Serine/threonine-protein phosphatase

Overview
NameSerine/threonine-protein phosphatase
Smed IDSMED30020485
Length (bp)2105
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein phosphatase (SMED30020485) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase (SMED30020485) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine-protein phosphatase (SMED30020485) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase (SMED30020485) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020485

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30020485SMESG000019044.1 SmedASXL_019511SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30020485SMESG000019044.1 SmedASXL_006624SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
posterior muscle cellSMED30020485SMESG000019044.1 dd_Smed_v4_3429_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30020485SMESG000019044.1 dd_Smed_v4_3429_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020485SMESG000019044.1 dd_Smed_v4_3429_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020485SMESG000019044.1 dd_Smed_v4_5206_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP5C (protein phosphatase 5 catalytic subunit [Source:HGNC Symbol;Acc:HGNC:9322])

HSP 1 Score: 632.484 bits (1630), Expect = 0.000e+0
Identity = 301/488 (61.68%), Postives = 377/488 (77.25%), Query Frame = 1
Query:  100 IQKAEEHKIKANEFFKNGDYNNAIVEYEKSIEIMPS-AVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEE-KKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRPMAYANSLLSM 1557
            +++AEE K +AN++FK  DY NAI  Y ++IE+ PS A+YY NRS AYL+TEC+GYAL DA  AI LD  Y+KGYYRRA++NMALGKF+ A +D+ETVV++  +DKDAKMK +EC KIV+++AFE+AIA +E K+S +D  DI  + IE  Y GP LE+ +VT              SFM  L+Q +K QKKLHRK A  IL Q+K+ LSKL +LVE  + ET K T+CGD HGQ++DL NIFE+NGLPS+ NPY+FNGDFVDRGSFSVE I TL GFKLLYP+HF++ RGNHE++NMNQ+YGFEGEVKAKY+  M E+F+EVF WLPLA  IN ++L MHGGLF ++ VTL+DI+ I+RNRQPP++G MCDLLWSDPQ   GR+ SKRGV CQFGPDVT+ F  +N LDYI+RSHEVK EGYE+ H  RCVTVFSAPNYCD M N+ +YI+++G   S + PQF  F  VPHPNV+PMAYAN+LL +
Sbjct:   25 LKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYSGPKLEDGKVTI-------------SFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQG---SDLRPQFHQFTAVPHPNVKPMAYANTLLQL 496          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP5C (protein phosphatase 5 catalytic subunit [Source:HGNC Symbol;Acc:HGNC:9322])

HSP 1 Score: 602.438 bits (1552), Expect = 0.000e+0
Identity = 289/475 (60.84%), Postives = 363/475 (76.42%), Query Frame = 1
Query:  100 IQKAEEHKIKANEFFKNGDYNNAIVEYEKSIEIMPS-AVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEE-KKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPN 1518
            +++AEE K +AN++FK  DY NAI  Y ++IE+ PS A+YY NRS AYL+TEC+GYAL DA  AI LD  Y+KGYYRRA++NMALGKF+ A +D+ETVV++  +DKDAKMK +EC KIV+++AFE+AIA +E K+S +D  DI  + IE  Y GP LE+ +VT              SFM  L+Q +K QKKLHRK A  IL Q+K+ LSKL +LVE  + ET K T+CGD HGQ++DL NIFE+NGLPS+ NPY+FNGDFVDRGSFSVE I TL GFKLLYP+HF++ RGNHE++NMNQ+YGFEGEVKAKY+  M E+F+EVF WLPLA  IN ++L MHGGLF ++ VTL+DI+ I+RNRQPP++G MCDLLWSDPQ   GR+ SKRGV CQFGPDVT+ F  +N LDYI+RSHEVK EGYE+ H  RCVTVFSAPNYCD M N+ +YI+++G   S + PQF  F  V  P+
Sbjct:   24 LKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYSGPKLEDGKVTI-------------SFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQG---SDLRPQFHQFTAVGRPS 482          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP5C (protein phosphatase 5 catalytic subunit [Source:HGNC Symbol;Acc:HGNC:9322])

HSP 1 Score: 499.204 bits (1284), Expect = 1.942e-172
Identity = 240/406 (59.11%), Postives = 298/406 (73.40%), Query Frame = 1
Query:  343 MALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEE-KKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRPMAYANSLLSM 1557
            MALGKF+ A +D+ETVV++  +DKDAKMK +EC KIV+++AFE+AIA +E K+S +D  DI  + IE  Y GP LE+ +VT              SFM  L+Q +K QKKLHRK A                       +T K T+CGD HGQ++DL NIFE+NGLPS+ NPY+FNGDFVDRGSFSVE I TL GFKLLYP+HF++ RGNHE++NMNQ+YGFEGEVKAKY+  M E+F+EVF WLPLA  IN ++L MHGGLF ++ VTL+DI+ I+RNRQPP++G MCDLLWSDPQ   GR+ SKRGV CQFGPDVT+ F  +N LDYI+RSHEVK EGYE+ H  RCVTVFSAPNYCD M N+ +YI+++G   S + PQF  F  VPHPNV+PMAYAN+LL +
Sbjct:    1 MALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYSGPKLEDGKVTI-------------SFMKELMQWYKDQKKLHRKCAY----------------------QTEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQG---SDLRPQFHQFTAVPHPNVKPMAYANTLLQL 368          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP1CC (protein phosphatase 1 catalytic subunit gamma [Source:HGNC Symbol;Acc:HGNC:9283])

HSP 1 Score: 219.55 bits (558), Expect = 5.937e-65
Identity = 119/293 (40.61%), Postives = 175/293 (59.73%), Query Frame = 1
Query:  691 IILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMS-RGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPN-VRPMAYANSLLSMLA 1563
            + LK  + +LS+ P L+E++ P      ICGDIHGQY+DL  +FE  G P + N YLF GD+VDRG  S+E I  LL +K+ YP +F++ RGNHE  ++N++YGF  E K +Y++ + + FT+ FN LP+A +++++I   HGGL  D   ++E I+ I R    P+ GL+CDLLWSDP     G   + RGV   FG +V  KF  ++ LD I R+H+V ++GYE     + VT+FSAPNYC    N GA +++  +       Q     E   PN  RP+     +++  A
Sbjct:   38 LCLKSREIFLSQ-PILLELEAP----LKICGDIHGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ-SMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSF--QILKPAEKKKPNATRPVTPPRGMITKQA 321          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP1CA (protein phosphatase 1 catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:9281])

HSP 1 Score: 218.779 bits (556), Expect = 1.358e-64
Identity = 112/255 (43.92%), Postives = 164/255 (64.31%), Query Frame = 1
Query:  691 IILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMS-RGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINI 1452
            + LK  + +LS+ P L+E++ P      ICGDIHGQY+DL  +FE  G P + N YLF GD+VDRG  S+E I  LL +K+ YP +F++ RGNHE  ++N++YGF  E K +Y++ + + FT+ FN LP+A +++++I   HGGL  D   ++E I+ I R    P+ GL+CDLLWSDP    +G   + RGV   FG +V  KF  ++ LD I R+H+V ++GYE     + VT+FSAPNYC    N GA +++
Sbjct:   38 LCLKSREIFLSQ-PILLELEAP----LKICGDIHGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ-SMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSV 285          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: pph-5 (Serine/threonine-protein phosphatase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q9NES8])

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 292/485 (60.21%), Postives = 367/485 (75.67%), Query Frame = 1
Query:  103 QKAEEHKIKANEFFKNGDYNNAIVEYEKSIEIMPSAVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVE-EKKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRPMAYANSLLS 1554
            +KA   K +AN+FFK+  Y+ A   Y  +IEI P+AV Y NR+ AYLK E +G AL DAD AI++DP+YVKG+YRRA+ANMALG+FK A  D++ VV++  NDKDA+ K +EC KIVRR+ FE AI+ + +KK+  +  DIN + IE SYDGP LE+               +T+ F+L LI+ FK Q+KLH+KYA  +L +  +Y+  LP++VEI VP   KFTICGD+HGQ++DLCNIFE+NG PS+ NPYLFNGDFVDRGSFSVE IFT++GFKLLYPNHF+M+RGNHES+ MN+MYGFEGEVKAKY+  M +MFTE F WLPL HLIN++I   HGGLF+++ VTLEDI+  DRNRQPP+ G+MCDLLWSDPQ   GR+PSKRGVGCQFGPDVT K+C  N ++Y+VRSHEVK EGYE+ H  +C TVFSAPNYCD M+N+GA+I I G     + P+F  F  VPHP + PMAYANSL  
Sbjct:   27 EKAGMIKDEANQFFKDQVYDVAADLYSVAIEIHPTAVLYGNRAQAYLKKELYGSALEDADNAIAIDPSYVKGFYRRATANMALGRFKKALTDYQAVVKVCPNDKDARAKFDECSKIVRRQKFEAAISTDHDKKTVAETLDINAMAIEDSYDGPRLED--------------KITKEFVLQLIKTFKNQQKLHKKYAFKMLLEFYNYVKSLPTMVEITVPTGKKFTICGDVHGQFYDLCNIFEINGYPSETNPYLFNGDFVDRGSFSVETIFTMIGFKLLYPNHFFMSRGNHESDVMNKMYGFEGEVKAKYTQQMCDMFTETFCWLPLCHLINEKIFVCHGGLFKEDGVTLEDIRKTDRNRQPPDEGIMCDLLWSDPQPINGRSPSKRGVGCQFGPDVTSKWCETNGIEYVVRSHEVKPEGYEMHHNGQCFTVFSAPNYCDQMNNKGAFITITG---DNLTPRFTPFDAVPHPKLPPMAYANSLFG 494          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: pef-1 (Serine/threonine-protein phosphatase with EF-hands pef-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EBX9])

HSP 1 Score: 231.106 bits (588), Expect = 6.157e-67
Identity = 134/364 (36.81%), Postives = 193/364 (53.02%), Query Frame = 1
Query:  487 EEKKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKY---SVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNR-----QPP-----------------ETGLMCDLLWSDPQMSRGRAPSK-RGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFK 1500
            E  K  L+ T    + I+ +Y GP L    +  DK +  +           +I+ FK  K LH KY L+IL + +     +PS+  I    +++ TICGD+HG++ DLC I   NG PS +NPY+FNGDFVDRG  S+E +  L    ++ P   Y+ RGNHE   MN  YGF  E+  KY   S  +  +  +VF+WLP+A +I++ I  +HGG+    +V+  D   I R+R     +PP                 E   M D++WSDP+ ++G  P+  RG G  FG D+T  F  ++    +VRSHE K EGYE +H + C+TVFSA NY +T  NRGAY+   G        Q+ + K
Sbjct:   36 ETVKKMLEDTSPTNVDIDRNYKGPTLS---LPLDKPQVAK-----------MIEAFKVNKVLHPKYVLMILHEARKIFKAMPSVSRISTSISNQVTICGDLHGKFDDLCIILYKNGYPSVDNPYIFNGDFVDRGGQSIEVLCVLFALVIVDPMSIYLNRGNHEDHIMNLRYGFIKELSTKYKDLSTPITRLLEDVFSWLPIATIIDRDIFVVHGGISDQTEVSKLD--KIPRHRFQSVLRPPVNKGMESEKENSAVNVDEWKQMLDIMWSDPKQNKGCWPNVFRGGGSYFGADITASFLEKHGFRLLVRSHECKFEGYEFSHNNTCLTVFSASNYYETGSNRGAYVKFIGKSKQPHFVQYMASK 383          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: pef-1 (Serine/threonine-protein phosphatase with EF-hands pef-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EBX9])

HSP 1 Score: 231.106 bits (588), Expect = 2.570e-66
Identity = 132/364 (36.26%), Postives = 192/364 (52.75%), Query Frame = 1
Query:  487 EEKKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKY---SVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNR-----QPP-----------------ETGLMCDLLWSDPQMSRGRAPSK-RGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFK 1500
            E  K  L+ T    + I+ +Y GP L              +  + +  +  +I+ FK  K LH KY L+IL + +     +PS+  I    +++ TICGD+HG++ DLC I   NG PS +NPY+FNGDFVDRG  S+E +  L    ++ P   Y+ RGNHE   MN  YGF  E+  KY   S  +  +  +VF+WLP+A +I++ I  +HGG+    +V+  D   I R+R     +PP                 E   M D++WSDP+ ++G  P+  RG G  FG D+T  F  ++    +VRSHE K EGYE +H + C+TVFSA NY +T  NRGAY+   G        Q+ + K
Sbjct:  106 ETVKKMLEDTSPTNVDIDRNYKGPTL--------------SLPLDKPQVAKMIEAFKVNKVLHPKYVLMILHEARKIFKAMPSVSRISTSISNQVTICGDLHGKFDDLCIILYKNGYPSVDNPYIFNGDFVDRGGQSIEVLCVLFALVIVDPMSIYLNRGNHEDHIMNLRYGFIKELSTKYKDLSTPITRLLEDVFSWLPIATIIDRDIFVVHGGISDQTEVSKLD--KIPRHRFQSVLRPPVNKGMESEKENSAVNVDEWKQMLDIMWSDPKQNKGCWPNVFRGGGSYFGADITASFLEKHGFRLLVRSHECKFEGYEFSHNNTCLTVFSASNYYETGSNRGAYVKFIGKSKQPHFVQYMASK 453          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: pef-1 (Serine/threonine-protein phosphatase with EF-hands pef-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EBX9])

HSP 1 Score: 231.106 bits (588), Expect = 7.731e-66
Identity = 132/364 (36.26%), Postives = 192/364 (52.75%), Query Frame = 1
Query:  487 EEKKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKY---SVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNR-----QPP-----------------ETGLMCDLLWSDPQMSRGRAPSK-RGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFK 1500
            E  K  L+ T    + I+ +Y GP L              +  + +  +  +I+ FK  K LH KY L+IL + +     +PS+  I    +++ TICGD+HG++ DLC I   NG PS +NPY+FNGDFVDRG  S+E +  L    ++ P   Y+ RGNHE   MN  YGF  E+  KY   S  +  +  +VF+WLP+A +I++ I  +HGG+    +V+  D   I R+R     +PP                 E   M D++WSDP+ ++G  P+  RG G  FG D+T  F  ++    +VRSHE K EGYE +H + C+TVFSA NY +T  NRGAY+   G        Q+ + K
Sbjct:  171 ETVKKMLEDTSPTNVDIDRNYKGPTL--------------SLPLDKPQVAKMIEAFKVNKVLHPKYVLMILHEARKIFKAMPSVSRISTSISNQVTICGDLHGKFDDLCIILYKNGYPSVDNPYIFNGDFVDRGGQSIEVLCVLFALVIVDPMSIYLNRGNHEDHIMNLRYGFIKELSTKYKDLSTPITRLLEDVFSWLPIATIIDRDIFVVHGGISDQTEVSKLD--KIPRHRFQSVLRPPVNKGMESEKENSAVNVDEWKQMLDIMWSDPKQNKGCWPNVFRGGGSYFGADITASFLEKHGFRLLVRSHECKFEGYEFSHNNTCLTVFSASNYYETGSNRGAYVKFIGKSKQPHFVQYMASK 518          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: gsp-1 (Serine/threonine-protein phosphatase PP1-alpha [Source:UniProtKB/Swiss-Prot;Acc:Q27497])

HSP 1 Score: 218.394 bits (555), Expect = 5.582e-65
Identity = 113/247 (45.75%), Postives = 158/247 (63.97%), Query Frame = 1
Query:  715 YLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMS-RGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINI 1452
            +LS+ P L+E++ P      ICGDIHGQY DL  +FE  G P + N YLF GD+VDRG  S+E I  LL +K+ YP +F++ RGNHE  ++N++YGF  E K ++S+ + + FT+ FN LP+A LI+++I   HGGL  D    +E I+ + R    P+TGL+CDLLWSDP     G   + RGV   FGPDV  KF  ++ LD I R+H+V ++GYE     + VT+FSAPNYC    N G  +++
Sbjct:   46 FLSQ-PILLELEAP----LKICGDIHGQYNDLLRLFEYGGFPPEAN-YLFLGDYVDRGKQSLETICLLLAYKVKYPENFFLLRGNHECASINRIYGFYDECKRRFSIKLWKTFTDCFNCLPIAALIDEKIFCCHGGLSPDLQ-NMEQIRRVMRPTDVPDTGLLCDLLWSDPDKDVTGWGENDRGVSFTFGPDVVAKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSV 285          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: PpD3 (gene:FBgn0005777 transcript:FBtr0082129)

HSP 1 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 299/488 (61.27%), Postives = 367/488 (75.20%), Query Frame = 1
Query:  109 AEEHKIKANEFFKNGDYNNAIVEYEKSIEIMP-SAVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEEKKSTLD--LTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRPMAYANSLLSMLA 1563
            AE++K + NE  K  +++ AI  Y K+IE+ P SA+YY+NRS A+L+ E FG+AL D   A+  DP Y+KGYYRRA+A+M+LGKFK A  DFE V +   NDKDAK+K  EC KIV+ RAFE+AIAV++ + TL    +D+  I IE  Y GP LE+ +VT               FM  L++H+K QK+LHRK+A  IL +I  Y+   PSLV+I VP+  KFTICGDIHGQ++DL NIFE+NGLPS++NPYLFNGDFVDRGSFSVECIFTL GFKLLYPNHF++ARGNHES NMNQMYGF GEV AKY+  M ++FT+VFNWLPL H IN++IL MHGGLF  EDVTL+ I+ I+RN QPPE GLMC+LLWSDPQ   G   SKRGVG QFGPDVTEKFC  N LDYI+RSHEVKD GYE+ H  +C+TVFSAPNYCDTM N GA+I I G   + + P + SF+ VPHP+V+PMAYANSL++ LA
Sbjct:   49 AEQYKNQGNEMLKTKEFSKAIDMYTKAIELHPNSAIYYANRSLAHLRQESFGFALQDGVSAVKADPAYLKGYYRRAAAHMSLGKFKQALCDFEFVAKCRPNDKDAKLKFTECNKIVKMRAFERAIAVDKPEKTLSEMYSDMENITIEDDYKGPQLEDGKVTL-------------KFMKELMEHYKAQKRLHRKFAYKILCEIDTYMRAQPSLVDITVPDEEKFTICGDIHGQFYDLMNIFEINGLPSEKNPYLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFLARGNHESINMNQMYGFTGEVTAKYTSAMADIFTQVFNWLPLCHCINQKILVMHGGLFSTEDVTLDHIRRIERNCQPPEEGLMCELLWSDPQQWMGLGQSKRGVGIQFGPDVTEKFCKDNNLDYIIRSHEVKDMGYEVAHNGKCITVFSAPNYCDTMGNMGAFITITG---NNLKPNYKSFEAVPHPDVKPMAYANSLMNWLA 520          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: PpD3 (gene:FBgn0005777 transcript:FBtr0082128)

HSP 1 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 299/488 (61.27%), Postives = 367/488 (75.20%), Query Frame = 1
Query:  109 AEEHKIKANEFFKNGDYNNAIVEYEKSIEIMP-SAVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEEKKSTLD--LTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRPMAYANSLLSMLA 1563
            AE++K + NE  K  +++ AI  Y K+IE+ P SA+YY+NRS A+L+ E FG+AL D   A+  DP Y+KGYYRRA+A+M+LGKFK A  DFE V +   NDKDAK+K  EC KIV+ RAFE+AIAV++ + TL    +D+  I IE  Y GP LE+ +VT               FM  L++H+K QK+LHRK+A  IL +I  Y+   PSLV+I VP+  KFTICGDIHGQ++DL NIFE+NGLPS++NPYLFNGDFVDRGSFSVECIFTL GFKLLYPNHF++ARGNHES NMNQMYGF GEV AKY+  M ++FT+VFNWLPL H IN++IL MHGGLF  EDVTL+ I+ I+RN QPPE GLMC+LLWSDPQ   G   SKRGVG QFGPDVTEKFC  N LDYI+RSHEVKD GYE+ H  +C+TVFSAPNYCDTM N GA+I I G   + + P + SF+ VPHP+V+PMAYANSL++ LA
Sbjct:   49 AEQYKNQGNEMLKTKEFSKAIDMYTKAIELHPNSAIYYANRSLAHLRQESFGFALQDGVSAVKADPAYLKGYYRRAAAHMSLGKFKQALCDFEFVAKCRPNDKDAKLKFTECNKIVKMRAFERAIAVDKPEKTLSEMYSDMENITIEDDYKGPQLEDGKVTL-------------KFMKELMEHYKAQKRLHRKFAYKILCEIDTYMRAQPSLVDITVPDEEKFTICGDIHGQFYDLMNIFEINGLPSEKNPYLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFLARGNHESINMNQMYGFTGEVTAKYTSAMADIFTQVFNWLPLCHCINQKILVMHGGLFSTEDVTLDHIRRIERNCQPPEEGLMCELLWSDPQQWMGLGQSKRGVGIQFGPDVTEKFCKDNNLDYIIRSHEVKDMGYEVAHNGKCITVFSAPNYCDTMGNMGAFITITG---NNLKPNYKSFEAVPHPDVKPMAYANSLMNWLA 520          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: PpD3 (gene:FBgn0005777 transcript:FBtr0331693)

HSP 1 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 299/488 (61.27%), Postives = 367/488 (75.20%), Query Frame = 1
Query:  109 AEEHKIKANEFFKNGDYNNAIVEYEKSIEIMP-SAVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEEKKSTLD--LTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRPMAYANSLLSMLA 1563
            AE++K + NE  K  +++ AI  Y K+IE+ P SA+YY+NRS A+L+ E FG+AL D   A+  DP Y+KGYYRRA+A+M+LGKFK A  DFE V +   NDKDAK+K  EC KIV+ RAFE+AIAV++ + TL    +D+  I IE  Y GP LE+ +VT               FM  L++H+K QK+LHRK+A  IL +I  Y+   PSLV+I VP+  KFTICGDIHGQ++DL NIFE+NGLPS++NPYLFNGDFVDRGSFSVECIFTL GFKLLYPNHF++ARGNHES NMNQMYGF GEV AKY+  M ++FT+VFNWLPL H IN++IL MHGGLF  EDVTL+ I+ I+RN QPPE GLMC+LLWSDPQ   G   SKRGVG QFGPDVTEKFC  N LDYI+RSHEVKD GYE+ H  +C+TVFSAPNYCDTM N GA+I I G   + + P + SF+ VPHP+V+PMAYANSL++ LA
Sbjct:   49 AEQYKNQGNEMLKTKEFSKAIDMYTKAIELHPNSAIYYANRSLAHLRQESFGFALQDGVSAVKADPAYLKGYYRRAAAHMSLGKFKQALCDFEFVAKCRPNDKDAKLKFTECNKIVKMRAFERAIAVDKPEKTLSEMYSDMENITIEDDYKGPQLEDGKVTL-------------KFMKELMEHYKAQKRLHRKFAYKILCEIDTYMRAQPSLVDITVPDEEKFTICGDIHGQFYDLMNIFEINGLPSEKNPYLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFLARGNHESINMNQMYGFTGEVTAKYTSAMADIFTQVFNWLPLCHCINQKILVMHGGLFSTEDVTLDHIRRIERNCQPPEEGLMCELLWSDPQQWMGLGQSKRGVGIQFGPDVTEKFCKDNNLDYIIRSHEVKDMGYEVAHNGKCITVFSAPNYCDTMGNMGAFITITG---NNLKPNYKSFEAVPHPDVKPMAYANSLMNWLA 520          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: PpD5 (gene:FBgn0005778 transcript:FBtr0071806)

HSP 1 Score: 219.935 bits (559), Expect = 4.016e-65
Identity = 116/275 (42.18%), Postives = 169/275 (61.45%), Query Frame = 1
Query:  715 YLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGR-APSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRPMAY 1536
            +LS+ P L+E+  P      ICGD+HGQ+ DL  IF+  G+P   N YLF GD+VDRG  S+E +  LL +KL YP  F++ RGNHES ++N++YGF  E K +YS+ +   F + ++ +P+A +I  RI  +HGGL  D +  L+DI+ ++R    P  GL+CDLLWSDP  + G  A + RGV   FG ++ E F  Q+K + IVR+H+V ++GYE     + VT+FSAPNYCD   N GA + +    ++K+   F   +  P P  RP  +
Sbjct:   61 FLSQ-PMLLELSAP----VKICGDLHGQFKDLLRIFQQCGVPPLSN-YLFLGDYVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGFFDECKRRYSIKLWRSFVDCYDCMPVAAIIADRIFCVHGGLSPDLN-NLDDIRRLNRPTDVPSDGLLCDLLWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQLVTIFSAPNYCDIFDNCGAVLVV----DAKLVCHFVIIR--PRPFSRPTGF 322          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: rdgC (gene:FBgn0265959 transcript:FBtr0342946)

HSP 1 Score: 227.639 bits (579), Expect = 9.187e-65
Identity = 120/307 (39.09%), Postives = 181/307 (58.96%), Query Frame = 1
Query:  640 LIQHFKQQK--KLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVT---MVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNR-----QPP----------ETGLMCDLLWSDPQMSRGRAPSK-RGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSF 1497
            LI  F++++  +LH KY  +IL++    L +LP++  +    + + T+CGD+HG+  DL  +   NGLPS  NPY+FNGDFVDRG   +E +  LL   L +PN  ++ RGNHE   MN  YGF  EV++KY      ++    EV+ WLPL  ++N R+L +HGG    +  +L+ IK+IDR +     +PP          E   + D++WSDPQ + G  P+  RG G  FGPDVT+ F  +++L Y++RSHE K  G+E  H ++ +T+FSA NY     N+GAYI +    N+++ P F  +
Sbjct:  108 LIDVFRKKRGNRLHPKYVALILREAAKSLKQLPNISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGF--SDSTSLDLIKSIDRGKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRL----NNQLMPHFVQY 408          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-050327-75])

HSP 1 Score: 645.966 bits (1665), Expect = 0.000e+0
Identity = 308/485 (63.51%), Postives = 378/485 (77.94%), Query Frame = 1
Query:  109 AEEHKIKANEFFKNGDYNNAIVEYEKSIEIMPS-AVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEE-KKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRPMAYANSLLSM 1557
            AE+ K KAN++FK+ DY NAI  Y +++++ P+  +YYSNRS +YL+TEC+GYAL DA  A+ LD NY+KGYYRRA++NMALGKFK A +D+ETVVR+  NDKDAKMK +EC KIV+++AFE+AIA +E K+S +D  DI  + IE  Y GP LE+ +VT               FM  L+  FK QKKLHRK A  IL Q+K+ L+KLPSLVEI + E+ K TICGD HGQY+DL NIFE+N LPS  NPYLFNGDFVDRGSFSVE I TL GFKLLYP HF++ RGNHE++NMNQMYGFEGEVKAKYS  M ++F+EVF WLPLA  IN ++L MHGGLF ++ VTL+DI+ IDRNRQPP++G MCDLLWSDPQ+  GR+ SKRGV CQFGPDVTE+F  QNKL+YIVRSHEVK EGYE+TH  +C+TVFSAPNYCD M N+GAYI+++G   S + P+F  F  VPHPNV+PMAYANSL+ M
Sbjct:   18 AEKLKEKANDYFKDKDYENAIKYYTEALDLNPTNPIYYSNRSLSYLRTECYGYALADATRALELDKNYLKGYYRRATSNMALGKFKAALKDYETVVRVRPNDKDAKMKYQECNKIVKQKAFERAIASDELKRSVVDSLDIENMTIEDDYAGPKLEDGKVTL-------------KFMEDLMDWFKDQKKLHRKCAYQILVQVKEVLTKLPSLVEITLKESEKITICGDTHGQYYDLLNIFELNSLPSPTNPYLFNGDFVDRGSFSVEVILTLFGFKLLYPEHFHLLRGNHETDNMNQMYGFEGEVKAKYSSQMFKLFSEVFQWLPLAQCINDKVLVMHGGLFSEDGVTLDDIRKIDRNRQPPDSGPMCDLLWSDPQLQNGRSISKRGVSCQFGPDVTERFLEQNKLEYIVRSHEVKAEGYEVTHSGKCITVFSAPNYCDQMGNKGAYIHLRG---SDLKPEFHQFTAVPHPNVKPMAYANSLMQM 486          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-030616-609])

HSP 1 Score: 218.394 bits (555), Expect = 8.966e-65
Identity = 113/258 (43.80%), Postives = 164/258 (63.57%), Query Frame = 1
Query:  691 IILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMS-RGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGS 1461
            + +K  + +LS+ P L+E++ P      ICGDIHGQY DL  +FE  G P + N YLF GD+VDRG  S+E I  LL +K+ YP +F++ RGNHE  ++N++YGF  E K ++++ + + FT+ FN LP+A +I+++I   HGGL  D   ++E I+ I R    P+TGL+CDLLWSDP    +G   + RGV   FG DV  KF  ++ LD I R+H+V ++GYE     + VT+FSAPNYC    N G  +++  S
Sbjct:   37 LCIKSREIFLSQ-PILLELEAP----LKICGDIHGQYTDLLRLFEYGGFPPEAN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQ-SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDES 287          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: CABZ01076667.1 (protein phosphatase 1, catalytic subunit, gamma isozyme [Source:NCBI gene;Acc:571753])

HSP 1 Score: 218.394 bits (555), Expect = 9.516e-65
Identity = 117/292 (40.07%), Postives = 179/292 (61.30%), Query Frame = 1
Query:  691 IILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMS-RGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRPMAYANSLLSMLA 1563
            + LK  + +LS+ P L+E++ P      ICGDIHGQY+DL  +FE  G P + N YLF GD+VDRG  S+E I  LL +K+ YP +F++ RGNHE  ++N++YGF  E + +Y++ + + FT+ FN LP+A +++++I   HGGL  D   ++E I+ I R    P+ GL+CDLLWSDP     G   + RGV   FG +V  KF  ++ LD I R+H+V ++GYE     + VT+FSAPNYC    N GA +++  +          + K+ P+P+ RP+    ++++  A
Sbjct:   38 LCLKSREIFLSQ-PILLELEAP----LKICGDIHGQYYDLLRLFEYGGYPPESN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECRRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ-SMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNPS-RPVTPPRNMVTKQA 321          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp1cab (protein phosphatase 1, catalytic subunit, alpha isozyme b [Source:ZFIN;Acc:ZDB-GENE-030131-5512])

HSP 1 Score: 216.083 bits (549), Expect = 8.775e-64
Identity = 109/255 (42.75%), Postives = 163/255 (63.92%), Query Frame = 1
Query:  691 IILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMS-RGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINI 1452
            + LK  + +LS+ P L+E++ P      ICGD+HGQY+DL  +FE  G P + N YLF GD+VDRG  S+E I  LL +K+ YP +F++ RGNHE  ++N++YGF  E K +Y++ + + FT+ FN LP+A +++++I   HGGL  D   ++E I+ + R    P+ GL+CDLLW+DP     G   + RGV   FG DV  KF  ++ +D I R+H+V ++GYE     + VT+FSAPNYC    N GA +++
Sbjct:   38 LCLKSREIFLSQ-PILLELEAP----LKICGDVHGQYYDLLRLFEYGGYPPESN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQ-SMEQIRRVMRPTDVPDQGLLCDLLWADPDKDVMGWGENDRGVSFTFGSDVVAKFLHKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSV 285          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp1caa (protein phosphatase 1, catalytic subunit, alpha isozyme a [Source:ZFIN;Acc:ZDB-GENE-040516-3])

HSP 1 Score: 216.083 bits (549), Expect = 8.886e-64
Identity = 108/255 (42.35%), Postives = 163/255 (63.92%), Query Frame = 1
Query:  691 IILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMS-RGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINI 1452
            + LK  + +LS+ P L+E++ P      ICGD+HGQY+DL  +FE  G P + N YLF GD+VDRG  S+E I  LL +K+ YP +F++ RGNHE  ++N++YGF  E K +Y++ + + FT+ FN LP+A +++++I   HGGL  D   ++E ++ + R    P+ GL+CDLLW+DP     G   + RGV   FG DV  KF  ++ +D I R+H+V ++GYE     + VT+FSAPNYC    N GA +++
Sbjct:   38 LCLKSREIFLSQ-PILLELEAP----LKICGDVHGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKVKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQ-SMEQVRRVMRPTDVPDQGLLCDLLWADPDKDVLGWGENDRGVSFTFGADVVAKFLHKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSV 285          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:NCBI gene;Acc:493275])

HSP 1 Score: 622.468 bits (1604), Expect = 0.000e+0
Identity = 294/490 (60.00%), Postives = 373/490 (76.12%), Query Frame = 1
Query:   94 SKIQKAEEHKIKANEFFKNGDYNNAIVEYEKSIEIMP-SAVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEE-KKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRPMAYANSLLSM 1557
            S+ + AEE K +ANE+F+  DY+ A+  Y ++I + P +A+YY NRS AYL+TEC+GYAL DA  AI LD  Y+KGYYRRA++NMALGK K A +D+ETVV++  +DKDA+MK +EC K+VR++AFE+AIA E+  +S +D  DI  + IE  Y GP L++  VT D             FML L+Q +K QKKLHRK    +L Q+KD LSKLPSLVEI + ++ + T+CGD HGQ++DL NIF +NGLPS+ NPY+FNGDFVDRGSFSVE I TL GFKLLYP HF++ RGNHE++ MNQMYGFEGEVKAKYS  M ++F+EVF WLPLA  +N+R+L MHGGLF ++ VTL+ I++I+RNRQPP++G MCDLLWSDPQ   GR+ SKRGV CQFGPDVT +F  +N LDYI+RSHEVK EGYE++H   CVTVFSAPNYCD M N+GAYI++ G   S + P+F  F+ VPHPNV+PM YANSLL M
Sbjct:   35 SREKTAEELKEQANEYFRVKDYDRAVQYYTQAIGLSPDTAIYYGNRSLAYLRTECYGYALADASRAIQLDAKYIKGYYRRAASNMALGKLKAALKDYETVVKVRPHDKDAQMKFQECSKLVRQKAFERAIACEQHNRSVVDSLDIEGMTIEDEYTGPQLKDGNVTID-------------FMLELMQFYKDQKKLHRKCVYQMLVQVKDILSKLPSLVEISLEKSQQVTVCGDTHGQFYDLMNIFHLNGLPSENNPYIFNGDFVDRGSFSVEVIVTLFGFKLLYPAHFHLLRGNHETDTMNQMYGFEGEVKAKYSAQMFQLFSEVFQWLPLAMCVNQRVLIMHGGLFSEDGVTLDQIRSIERNRQPPDSGPMCDLLWSDPQPQDGRSSSKRGVSCQFGPDVTRRFLEENGLDYIIRSHEVKPEGYEVSHNGLCVTVFSAPNYCDQMGNKGAYIHLNG---SDLKPKFHQFEAVPHPNVKPMMYANSLLQM 508          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:NCBI gene;Acc:493275])

HSP 1 Score: 597.045 bits (1538), Expect = 0.000e+0
Identity = 289/492 (58.74%), Postives = 369/492 (75.00%), Query Frame = 1
Query:   94 SKIQKAEEHKIKANEFFKNGDYNNAIVEYEKSIEIMP-SAVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEE-KKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLM--CDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRPMAYANSLLSM 1557
            S+ + AEE K +ANE+F+  DY+ A+  Y ++I + P +A+YY NRS AYL+TEC+GYAL DA  AI LD  Y+KGYYRRA++NMALGK K A +D+ETVV++  +DKDA+MK +EC K+VR++AFE+AIA E+  +S +D  DI  + IE  Y GP L++  VT D             FML L+Q +K QKKLHRK    +L Q+KD LSKLPSLVEI + ++ + T+CGD HGQ++DL NIF +NGLPS+ NPY+FNGDFVDRGSFSVE I TL GFKLLYP HF++ RGNHE++ MNQMYGFEGEVKAKYS  M ++F+EVF WLPLA  +N+R+L MHGGLF ++ VTL+ I++I+RNRQPP++G+     LL S P  S GR+ SKRGV CQFGPDVT +F  +N LDYI+RSHEVK EGYE++H   CVTVFSAPNYCD M N+GAYI++ G   S + P+F  F+ VPHPNV+PM YANSLL M
Sbjct:   35 SREKTAEELKEQANEYFRVKDYDRAVQYYTQAIGLSPDTAIYYGNRSLAYLRTECYGYALADASRAIQLDAKYIKGYYRRAASNMALGKLKAALKDYETVVKVRPHDKDAQMKFQECSKLVRQKAFERAIACEQHNRSVVDSLDIEGMTIEDEYTGPQLKDGNVTID-------------FMLELMQFYKDQKKLHRKCVYQMLVQVKDILSKLPSLVEISLEKSQQVTVCGDTHGQFYDLMNIFHLNGLPSENNPYIFNGDFVDRGSFSVEVIVTLFGFKLLYPAHFHLLRGNHETDTMNQMYGFEGEVKAKYSAQMFQLFSEVFQWLPLAMCVNQRVLIMHGGLFSEDGVTLDQIRSIERNRQPPDSGVTLVLLLLLSFPIFSDGRSSSKRGVSCQFGPDVTRRFLEENGLDYIIRSHEVKPEGYEVSHNGLCVTVFSAPNYCDQMGNKGAYIHLNG---SDLKPKFHQFEAVPHPNVKPMMYANSLLQM 510          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:NCBI gene;Acc:493275])

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 275/474 (58.02%), Postives = 346/474 (73.00%), Query Frame = 1
Query:  142 FKNGDYNNAIVEYEKSIEIMP-SAVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEE-KKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRPMAYANSLLSM 1557
            FK  DY+ A+  Y ++I + P +A+YY NRS AYL+TEC+GYAL DA  AI LD  Y+KGYYRRA++NMALGK K A +D+ETVV++  +DKDA+MK +EC K+VR++AFE+AIA E+  +S +D  DI  + IE  Y GP L++  VT D             FML L+Q +K QKKLHRK     + Q++  LS                 +CGD HGQ++DL NIF +NGLPS+ NPY+FNGDFVDRGSFSVE I TL GFKLLYP HF++ RGNHE++ MNQMYGFEGEVKAKYS  M ++F+EVF WLPLA  +N+R+L MHGGLF ++ VTL+ I++I+RNRQPP++G MCDLLWSDPQ   GR+ SKRGV CQFGPDVT +F  +N LDYI+RSHEVK EGYE++H   CVTVFSAPNYCD M N+GAYI++ G   S + P+F  F+ VPHPNV+PM YANSLL M
Sbjct:   34 FKMLDYDRAVQYYTQAIGLSPDTAIYYGNRSLAYLRTECYGYALADASRAIQLDAKYIKGYYRRAASNMALGKLKAALKDYETVVKVRPHDKDAQMKFQECSKLVRQKAFERAIACEQHNRSVVDSLDIEGMTIEDEYTGPQLKDGNVTID-------------FMLELMQFYKDQKKLHRK----CVYQVRFCLS---------------LYMCGDTHGQFYDLMNIFHLNGLPSENNPYIFNGDFVDRGSFSVEVIVTLFGFKLLYPAHFHLLRGNHETDTMNQMYGFEGEVKAKYSAQMFQLFSEVFQWLPLAMCVNQRVLIMHGGLFSEDGVTLDQIRSIERNRQPPDSGPMCDLLWSDPQPQDGRSSSKRGVSCQFGPDVTRRFLEENGLDYIIRSHEVKPEGYEVSHNGLCVTVFSAPNYCDQMGNKGAYIHLNG---SDLKPKFHQFEAVPHPNVKPMMYANSLLQM 472          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp1cc (protein phosphatase 1, catalytic subunit, gamma isozyme [Source:NCBI gene;Acc:407879])

HSP 1 Score: 219.164 bits (557), Expect = 5.546e-65
Identity = 119/293 (40.61%), Postives = 175/293 (59.73%), Query Frame = 1
Query:  691 IILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMS-RGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNV-RPMAYANSLLSMLA 1563
            + LK  + +LS+ P L+E++ P      ICGDIHGQY+DL  +FE  G P + N YLF GD+VDRG  S+E I  LL +K+ YP +F++ RGNHE  ++N++YGF  E K +Y++ + + FT+ FN LP+A +++++I   HGGL  D   ++E I+ I R    P+ GL+CDLLWSDP     G   + RGV   FG +V  KF  ++ LD I R+H+V ++GYE     + VT+FSAPNYC    N GA +++  +       Q     E   PN  RP+     +++  A
Sbjct:   26 LCLKSREIFLSQ-PILLELEAP----LKICGDIHGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ-SMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSF--QILKPAEKKKPNASRPVTPPRGMITKQA 309          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp1cc (protein phosphatase 1, catalytic subunit, gamma isozyme [Source:NCBI gene;Acc:407879])

HSP 1 Score: 219.164 bits (557), Expect = 6.905e-65
Identity = 119/293 (40.61%), Postives = 175/293 (59.73%), Query Frame = 1
Query:  691 IILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMS-RGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNV-RPMAYANSLLSMLA 1563
            + LK  + +LS+ P L+E++ P      ICGDIHGQY+DL  +FE  G P + N YLF GD+VDRG  S+E I  LL +K+ YP +F++ RGNHE  ++N++YGF  E K +Y++ + + FT+ FN LP+A +++++I   HGGL  D   ++E I+ I R    P+ GL+CDLLWSDP     G   + RGV   FG +V  KF  ++ LD I R+H+V ++GYE     + VT+FSAPNYC    N GA +++  +       Q     E   PN  RP+     +++  A
Sbjct:   38 LCLKSREIFLSQ-PILLELEAP----LKICGDIHGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ-SMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSF--QILKPAEKKKPNASRPVTPPRGMITKQA 321          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp5c (protein phosphatase 5, catalytic subunit [Source:MGI Symbol;Acc:MGI:102666])

HSP 1 Score: 629.787 bits (1623), Expect = 0.000e+0
Identity = 298/488 (61.07%), Postives = 377/488 (77.25%), Query Frame = 1
Query:  100 IQKAEEHKIKANEFFKNGDYNNAIVEYEKSIEIMP-SAVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEE-KKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRPMAYANSLLSM 1557
            +++AEE K +AN++FK  DY NAI  Y ++IE+ P +A+YY NRS AYL+TEC+GYAL DA  AI LD  Y+KGYYRRA++NMALGKF+ A +D+ETVV++  NDKDAKMK +EC KIV+++AFE+AIA +E ++S +D  DI  + IE  Y GP LE+ +VT              +FM  L+Q +K QKKLHRK A  IL Q+K+ L KL +LVE  + ET K T+CGD HGQ++DL NIFE+NGLPS+ NPY+FNGDFVDRGSFSVE I TL GFKLLYP+HF++ RGNHE++NMNQ+YGFEGEVKAKY+  M E+F+EVF WLPLA  IN ++L MHGGLF ++ VTL+DI+ I+RNRQPP++G MCDLLWSDPQ   GR+ SKRGV CQFGPDVT+ F  +N+LDYI+RSHEVK EGYE+ H  RCVTVFSAPNYCD M N+ +YI+++G   S + PQF  F  VPHPNV+PMAYAN+LL +
Sbjct:   25 LKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPGNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPNDKDAKMKYQECSKIVKQKAFERAIAGDEHRRSVVDSLDIESMTIEDEYSGPKLEDGKVTI-------------TFMKDLMQWYKDQKKLHRKCAYQILVQVKEVLCKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSVSKRGVSCQFGPDVTKAFLEENQLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQG---SDLRPQFHQFTAVPHPNVKPMAYANTLLQL 496          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp5c (protein phosphatase 5, catalytic subunit [Source:MGI Symbol;Acc:MGI:102666])

HSP 1 Score: 598.971 bits (1543), Expect = 0.000e+0
Identity = 287/488 (58.81%), Postives = 363/488 (74.39%), Query Frame = 1
Query:  100 IQKAEEHKIKANEFFKNGDYNNAIVEYEKSIEIMP-SAVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEE-KKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRPMAYANSLLSM 1557
            +++AEE K +AN++FK  DY NAI  Y ++IE+ P +A+YY NRS AYL+TEC+GYAL DA  AI LD  Y+KGYYRRA++NMALGKF+ A +D+ETVV++  NDKDAKMK +EC KIV+++AFE+AIA +E ++S +D  DI  + IE  Y GP LE+ +VT              +FM  L+Q +K QKKLHRK A                       +T K T+CGD HGQ++DL NIFE+NGLPS+ NPY+FNGDFVDRGSFSVE I TL GFKLLYP+HF++ RGNHE++NMNQ+YGFEGEVKAKY+  M E+F+EVF WLPLA  IN ++L MHGGLF ++ VTL+DI+ I+RNRQPP++G MCDLLWSDPQ   GR+ SKRGV CQFGPDVT+ F  +N+LDYI+RSHEVK EGYE+ H  RCVTVFSAPNYCD M N+ +YI+++G   S + PQF  F  VPHPNV+PMAYAN+LL +
Sbjct:   24 LKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPGNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPNDKDAKMKYQECSKIVKQKAFERAIAGDEHRRSVVDSLDIESMTIEDEYSGPKLEDGKVTI-------------TFMKDLMQWYKDQKKLHRKCAY----------------------QTEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSVSKRGVSCQFGPDVTKAFLEENQLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQG---SDLRPQFHQFTAVPHPNVKPMAYANTLLQL 473          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppef1 (protein phosphatase with EF hand calcium-binding domain 1 [Source:MGI Symbol;Acc:MGI:1097157])

HSP 1 Score: 238.424 bits (607), Expect = 1.081e-68
Identity = 139/380 (36.58%), Postives = 202/380 (53.16%), Query Frame = 1
Query:  529 IIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSV---TMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNR-----QPP-----ETG--------------------------------LMCDLLWSDPQMSRGRAP-SKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRPM 1530
            I +  SYDGP L+              + +T + +  L+Q FKQQ+ LH  Y L +L + +  L ++P+   +      + TICGD+HG+  DL  IF  NGLPS+ NPY+FNGDFVDRG+ S+E +  LL   L+YP+  ++ RGNHE   MN  YGF  E+  KY +    ++++  EV+ WLP+  +I+  IL +HGG+   E   L  +  + RN+      PP     ETG                                 + D+LWSDP+  +G  P + RG GC FGPDVT K   +N+L  ++RSHE K +GYE++H  + +TVFSA NY +   NRGAYI +  SY +   PQFF ++      + P+
Sbjct:  104 IEVPDSYDGPRLQ--------------FPLTFTDIHILLQAFKQQQILHAHYVLEVLFEARKVLKQMPNFSHVKTFPAKEITICGDLHGKLDDLMLIFYKNGLPSENNPYVFNGDFVDRGNNSMEILMILLVCFLVYPSDLHLNRGNHEDFMMNLRYGFTKEILQKYKLHGRKILQVLEEVYTWLPIGTIIDNEILVIHGGI--SESTDLNTLHQLQRNKMKSVLMPPVLGNQETGEKRNKSASNYVEPRKVEPDKTPSEDLTKQEWEQIVDILWSDPRGKKGCYPNTSRGGGCYFGPDVTSKVLSKNQLKMLIRSHECKPDGYEVSHDGKVITVFSASNYYEEGSNRGAYIRL--SYGT--MPQFFQYQVTSTSCLNPL 463          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp1cc (protein phosphatase 1 catalytic subunit gamma [Source:MGI Symbol;Acc:MGI:104872])

HSP 1 Score: 219.55 bits (558), Expect = 4.293e-65
Identity = 119/293 (40.61%), Postives = 175/293 (59.73%), Query Frame = 1
Query:  691 IILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMS-RGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPN-VRPMAYANSLLSMLA 1563
            + LK  + +LS+ P L+E++ P      ICGDIHGQY+DL  +FE  G P + N YLF GD+VDRG  S+E I  LL +K+ YP +F++ RGNHE  ++N++YGF  E K +Y++ + + FT+ FN LP+A +++++I   HGGL  D   ++E I+ I R    P+ GL+CDLLWSDP     G   + RGV   FG +V  KF  ++ LD I R+H+V ++GYE     + VT+FSAPNYC    N GA +++  +       Q     E   PN  RP+     +++  A
Sbjct:   38 LCLKSREIFLSQ-PILLELEAP----LKICGDIHGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ-SMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSF--QILKPAEKKKPNATRPVTPPRGMITKQA 321          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp1ca (protein phosphatase 1 catalytic subunit alpha [Source:MGI Symbol;Acc:MGI:103016])

HSP 1 Score: 218.779 bits (556), Expect = 8.317e-65
Identity = 112/255 (43.92%), Postives = 164/255 (64.31%), Query Frame = 1
Query:  691 IILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMS-RGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINI 1452
            + LK  + +LS+ P L+E++ P      ICGDIHGQY+DL  +FE  G P + N YLF GD+VDRG  S+E I  LL +K+ YP +F++ RGNHE  ++N++YGF  E K +Y++ + + FT+ FN LP+A +++++I   HGGL  D   ++E I+ I R    P+ GL+CDLLWSDP    +G   + RGV   FG +V  KF  ++ LD I R+H+V ++GYE     + VT+FSAPNYC    N GA +++
Sbjct:   38 LCLKSREIFLSQ-PILLELEAP----LKICGDIHGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKIRYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ-SMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSV 285          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|P53041|PPP5_HUMAN (Serine/threonine-protein phosphatase 5 OS=Homo sapiens OX=9606 GN=PPP5C PE=1 SV=1)

HSP 1 Score: 632.484 bits (1630), Expect = 0.000e+0
Identity = 301/488 (61.68%), Postives = 377/488 (77.25%), Query Frame = 1
Query:  100 IQKAEEHKIKANEFFKNGDYNNAIVEYEKSIEIMPS-AVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEE-KKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRPMAYANSLLSM 1557
            +++AEE K +AN++FK  DY NAI  Y ++IE+ PS A+YY NRS AYL+TEC+GYAL DA  AI LD  Y+KGYYRRA++NMALGKF+ A +D+ETVV++  +DKDAKMK +EC KIV+++AFE+AIA +E K+S +D  DI  + IE  Y GP LE+ +VT              SFM  L+Q +K QKKLHRK A  IL Q+K+ LSKL +LVE  + ET K T+CGD HGQ++DL NIFE+NGLPS+ NPY+FNGDFVDRGSFSVE I TL GFKLLYP+HF++ RGNHE++NMNQ+YGFEGEVKAKY+  M E+F+EVF WLPLA  IN ++L MHGGLF ++ VTL+DI+ I+RNRQPP++G MCDLLWSDPQ   GR+ SKRGV CQFGPDVT+ F  +N LDYI+RSHEVK EGYE+ H  RCVTVFSAPNYCD M N+ +YI+++G   S + PQF  F  VPHPNV+PMAYAN+LL +
Sbjct:   25 LKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYSGPKLEDGKVTI-------------SFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQG---SDLRPQFHQFTAVPHPNVKPMAYANTLLQL 496          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|P53042|PPP5_RAT (Serine/threonine-protein phosphatase 5 OS=Rattus norvegicus OX=10116 GN=Ppp5c PE=1 SV=1)

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 299/488 (61.27%), Postives = 377/488 (77.25%), Query Frame = 1
Query:  100 IQKAEEHKIKANEFFKNGDYNNAIVEYEKSIEIMPS-AVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEE-KKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRPMAYANSLLSM 1557
            +++AEE K +AN++FK  DY NAI  Y ++IE+ PS A+YY NRS AYL+TEC+GYAL DA  AI LD  Y+KGYYRRA++NMALGKF+ A +D+ETVV++  NDKDAKMK +EC KIV+++AFE+AIA +E ++S +D  DI  + IE  Y GP LE+ +VT              +FM  L+Q +K QKKLHRK A  IL Q+K+ L KL +LVE  + ET K T+CGD HGQ++DL NIFE+NGLPS+ NPY+FNGDFVDRGSFSVE I TL GFKLLYP+HF++ RGNHE++NMNQ+YGFEGEVKAKY+  M E+F+EVF WLPLA  IN ++L MHGGLF ++ VTL+DI+ I+RNRQPP++G MCDLLWSDPQ   GR+ SKRGV CQFGPDVT+ F  +N+LDYI+RSHEVK EGYE+ H  RCVTVFSAPNYCD M N+ +YI+++G   S + PQF  F  VPHPNV+PMAYAN+LL +
Sbjct:   25 LKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPNDKDAKMKYQECSKIVKQKAFERAIAGDEHRRSVVDSLDIESMTIEDEYSGPKLEDGKVTI-------------TFMKDLMQWYKDQKKLHRKCAYQILVQVKEVLCKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSVSKRGVSCQFGPDVTKAFLEENQLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQG---SDLRPQFHQFTAVPHPNVKPMAYANTLLQL 496          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|Q60676|PPP5_MOUSE (Serine/threonine-protein phosphatase 5 OS=Mus musculus OX=10090 GN=Ppp5c PE=1 SV=3)

HSP 1 Score: 629.787 bits (1623), Expect = 0.000e+0
Identity = 298/488 (61.07%), Postives = 377/488 (77.25%), Query Frame = 1
Query:  100 IQKAEEHKIKANEFFKNGDYNNAIVEYEKSIEIMP-SAVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEE-KKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRPMAYANSLLSM 1557
            +++AEE K +AN++FK  DY NAI  Y ++IE+ P +A+YY NRS AYL+TEC+GYAL DA  AI LD  Y+KGYYRRA++NMALGKF+ A +D+ETVV++  NDKDAKMK +EC KIV+++AFE+AIA +E ++S +D  DI  + IE  Y GP LE+ +VT              +FM  L+Q +K QKKLHRK A  IL Q+K+ L KL +LVE  + ET K T+CGD HGQ++DL NIFE+NGLPS+ NPY+FNGDFVDRGSFSVE I TL GFKLLYP+HF++ RGNHE++NMNQ+YGFEGEVKAKY+  M E+F+EVF WLPLA  IN ++L MHGGLF ++ VTL+DI+ I+RNRQPP++G MCDLLWSDPQ   GR+ SKRGV CQFGPDVT+ F  +N+LDYI+RSHEVK EGYE+ H  RCVTVFSAPNYCD M N+ +YI+++G   S + PQF  F  VPHPNV+PMAYAN+LL +
Sbjct:   25 LKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPGNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPNDKDAKMKYQECSKIVKQKAFERAIAGDEHRRSVVDSLDIESMTIEDEYSGPKLEDGKVTI-------------TFMKDLMQWYKDQKKLHRKCAYQILVQVKEVLCKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSVSKRGVSCQFGPDVTKAFLEENQLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQG---SDLRPQFHQFTAVPHPNVKPMAYANTLLQL 496          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|Q9NES8|PPP5_CAEEL (Serine/threonine-protein phosphatase 5 OS=Caenorhabditis elegans OX=6239 GN=pph-5 PE=1 SV=2)

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 292/485 (60.21%), Postives = 367/485 (75.67%), Query Frame = 1
Query:  103 QKAEEHKIKANEFFKNGDYNNAIVEYEKSIEIMPSAVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVE-EKKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRPMAYANSLLS 1554
            +KA   K +AN+FFK+  Y+ A   Y  +IEI P+AV Y NR+ AYLK E +G AL DAD AI++DP+YVKG+YRRA+ANMALG+FK A  D++ VV++  NDKDA+ K +EC KIVRR+ FE AI+ + +KK+  +  DIN + IE SYDGP LE+               +T+ F+L LI+ FK Q+KLH+KYA  +L +  +Y+  LP++VEI VP   KFTICGD+HGQ++DLCNIFE+NG PS+ NPYLFNGDFVDRGSFSVE IFT++GFKLLYPNHF+M+RGNHES+ MN+MYGFEGEVKAKY+  M +MFTE F WLPL HLIN++I   HGGLF+++ VTLEDI+  DRNRQPP+ G+MCDLLWSDPQ   GR+PSKRGVGCQFGPDVT K+C  N ++Y+VRSHEVK EGYE+ H  +C TVFSAPNYCD M+N+GA+I I G     + P+F  F  VPHP + PMAYANSL  
Sbjct:   27 EKAGMIKDEANQFFKDQVYDVAADLYSVAIEIHPTAVLYGNRAQAYLKKELYGSALEDADNAIAIDPSYVKGFYRRATANMALGRFKKALTDYQAVVKVCPNDKDARAKFDECSKIVRRQKFEAAISTDHDKKTVAETLDINAMAIEDSYDGPRLED--------------KITKEFVLQLIKTFKNQQKLHKKYAFKMLLEFYNYVKSLPTMVEITVPTGKKFTICGDVHGQFYDLCNIFEINGYPSETNPYLFNGDFVDRGSFSVETIFTMIGFKLLYPNHFFMSRGNHESDVMNKMYGFEGEVKAKYTQQMCDMFTETFCWLPLCHLINEKIFVCHGGLFKEDGVTLEDIRKTDRNRQPPDEGIMCDLLWSDPQPINGRSPSKRGVGCQFGPDVTSKWCETNGIEYVVRSHEVKPEGYEMHHNGQCFTVFSAPNYCDQMNNKGAFITITG---DNLTPRFTPFDAVPHPKLPPMAYANSLFG 494          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|Q84XU2|PPP5_ARATH (Serine/threonine-protein phosphatase 5 OS=Arabidopsis thaliana OX=3702 GN=PAPP5 PE=1 SV=1)

HSP 1 Score: 501.516 bits (1290), Expect = 3.816e-170
Identity = 260/542 (47.97%), Postives = 347/542 (64.02%), Query Frame = 1
Query:   70 MTSENGDSSKIQKAEEHKIKANEFFKNGDYNNAIVEYEKSIEIMPS-AVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAV--EEKKSTLDLTDINEI------------------------------------------IIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRPMAYANSLLSML 1560
            M ++N ++S + +AEE K +ANE FK   Y++AI  Y K+IE+  + AVY++NR+FA+ K E +G A+ DA  AI +D  Y KGYYRR +A +A+GKFK A +DF+ V R+  ND DA  KL+EC K V +  FE+AI+V   E++S  +  D + I                                          ++ + + G    ++E      R  E   VT  F+  +++ FK QK LH++YA  I+ Q +  L  LPSLV+I VP     T+CGD+HGQ++DL NIFE+NGLPS+ENPYLFNGDFVDRGSFSVE I TL  FK + P+  Y+ARGNHES++MN++YGFEGEV++K S   V++F EVF +LPLAH+IN ++  +HGGLF  + V L DI+ IDR  +PPE GLMC+LLWSDPQ   GR PSKRGVG  FG DVT++F   N LD +VRSHEVKDEGYE+ H  + +TVFSAPNYCD M N+GA+I  +      M P   +F  VPHP+V+PMAYAN+ L M 
Sbjct:    1 METKN-ENSDVSRAEEFKSQANEAFKGHKYSSAIDLYTKAIELNSNNAVYWANRAFAHTKLEEYGSAIQDASKAIEVDSRYSKGYYRRGAAYLAMGKFKDALKDFQQVKRLSPNDPDATRKLKECEKAVMKLKFEEAISVPVSERRSVAESIDFHTIGNKPRSSSMPTKTALAAVVAAVMVVAVRGFATTEILMVLVSVVLGTFWWGSFSGKVEPQYSGARI-EGEEVTLDFVKTMMEDFKNQKTLHKRYAYQIVLQTRQILLALPSLVDISVPHGKHITVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFSVEIILTLFAFKCMCPSSIYLARGNHESKSMNKIYGFEGEVRSKLSEKFVDLFAEVFCYLPLAHVINGKVFVVHGGLFSVDGVKLSDIRAIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGGDVTKRFLQDNNLDLLVRSHEVKDEGYEVEHDGKLITVFSAPNYCDQMGNKGAFIRFEA---PDMKPNIVTFSAVPHPDVKPMAYANNFLRMF 537          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A0X3PE57 (Serine/threonine-protein phosphatase 5 OS=Schistocephalus solidus OX=70667 GN=PPP5 PE=4 SV=1)

HSP 1 Score: 699.893 bits (1805), Expect = 0.000e+0
Identity = 332/491 (67.62%), Postives = 393/491 (80.04%), Query Frame = 1
Query:   91 SSKIQKAEEHKIKANEFFKNGDYNNAIVEYEKSIEIMPSAVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEEKKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYN-SKMAPQFFSFKEVPHPNVRPMAYANSLLSML 1560
            S  + +A E K KANE+F +GDY +AI  Y K+IE+  +AV+++NRSFAYL+TE FG AL DA  AISLD NY+KGYYRRASANMA+G +  A +DFETVVR Y N KDA+ K +EC K  R RAF KAIA EEK S L+  D + I IE SY GPHLE+ +  +        Y VT+ FM+ L++ FK QKKLHR+YA++++KQ  D L KLPSLVEIDVP+ +KFT+CGD+HGQ++DL NIFE+NGLPS ENPYLFNGDFVDRGSFSVECIFTL+GFKLLYPNHF+M+RGNHES NMNQMYGFEGEVK+KY+  M + FTEVFNWLPL HLIN RIL MHGGLF  EDV L+D+K IDRNRQPP++GLMC+LLWSDP    GRAPSKRGVGCQFGPD+TE FC +N LD I+RSHEVK+EGYE+ H  RC+TVFSAPNYCDTMHNRGA+I  +GS    +M P+F SFKEVPHP VRPMAYANSLLS+L
Sbjct:   26 SDVVLQANELKSKANEYFASGDYTDAIAYYSKAIELHETAVFFANRSFAYLRTEMFGAALEDASKAISLDENYIKGYYRRASANMAMGHYDKALRDFETVVRKYPNSKDARQKYDECFKRQRLRAFAKAIASEEKPSPLENFDPSSICIEPSYAGPHLEQKDDGT--------YTVTQKFMVELLETFKAQKKLHRRYAVVMVKQFYDILRKLPSLVEIDVPDGAKFTVCGDVHGQFYDLVNIFELNGLPSTENPYLFNGDFVDRGSFSVECIFTLIGFKLLYPNHFFMSRGNHESVNMNQMYGFEGEVKSKYNADMADSFTEVFNWLPLCHLINSRILVMHGGLFSQEDVKLQDLKTIDRNRQPPDSGLMCELLWSDPMDGNGRAPSKRGVGCQFGPDITEDFCERNGLDMIIRSHEVKNEGYEVAHNGRCITVFSAPNYCDTMHNRGAFIVFRGSKKPGEMKPEFTSFKEVPHPQVRPMAYANSLLSLL 508          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: G4V8L2 (TPR_REGION domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_090860 PE=4 SV=1)

HSP 1 Score: 691.034 bits (1782), Expect = 0.000e+0
Identity = 329/491 (67.01%), Postives = 397/491 (80.86%), Query Frame = 1
Query:   91 SSKIQKAEEHKIKANEFFKNGDYNNAIVEYEKSIEIMPSAVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEEKKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYN-SKMAPQFFSFKEVPHPNVRPMAYANSLLSML 1560
            S+   +AE  K +AN+FFK+GDY  AI  Y K+IEI  +AVY +NRS AYL+TECFGYAL DA  AISLD +YVKGYYRRASA+MALG++K A  D+ETV+R+  +DK A+ KL ECRKI+RR+AFEKAIAVE++ S L+  D++ I +ESSYDGPHLE+             Y VTESFML L++H+K QK LH+KYA+II+K+I  YL  LPSLV+I VPE SKFT+CGDIHGQ++DL NIF++NGLPSK+NPYLFNGDFVDRGSFSVECIFTL GFKLLYP+ FY++RGNHESE+MN++YGFEGEVK+KYS  +  MFT++FNWLPL HLIN+RIL MHGGLF  ++VTL++IK + RNRQP E  +MC+LLWSDP  + GRA SKRGVGCQFGPDVTEKFC QN LDYI+RSHEVKDEGYE+ H  RC+TVFSAPNYCDTMHNRGA+I + GS    +M+P F SF  VPHP+VRPMAY N LLSM 
Sbjct:    4 STISDEAEALKEEANKFFKDGDYEKAIDAYTKAIEIRETAVYLANRSLAYLRTECFGYALDDASKAISLDSSYVKGYYRRASAHMALGQYKEALADYETVIRVAPSDKMAREKLTECRKIIRRKAFEKAIAVEDQPSPLESFDLSTITVESSYDGPHLEQ--------DSNGKYFVTESFMLALMEHYKSQKVLHKKYAIIIMKEIFLYLRDLPSLVDIKVPEKSKFTVCGDIHGQFYDLMNIFQINGLPSKDNPYLFNGDFVDRGSFSVECIFTLFGFKLLYPDKFYLSRGNHESEHMNRLYGFEGEVKSKYSSEVANMFTDIFNWLPLCHLINERILVMHGGLFERDNVTLDEIKKVSRNRQPDEGTIMCELLWSDPMEAEGRAHSKRGVGCQFGPDVTEKFCKQNGLDYIIRSHEVKDEGYEVAHNGRCITVFSAPNYCDTMHNRGAFITLIGSDEPGEMSPMFTSFTAVPHPDVRPMAYVNPLLSMF 486          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A075A2N4 (TPR_REGION domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_10083 PE=4 SV=1)

HSP 1 Score: 686.797 bits (1771), Expect = 0.000e+0
Identity = 322/487 (66.12%), Postives = 387/487 (79.47%), Query Frame = 1
Query:  103 QKAEEHKIKANEFFKNGDYNNAIVEYEKSIEIMPSAVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEEKKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYN-SKMAPQFFSFKEVPHPNVRPMAYANSLLSML 1560
            +KA+  K +AN+FFK+G+Y+ AI  Y K++++  SA+Y+SNRS AYL+TECFGYAL DA  AI LD +YVKGYYRRA   MAL KFK A  D + V+R    DK A+ K   C+KI RRR FE+AIAVE+K S L   D   + +E SYDGPHLE  E+         NY VTESFML LI+H+K QKKLH+KYA+IILKQI   L  LPSLV+ID+PE +KFT+CGDIHGQ++DL NIFE+NGLPSKENPYLFNGDFVDRGSFSVECIFTL GFKLLYP HFY++RGNHESENMN++YGFEGEVK+KYS+ MV++FT++FNWLPL+HLIN+RIL MHGGLF ++DVTL+DI+ I R+RQPPE   MC+LLWSDP    GR+PSKRG+GCQFGPDVTE+FC  N LDYI+RSHEVKDEGYE+ H  RC+TVFSAPNYCDTMHNRGA+I + G    + M P+F SFKEVPHP+VRP+AY N  LS  
Sbjct:   68 EKADAFKEEANKFFKDGEYDKAIENYTKALQLKESAIYFSNRSLAYLRTECFGYALEDATKAIELDGSYVKGYYRRAMVYMALEKFKEALSDLDMVLRNAPQDKTARAKHTACQKIYRRRLFEQAIAVEDKASALTSFDPASVTVEPSYDGPHLESDEMG--------NYVVTESFMLALIEHYKAQKKLHKKYAMIILKQIDQLLRNLPSLVDIDIPEDTKFTVCGDIHGQFYDLMNIFELNGLPSKENPYLFNGDFVDRGSFSVECIFTLFGFKLLYPKHFYLSRGNHESENMNRLYGFEGEVKSKYSMEMVDIFTDLFNWLPLSHLINERILVMHGGLFSNDDVTLDDIRKISRDRQPPEGSPMCELLWSDPMEGNGRSPSKRGIGCQFGPDVTERFCKANGLDYIIRSHEVKDEGYEVAHGGRCITVFSAPNYCDTMHNRGAFITLIGKRKPAPMKPEFTSFKEVPHPDVRPLAYVNPFLSFF 546          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A4S2KWR1 (TPR_REGION domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010588 PE=4 SV=1)

HSP 1 Score: 684.871 bits (1766), Expect = 0.000e+0
Identity = 321/487 (65.91%), Postives = 387/487 (79.47%), Query Frame = 1
Query:  103 QKAEEHKIKANEFFKNGDYNNAIVEYEKSIEIMPSAVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEEKKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYN-SKMAPQFFSFKEVPHPNVRPMAYANSLLSML 1560
            +KA+  K +AN+FFK+G+Y+ AI  Y K++++  SA+Y+SNRS AYL+TECFGYAL DA  AI LD +YVKGYYRRA   MAL KFK A  D +TV+R    DK A+ K   C+KI RRR FE+AIAVE+K S L   D   + +E SYDGPHLE  EV         NY VTESFML L++H+K QKKLH+KYA+IILKQI   L  LPSLV+ID+PE +KFT+CGDIHGQ++DL NIFE+NGLPSKENPYLFNGDFVDRGSFSVECIFTL GFKLLYP HFY++RGNHESENMN++YGFEGEVK+KYS+ MV++FT++FNWLPL+HLIN+RIL MHGGLF ++ +TL+DI+ I R+RQPPE   MC+LLWSDP    GR+PSKRG+GCQFGPDVTE+FC  N LDYI+RSHEVKDEGYE+ H  RC+TVFSAPNYCDTMHNRGA+I + G    + M P+F SFKEVPHP+VRP+AY N  LS  
Sbjct:    8 EKADAFKEEANKFFKDGEYDKAIENYTKALQLKESAIYFSNRSLAYLRTECFGYALEDATKAIELDGSYVKGYYRRAMVYMALEKFKEALSDLDTVLRNAPQDKTARAKHTACQKIYRRRLFEQAIAVEDKASALASFDPASVAVEPSYDGPHLESDEVG--------NYVVTESFMLALMEHYKAQKKLHKKYAMIILKQIDQLLRNLPSLVDIDIPEDTKFTVCGDIHGQFYDLMNIFELNGLPSKENPYLFNGDFVDRGSFSVECIFTLFGFKLLYPKHFYLSRGNHESENMNRLYGFEGEVKSKYSMEMVDVFTDLFNWLPLSHLINERILVMHGGLFSNDGITLDDIRKISRDRQPPEGSPMCELLWSDPMEGNGRSPSKRGIGCQFGPDVTERFCKANGLDYIIRSHEVKDEGYEVAHGGRCITVFSAPNYCDTMHNRGAFITLIGKRKPAPMKPEFTSFKEVPHPDVRPLAYVNPFLSFF 486          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A095A3U8 (Serine/threonine-protein phosphatase 5 OS=Schistosoma haematobium OX=6185 GN=MS3_10561 PE=4 SV=1)

HSP 1 Score: 684.485 bits (1765), Expect = 0.000e+0
Identity = 326/491 (66.40%), Postives = 395/491 (80.45%), Query Frame = 1
Query:   91 SSKIQKAEEHKIKANEFFKNGDYNNAIVEYEKSIEIMPSAVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEEKKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYN-SKMAPQFFSFKEVPHPNVRPMAYANSLLSML 1560
            S+   +AE  K +AN+FFK+GDY  AI  Y K+IEI  +AVY +NRS AYL+TECFGYAL DA  AISLD +YVKGYYRRASA+MALG++K A  D+ETV+R+  +DK A+ KL ECRKI+RR+AFEKAIAVE++ S L+  D++ I +ESSYDGPHLE+             Y VTESFML L++H+K QK LH+KYA+II+K I  +L  LPSLV+I VPE SKFT+CGDIHGQ++DL NIF++NGLPSK+NPYLFNGDFVDRGSFSVECIFTL GFKLLYP+ FY++RGNHESE+MN++YGFEGEVK+KYS  +  MFT++FNWLPL HLIN+RIL MHGGLF  ++VTL++IK + RNRQP E  +MC+LLWSDP  + GRA SKRGVGCQFGPDVT+KFC QN LDYI+RSHEVKDEGYE+ H  RC+TVFSAPNYCDTMHNRGA+I + GS    +M+P F SF  V HP+VRPMAY N LLSM 
Sbjct:    4 STISDEAEALKEEANKFFKDGDYEKAIDAYTKAIEIRETAVYLANRSLAYLRTECFGYALDDASKAISLDSSYVKGYYRRASAHMALGQYKEALADYETVIRVAPSDKMAREKLTECRKIIRRKAFEKAIAVEDQPSPLESFDLSTITVESSYDGPHLEQ--------DSNGKYFVTESFMLALMEHYKSQKVLHKKYAIIIMKDIFLFLRGLPSLVDIKVPEQSKFTVCGDIHGQFYDLMNIFKINGLPSKDNPYLFNGDFVDRGSFSVECIFTLFGFKLLYPDKFYLSRGNHESEHMNRLYGFEGEVKSKYSSEVANMFTDIFNWLPLCHLINERILVMHGGLFERDNVTLDEIKKVSRNRQPDEGTIMCELLWSDPMEAEGRAHSKRGVGCQFGPDVTKKFCKQNGLDYIIRSHEVKDEGYEVAHNGRCITVFSAPNYCDTMHNRGAFITLIGSNKPGEMSPMFTSFTAVAHPDVRPMAYVNPLLSMF 486          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp5c (protein phosphatase 5 catalytic subunit [Source:NCBI gene;Acc:103034548])

HSP 1 Score: 649.432 bits (1674), Expect = 0.000e+0
Identity = 309/486 (63.58%), Postives = 378/486 (77.78%), Query Frame = 1
Query:  106 KAEEHKIKANEFFKNGDYNNAIVEYEKSIEIMPS-AVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEE-KKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRPMAYANSLLSM 1557
            +AEE K KAN +FK  DY NAI  Y +++E+ PS A+YYSNRS AYL+TEC+GYAL DA  A+ +D NY+KGYYRRA++NMALGKFK A +D+ETVVR+  NDKDAKMK +EC KIV+++AFE+AIA +E K+S +D  DI  + IE  Y GP LE+ +VT               FM  ++  FK QKKLHRK A  +L Q+K+ LSKLPSLVEI + ET K TICGD HGQY+DL NIFE+NGLPS  NPYLFNGDFVDRGSFS+E I TL GFKLLYP+HF++ RGNHE++NMNQMYGFEGEVKAKY+  M ++F+EVF WLPLA  IN ++L MHGGLF ++ VTL+D++ IDRNRQPP++G MCDLLWSDPQ   GR+ SKRGV CQFGPDVT++F  QNKL YIVRSHEVK EGYE+TH  +C+TVFSAPNYCD M N+GAYI+++G   S + P+F  F  VPHPNV+PMAYANSLL +
Sbjct:   20 RAEELKEKANNYFKEKDYENAIKYYTEALELNPSNAIYYSNRSLAYLRTECYGYALADATRALEIDKNYIKGYYRRATSNMALGKFKAALKDYETVVRVRPNDKDAKMKYQECNKIVKQKAFERAIASDELKRSVVDSLDIENMTIEDEYAGPKLEDGKVTL-------------KFMKEMMDWFKDQKKLHRKCAYQMLVQVKEVLSKLPSLVEITLKETEKITICGDTHGQYYDLLNIFELNGLPSPTNPYLFNGDFVDRGSFSMEVILTLFGFKLLYPDHFHLLRGNHETDNMNQMYGFEGEVKAKYTAQMFQLFSEVFQWLPLAQCINSKVLVMHGGLFSEDGVTLDDLRKIDRNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTQRFLEQNKLQYIVRSHEVKAEGYEVTHSGKCITVFSAPNYCDQMGNKGAYIHLRG---SDLKPEFHQFTAVPHPNVKPMAYANSLLQL 489          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp1cb (serine/threonine-protein phosphatase PP1-beta catalytic subunit-like [Source:NCBI gene;Acc:103030509])

HSP 1 Score: 219.55 bits (558), Expect = 3.278e-65
Identity = 114/258 (44.19%), Postives = 164/258 (63.57%), Query Frame = 1
Query:  691 IILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMS-RGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGS 1461
            + LK  + +LS+ P L+E++ P      ICGDIHGQY DL  +FE  G P + N YLF GD+VDRG  S+E I  LL +K+ YP +F++ RGNHE  ++N++YGF  E K ++++ + + FT+ FN LP+A +I+++I   HGGL  D   ++E I+ I R    P+TGL+CDLLWSDP    +G   + RGV   FG DV  KF  ++ LD I R+H+V ++GYE     + VT+FSAPNYC    N G  +++  S
Sbjct:   37 LCLKSREIFLSQ-PILLELEAP----LKICGDIHGQYTDLLRLFEYGGFPPEAN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQ-SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDES 287          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp1cb (serine/threonine-protein phosphatase PP1-beta catalytic subunit-like [Source:NCBI gene;Acc:103030509])

HSP 1 Score: 219.164 bits (557), Expect = 5.242e-65
Identity = 114/258 (44.19%), Postives = 164/258 (63.57%), Query Frame = 1
Query:  691 IILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMS-RGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGS 1461
            + LK  + +LS+ P L+E++ P      ICGDIHGQY DL  +FE  G P + N YLF GD+VDRG  S+E I  LL +K+ YP +F++ RGNHE  ++N++YGF  E K ++++ + + FT+ FN LP+A +I+++I   HGGL  D   ++E I+ I R    P+TGL+CDLLWSDP    +G   + RGV   FG DV  KF  ++ LD I R+H+V ++GYE     + VT+FSAPNYC    N G  +++  S
Sbjct:   41 LCLKSREIFLSQ-PILLELEAP----LKICGDIHGQYTDLLRLFEYGGFPPEAN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQ-SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDES 291          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: PPP1CB (serine/threonine-protein phosphatase PP1-beta catalytic subunit-like [Source:NCBI gene;Acc:103028275])

HSP 1 Score: 218.394 bits (555), Expect = 7.121e-65
Identity = 113/258 (43.80%), Postives = 164/258 (63.57%), Query Frame = 1
Query:  691 IILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMS-RGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGS 1461
            + +K  + +LS+ P L+E++ P      ICGDIHGQY DL  +FE  G P + N YLF GD+VDRG  S+E I  LL +K+ YP +F++ RGNHE  ++N++YGF  E K ++++ + + FT+ FN LP+A +I+++I   HGGL  D   ++E I+ I R    P+TGL+CDLLWSDP    +G   + RGV   FG DV  KF  ++ LD I R+H+V ++GYE     + VT+FSAPNYC    N G  +++  S
Sbjct:   27 LCIKSREIFLSQ-PILLELEAP----LKICGDIHGQYTDLLRLFEYGGFPPEAN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQ-SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDES 277          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: PPP1CB (serine/threonine-protein phosphatase PP1-beta catalytic subunit-like [Source:NCBI gene;Acc:103028275])

HSP 1 Score: 218.394 bits (555), Expect = 8.606e-65
Identity = 113/258 (43.80%), Postives = 164/258 (63.57%), Query Frame = 1
Query:  691 IILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMS-RGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGS 1461
            + +K  + +LS+ P L+E++ P      ICGDIHGQY DL  +FE  G P + N YLF GD+VDRG  S+E I  LL +K+ YP +F++ RGNHE  ++N++YGF  E K ++++ + + FT+ FN LP+A +I+++I   HGGL  D   ++E I+ I R    P+TGL+CDLLWSDP    +G   + RGV   FG DV  KF  ++ LD I R+H+V ++GYE     + VT+FSAPNYC    N G  +++  S
Sbjct:   37 LCIKSREIFLSQ-PILLELEAP----LKICGDIHGQYTDLLRLFEYGGFPPEAN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQ-SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDES 287          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-050327-75])

HSP 1 Score: 586.645 bits (1511), Expect = 0.000e+0
Identity = 283/472 (59.96%), Postives = 352/472 (74.58%), Query Frame = 1
Query:  154 DYNNAIVEYEKSIEIMP-SAVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEE-KKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSK--FTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRPMAYANSLLSM 1557
            DY+NAI  Y  +I +   +A+YY NRS +YL+TEC+GYAL DA  A+ LD  Y+KGYYRRA+A MALGKFK A +D+ETVV++  NDKDAK+K +EC KIV+R+AFE+AIA ++ KKS  D  D++ + IE  Y GP ++             N  VT +FM  LI+ FK QKKLHRKYA  IL Q+K  L KLPSLVE+ + +      T+CGDIHGQYFDL +IFE+NGLPS+ NPY+FNGDFVDRGS+SVE I  L GFKLLYP+HF++ RGNHE++NMNQMYGFEGEVKAKY+  M + F+EVF WLPLA  IN R+L MHGGLF ++ VTL+DI+ IDRNRQPP++G MCDLLWSDPQ   GR+ SKRGV CQFGPDV+  F  QN L+ I+RSHE K +GYE+ H  RCVTVFSAPNYCD M N+G+YI++       + P+F  F  VPHPNV+PMAYAN+L+ M
Sbjct:    3 DYDNAIKFYTDAIALCADNAIYYGNRSLSYLRTECYGYALADATRALELDKAYIKGYYRRATAKMALGKFKEALKDYETVVKVKPNDKDAKLKYQECSKIVKRKAFERAIASDDSKKSVADALDLDSMAIEDDYTGPKVD-------------NGQVTITFMKELIEWFKDQKKLHRKYAYQILLQVKQSLQKLPSLVEVTIKDEQGDMITVCGDIHGQYFDLLHIFELNGLPSETNPYVFNGDFVDRGSWSVEVILVLFGFKLLYPDHFHLMRGNHETDNMNQMYGFEGEVKAKYTAQMFDFFSEVFQWLPLAMCINSRVLIMHGGLFSEDGVTLDDIRKIDRNRQPPDSGPMCDLLWSDPQPQPGRSVSKRGVSCQFGPDVSRAFMEQNNLELIIRSHE-KPDGYEVAHDGRCVTVFSAPNYCDQMGNKGSYIHLTA---PALKPEFHEFAAVPHPNVKPMAYANALMRM 457          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp1cab (protein phosphatase 1, catalytic subunit, alpha isozyme b [Source:ZFIN;Acc:ZDB-GENE-030131-5512])

HSP 1 Score: 214.927 bits (546), Expect = 1.811e-64
Identity = 112/255 (43.92%), Postives = 165/255 (64.71%), Query Frame = 1
Query:  691 IILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQM-SRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINI 1452
            + LK  + +LS+ P L+E++ P      ICGDIHGQY+DL  +FE  G P + N YLF GD+VDRG  S+E I  LL +K+ YP +F++ RGNHE+ ++N++YGF  E K +Y++ + + FT+ FN LP+A +++++I   HGGL  D   ++E I+ I R    P+ GL+CDLLWSDP   + G   + RGV   FG +V  KF  ++ LD I R+H+V ++GYE     + VT+FSAPNYC    N GA +++
Sbjct:   20 LCLKSREIFLSQ-PILLELEAP----LKICGDIHGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHEA-SINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ-SMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSV 266          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010086.1 (pep scaffold:Pmarinus_7.0:GL479411:90249:92178:-1 gene:ENSPMAG00000009123.1 transcript:ENSPMAT00000010086.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 199.519 bits (506), Expect = 3.125e-59
Identity = 102/228 (44.74%), Postives = 146/228 (64.04%), Query Frame = 1
Query:  781 GDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPET---GLMCDLLWSDPQMS-RGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINI 1452
            GDIHGQY DL  +FE  G P + N YLF GD+VDRG  S+E I  LL +K+ YP +F++ RGNHE  ++N++YGF  E K ++++ + + FT+ FN LP+A +++++I   HGGL  D   ++E I+ I R    P+T   GL+CDLLWSDP    +G   + RGV   FG DV  KF  ++ LD I R+H+V ++GYE     + VT+FSAPNYC    N G  +++
Sbjct:    1 GDIHGQYTDLLRLFEYGGFPPEAN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ-SMEQIRRIMRPTDVPDTGDAGLLCDLLWSDPDKDVQGWGENDRGVSFTFGGDVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSV 226          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp3cb (protein phosphatase 3, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-050417-406])

HSP 1 Score: 204.142 bits (518), Expect = 2.999e-58
Identity = 113/310 (36.45%), Postives = 169/310 (54.52%), Query Frame = 1
Query:  640 LIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSK--------RGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYEL------THYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRP 1527
            L  H  ++ ++    AL I+      L +  ++++I+ P     T+CGDIHGQ+FDL  +FE+ G P+    YLF GD+VDRG FS+EC+  L   K+LYP   ++ RGNHE  ++ + + F+ E K KY+ T+ +   + F+ LPLA L+N++ L +HGGL   E   LEDI+ +DR ++PP  G MCDLLWSDP    G   ++        RG    +       F   N L  ++R+HE +D GY +      T +   +T+FSAPNY D  +N+ A +  +   N+ M      F   PHP   P
Sbjct:   29 LKNHLVKEGRVEEDVALRIINDGASILRREKTMIDIEAP----VTVCGDIHGQFFDLMKLFEVGGSPANTR-YLFLGDYVDRGYFSIECVLYLWALKILYPTTLFLLRGNHECRHLTEYFTFKQECKIKYTETVYDACMDAFDCLPLAALMNQQFLCVHGGL-SPEVHNLEDIRKLDRFKEPPAFGPMCDLLWSDPSEDFGNEKTQEYFCHNTVRGCSYFYSYPAVCDFLQNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYE---NNVM--NIRQFNCSPHPYWLP 327          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-030616-609])

HSP 1 Score: 176.022 bits (445), Expect = 4.802e-51
Identity = 91/205 (44.39%), Postives = 132/205 (64.39%), Query Frame = 1
Query:  691 IILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMS-RGRAPSKRGVGCQFGPDVTEKF 1302
            + +K  + +LS+ P L+E++ P      ICGDIHGQY DL  +FE  G P + N YLF GD+VDRG  S+E I  LL +K+ YP +F++ RGNHE  ++N++YGF  E K ++++ + + FT+ FN LP+A +++++I   HGGL  D   ++E I+ I R    P+TGL+CDLLWSDP    +G   + RGV   FG DV  KF
Sbjct:   24 LCIKSREIFLSQ-PILLELEAP----LKICGDIHGQYTDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ-SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKF 221          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPT1 (Protein serine/threonine phosphatase; regulates Hsp90 chaperone by affecting its ATPase and cochaperone binding activities; has similarity to human phosphatase PP5; present in both the nucleus and cytoplasm; expressed during logarithmic growth [Source:SGD;Acc:S000003355])

HSP 1 Score: 365.54 bits (937), Expect = 1.896e-119
Identity = 200/499 (40.08%), Postives = 292/499 (58.52%), Query Frame = 1
Query:  106 KAEEHKIKANEFFKNGDYNNAIVEYEKSIEIMPS-AVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEEKKS------TLDLTDINEIIIESSYDGPHLEEIEVTSDK--CRCYENYAVTESFMLHLIQH-FKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETS--KFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINI-------KGSYNSKMAPQFFSFKEVPHPNVRPMAYANS 1545
            KA E K + N F K   +  AI +Y ++I++  + ++Y+SNR+FA+ K + F  AL D D AI LDP  +K Y+RRA + MAL +FK A++D   +++   ND  A   L  C + +R   F KAI   E ++      TL+L+  +     ++Y+GP LE  ++  DK   +  +   +++ F+  ++   F + K L +KY   I+        + PS+VE++   T   K ++CGD HGQ++D+ N+F   G    ++ YLFNGDFVDRGS+S E        K+L+PN+F++ RGNHES+NMN++YGFE E K KYS  +  MF + F  LPLA LIN   L MHGGL  D   TL D KNIDR  QPP  G   +LLW+DPQ + G  PS+RG+G  FGPD+T++F   NKL  I RSHE++  G +     + +TVFSAPNYCD+  N G  I++       +   N        +F+ V HP+++PMAY+N 
Sbjct:   11 KALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKARKDLNVLLKAKPNDPAATKALLTCDRFIREERFRKAIGGAENEAKISLCQTLNLSSFDANADLANYEGPKLEFEQLYDDKNAFKGAKIKNMSQEFISKMVNDLFLKGKYLPKKYVAAIISHADTLFRQEPSMVELENNSTPDVKISVCGDTHGQFYDVLNLFRKFGKVGPKHTYLFNGDFVDRGSWSCEVALLFYCLKILHPNNFFLNRGNHESDNMNKIYGFEDECKYKYSQRIFNMFAQSFESLPLATLINNDYLVMHGGLPSDPSATLSDFKNIDRFAQPPRDGAFMELLWADPQEANGMGPSQRGLGHAFGPDITDRFLRNNKLRKIFRSHELRMGGVQFEQKGKLMTVFSAPNYCDSQGNLGGVIHVVPGHGILQAGRNDDQNLIIETFEAVEHPDIKPMAYSNG 509          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: GLC7 (Type 1 S/T protein phosphatase (PP1) catalytic subunit; involved in glycogen metabolism, sporulation and mitotic progression; interacts with multiple regulatory subunits; regulates actomyosin ring formation; subunit of CPF; recruited to mating projections by Afr1p interaction; regulates nucleocytoplasmic shuttling of Hxk2p; import into the nucleus is inhibited during spindle assembly checkpoint arrest; involved in dephosphorylating Rps6a/b and Bnr1p [Source:SGD;Acc:S000000935])

HSP 1 Score: 223.402 bits (568), Expect = 9.098e-68
Identity = 113/269 (42.01%), Postives = 166/269 (61.71%), Query Frame = 1
Query:  658 QQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMS-RGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGS 1461
            QQ  L       +  + +    K P L+E++ P      ICGDIHGQY+DL  +FE  G P + N YLF GD+VDRG  S+E I  LL +K+ YP +F++ RGNHE  ++N++YGF  E K +Y++ + + FT+ FN LP+A +I+++I  MHGGL  D + ++E I+ + R    P+ GL+CDLLWSDP     G + + RGV   FGPDV  +F  +  ++ I R+H+V ++GYE     + VT+FSAPNYC    N GA +++  S
Sbjct:   25 QQVDLEENEIRYLCSKARSIFIKQPILLELEAP----IKICGDIHGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPDLN-SMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSENDRGVSFTFGPDVVNRFLQKQDMELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDES 287          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPH21 (Catalytic subunit of protein phosphatase 2A (PP2A); functionally redundant with Pph22p; methylated at C terminus; forms alternate complexes with several regulatory subunits; involved in signal transduction and regulation of mitosis; forms nuclear foci upon DNA replication stress; PPH21 has a paralog, PPH22, that arose from the whole genome duplication [Source:SGD;Acc:S000002292])

HSP 1 Score: 209.149 bits (531), Expect = 9.779e-62
Identity = 114/296 (38.51%), Postives = 170/296 (57.43%), Query Frame = 1
Query:  643 IQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKY-SVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRP 1527
            I+H  + + L       + K   D L    ++  I+VP     TICGD+HGQ+ DL  +F++ G P  +  YLF GD+VDRG +SVE +  L+  K+ YP+   + RGNHES  + Q+YGF  E   KY S  + +MFT++F++ P+  L++ +I  +HGGL    + T++ ++ ++R ++ P  G MCDLLWSDP    G   S RG G  FG DV+E+F   N L  I R+H++  EGY  +H    VT+FSAPNYC    N+ A + +  ++N     QF  +     P+VRP
Sbjct:   74 IEHLSKCEPLSEDDVARLCKMAVDVLQFEENVKPINVP----VTICGDVHGQFHDLLELFKIGG-PCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPITALVDNKIFCLHGGLSPMIE-TIDQVRELNRIQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGFTFGQDVSEQFNHTNDLSLIARAHQLVMEGYAWSHQQNVVTIFSAPNYCYRCGNQAAIMEVDENHNR----QFLQYD----PSVRP 355          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPH22 (Catalytic subunit of protein phosphatase 2A (PP2A); functionally redundant with Pph21p; methylated at C terminus; forms alternate complexes with several regulatory subunits; involved in signal transduction and regulation of mitosis; protein abundance increases in response to DNA replication stress; dephosphorylates Tel1p/Mec1p-phosphorylated Cdc13p to promote telomerase release from telomeres at G2/M; PPH22 has a paralog, PPH21, that arose from the whole genome duplication [Source:SGD;Acc:S000002347])

HSP 1 Score: 208.379 bits (529), Expect = 2.623e-61
Identity = 113/296 (38.18%), Postives = 171/296 (57.77%), Query Frame = 1
Query:  643 IQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKY-SVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRP 1527
            I+H  + + L       + K   D L    ++  I+VP     TICGD+HGQ+ DL  +F++ G P  +  YLF GD+VDRG +SVE +  L+  K+ YP+   + RGNHES  + Q+YGF  E   KY S  + +MFT++F++ P+  L++ +I  +HGGL    + T++ +++++R ++ P  G MCDLLWSDP    G   S RG G  FG D++E+F   N L  I R+H++  EGY  +H    VT+FSAPNYC    N+ A + +  ++N     QF  +     P+VRP
Sbjct:   82 IEHLSKCEPLSEDDVARLCKMAVDVLQFEENVKPINVP----VTICGDVHGQFHDLLELFKIGG-PCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPVTALVDNKIFCLHGGLSPMIE-TIDQVRDLNRIQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGFTFGQDISEQFNHTNDLSLIARAHQLVMEGYSWSHQQNVVTIFSAPNYCYRCGNQAAIMEVDENHNR----QFLQYD----PSVRP 363          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPQ1 (Protein phosphatase that regulates the mating response; negatively regulates the MAP kinase signaling cascade during mating; member of the serine/threonine phosphatase PP1 family [Source:SGD;Acc:S000006100])

HSP 1 Score: 203.756 bits (517), Expect = 7.354e-58
Identity = 106/245 (43.27%), Postives = 150/245 (61.22%), Query Frame = 1
Query:  730 PSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQP---PETGLMCDLLWSDPQ-MSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINI 1452
            P+L+ +  P      + GD+HGQ+ DL  I +++G+PS  N YLF GD+VDRG  S+E I  LL +K+ Y ++F+M RGNHES N+ +MYGF  E K + S  + +MF +VFN LPLA +I  +I  +HGG+  D    L D+K I++  +P   PE+GL+ DLLWSDP       + + RGV   F       FC + K D I+R H V ++GYE     + VT+FSAPNYC   HN GA +++
Sbjct:  287 PTLLRLQAP----IKVVGDVHGQFNDLLRILKLSGVPSDTN-YLFLGDYVDRGKNSLETILLLLCYKIKYKDNFFMLRGNHESANVTKMYGFYDECKRRLSSKVWKMFVDVFNTLPLAAIIQDKIFCVHGGISPD----LHDMKQIEKVARPTDIPESGLVTDLLWSDPDPQVTDWSENDRGVSYTFSKRNVLDFCAKFKFDLILRGHMVVEDGYEFFARKKFVTIFSAPNYCGEFHNWGAVMSV 522          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO47034 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RNB7])

HSP 1 Score: 247.669 bits (631), Expect = 1.826e-72
Identity = 137/351 (39.03%), Postives = 196/351 (55.84%), Query Frame = 1
Query:  514 TDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKY---SVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNR-----QPP-------------ETGLMCDLLWSDPQMSRGRAPSK-RGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFK 1500
            TD ++I +E +Y G H+ ++ +T    R             ++I+  K  K +H KY L+IL++ ++    LP+++ +      + TICGD+HG+  DL  IF  NGLPS ENPY+FNGD VDRG  S+E    L  F +LYPN  Y+ RGNHE   MN  YGF  EV  KY   +  ++ +F ++F WLPLA ++N +I   HGG+    D  L+ I+ IDR++     +PP             E   + DLLWSDP+ + G  P+  RG GC FGPDVT +   ++  + +VRSHE K EGYE  H  + +T+FSA NY +   NRGAY+ I       M P F  ++
Sbjct:  120 TDPSDIKVEPTYTG-HVVKLPITLMSVR-------------NIIEQCKLNKLVHAKYVLLILREARERFRALPNVIRVTTRIAKQMTICGDLHGKLDDLFMIFHKNGLPSPENPYIFNGDLVDRGPRSIEICIILFAFTILYPNGVYINRGNHEDHIMNLRYGFVKEVMDKYKDHASKIIRLFEDIFGWLPLATIVNNKIFVAHGGISNITD--LDIIERIDRHKYVSVLKPPNIVKDNPSLSSLKEWRQVLDLLWSDPKPTPGCKPNTFRGGGCYFGPDVTSQVLRKHNFELLVRSHECKYEGYEYMHNKKVITIFSASNYYEQGSNRGAYMKI----GPDMTPYFVQYQ 450          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO44648 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RVJ0])

HSP 1 Score: 222.631 bits (566), Expect = 7.375e-67
Identity = 113/255 (44.31%), Postives = 165/255 (64.71%), Query Frame = 1
Query:  691 IILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMS-RGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINI 1452
            + LK  + +LS+ P L+E++ P      ICGDIHGQY+DL  +FE  G P + N YLF GD+VDRG  S+E I  LL +K+ YP +F++ RGNHE  ++N++YGF  E K +Y++ + + FT+ FN LP+A +++++I   HGGL  D   ++E I+ I R    P+ GL+CDLLWSDP    +G   + RGV   FGPD+  KF  ++ LD I R+H+V ++GYE     + VT+FSAPNYC    N GA +++
Sbjct:   38 LCLKSREIFLSQ-PILLELEAP----LKICGDIHGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAILDEKIFCCHGGLSPDLQ-SMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGPDIVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSV 285          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO29759 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7T2Q5])

HSP 1 Score: 204.527 bits (519), Expect = 3.052e-60
Identity = 111/290 (38.28%), Postives = 165/290 (56.90%), Query Frame = 1
Query:  643 IQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKY-SVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVP 1509
            I+   + K+L       + ++ K+ LSK  ++ E+  P     T+CGD+HGQ+ DL  +F + G  S +  YLF GD+VDRG +SVE +  L+  K+ +P+   + RGNHES  + Q+YGF  E   KY + ++ + FT++F++LPL  L++ +I  +HGGL    D TL+ I+ +DR ++ P  G MCDLLWSDP    G   S RG G  FG D++E F   N L  I R+H++  EGY   H    VT+FSAPNYC    N+ A + +    +  +   F  F   P
Sbjct:   15 IEQLMECKQLTEAQVKTLCEKAKEILSKESNVQEVKCP----VTVCGDVHGQFHDLMELFRIGG-KSPDTNYLFMGDYVDRGYYSVETVTLLVTLKVRFPHRICILRGNHESRQITQVYGFYDECLRKYGNASVWKYFTDLFDYLPLTALVDNQIFCLHGGLSPSID-TLDHIRALDRIQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHTNGLTLITRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMEL----DDALKYSFLQFDPAP 294          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO49936 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RFC7])

HSP 1 Score: 202.601 bits (514), Expect = 1.526e-59
Identity = 117/293 (39.93%), Postives = 168/293 (57.34%), Query Frame = 1
Query:  655 KQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPET------SKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKY-SVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPH 1512
            +Q +KL R   LI  K++K   +K     EI V E+      S  T+CGDIHGQ++DL  +F++ G     N YLF GDFVDRG +SVE    LL  K+ YP+   + RGNHES  + Q+YGF  E   KY S+T+     E+F++L L+ +I+ R+  +HGGL      TL+ I++IDR ++ P  G MCDLLWSDP+  +G   S RG G  FG DV  ++   N +D I R+H++  EGY+    +  +TV+SAPNYC    N  A + +    +  +  +F  F+  P 
Sbjct:    9 RQIEKL-RNCELITEKEVKQLCAKAR---EILVEESNVQRVDSPVTVCGDIHGQFYDLKELFKVGGDVPDTN-YLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLKKYGSITVWRYCAEIFDYLSLSAIIDNRVFCVHGGL-SPSISTLDQIRSIDRKQEVPHDGPMCDLLWSDPEDIQGWGVSPRGAGYLFGSDVVAQYNAANDIDLICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILEL----DEHLKREFTIFEAAPQ 291          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO36272 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7SJ38])

HSP 1 Score: 205.297 bits (521), Expect = 8.656e-59
Identity = 118/310 (38.06%), Postives = 170/310 (54.84%), Query Frame = 1
Query:  640 LIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSK--------RGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYEL------THYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRP 1527
            L  HF  + ++  + AL I+      L K  +++E+D P     T+CGDIHGQ++DL  +FE+ G P+    YLF GD+VDRG FS+EC+  L   K LY N  ++ RGNHE  ++ + + F+ E K KYS  + +   E F+ LPLA L+N++ L +HGGL   E  TL+D+K +DR ++PP  G MCDLLWSDP    G   +         RG    +    T +F   N L  I+R+HE +D GY +      T +   +T+FSAPNY D  +N+ A +  +   N+ M      F   PHP   P
Sbjct:   24 LKAHFILEGRVEDEVALKIINDGTAILRKEKTMLEVDAP----ITVCGDIHGQFYDLVKLFEVGGSPATTR-YLFLGDYVDRGYFSIECVLYLWTLKCLYTNTLFLLRGNHECRHLTEYFTFKTECKIKYSEAVYDACMESFDCLPLAALMNQQFLCVHGGL-SPEIHTLDDVKKLDRFKEPPAFGPMCDLLWSDPLEDYGNEKTSEHFSHNTVRGCSYFYSYPATCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYNNKAAVLKYE---NNVM--NIRQFNCSPHPYWLP 322          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ppp5c (protein phosphatase 5 catalytic subunit [Source:NCBI gene;Acc:101158545])

HSP 1 Score: 650.588 bits (1677), Expect = 0.000e+0
Identity = 310/498 (62.25%), Postives = 384/498 (77.11%), Query Frame = 1
Query:   70 MTSENGDSSKIQKAEEHKIKANEFFKNGDYNNAIVEYEKSIEIMPS-AVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEE-KKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRPMAYANSLLSM 1557
            + +E   +    +AE  K KAN +FK  DY NAI  Y +++E+ PS A+YYSNRS AYL+TEC+GYAL DA  A+ +D NY+KGYYRRA++NMALGKFK A +D+ETVVR+  NDKDAKMK +EC KIV+++AFE+AIA +E KKS +D  DI  + IE  Y GP LE+ +VT              SFM  +++ FK+QKKLHRK A  IL Q+KD LSKLPSLVEI + ET K TICGD HGQY+DL NIF++NGLPS  NPYLFNGDFVDRGSFS+E I TL GFKLLYP++F++ RGNHE++NMNQMYGFEGEVKAKY+  M ++F+EVF WLPLA  IN ++L MHGGLF ++ VTL+DI+ IDRNRQPP++G MCDLLWSDPQ   GR+ SKRGV CQFGPDVTE F  +NKLDYI+RSHEVK EGYE+TH  +C+TVFSAPNYCD M N+GAYI+++G   S + P+F  F  VPHPNV+PMAYAN+L+ +
Sbjct:    7 VVTEEKMAEAANEAELLKEKANNYFKEKDYENAIKFYSEALELNPSNAIYYSNRSLAYLRTECYGYALADATKALEVDKNYIKGYYRRATSNMALGKFKAALKDYETVVRVRPNDKDAKMKYQECNKIVKQKAFERAIASDETKKSVVDSLDIESMTIEDDYAGPKLEDGKVTV-------------SFMTDMMEWFKEQKKLHRKCAYQILVQVKDVLSKLPSLVEITLKETDKLTICGDTHGQYYDLLNIFKLNGLPSDANPYLFNGDFVDRGSFSLEVILTLFGFKLLYPDNFHLLRGNHETDNMNQMYGFEGEVKAKYTAQMFQLFSEVFQWLPLAQCINSKVLVMHGGLFSEDGVTLDDIRKIDRNRQPPDSGPMCDLLWSDPQPQNGRSVSKRGVSCQFGPDVTESFLEKNKLDYIIRSHEVKAEGYEVTHSGKCITVFSAPNYCDQMGNKGAYIHLRG---SDLKPEFHQFTAVPHPNVKPMAYANTLMQL 488          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ppp5c (protein phosphatase 5 catalytic subunit [Source:NCBI gene;Acc:101158545])

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 294/498 (59.04%), Postives = 367/498 (73.69%), Query Frame = 1
Query:   70 MTSENGDSSKIQKAEEHKIKANEFFKNGDYNNAIVEYEKSIEIMPS-AVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEE-KKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRPMAYANSLLSM 1557
            + +E   +    +AE  K KAN +FK  DY NAI  Y +++E+ PS A+YYSNRS AYL+TEC+GYAL DA  A+ +D NY+KGYYRRA++NMALGKFK A +D+ETVVR+  NDKDAKMK +EC KIV+++AFE+AIA +E KKS +D  DI  + IE  Y GP LE+ +VT              SFM  +++ FK+QKKLHRK A                       +T K TICGD HGQY+DL NIF++NGLPS  NPYLFNGDFVDRGSFS+E I TL GFKLLYP++F++ RGNHE++NMNQMYGFEGEVKAKY+  M ++F+EVF WLPLA  IN ++L MHGGLF ++ VTL+DI+ IDRNRQPP++G MCDLLWSDPQ   GR+ SKRGV CQFGPDVTE F  +NKLDYI+RSHEVK EGYE+TH  +C+TVFSAPNYCD M N+GAYI+++G   S + P+F  F  VPHPNV+PMAYAN+L+ +
Sbjct:    7 VVTEEKMAEAANEAELLKEKANNYFKEKDYENAIKFYSEALELNPSNAIYYSNRSLAYLRTECYGYALADATKALEVDKNYIKGYYRRATSNMALGKFKAALKDYETVVRVRPNDKDAKMKYQECNKIVKQKAFERAIASDETKKSVVDSLDIESMTIEDDYAGPKLEDGKVTV-------------SFMTDMMEWFKEQKKLHRKCAY----------------------QTDKLTICGDTHGQYYDLLNIFKLNGLPSDANPYLFNGDFVDRGSFSLEVILTLFGFKLLYPDNFHLLRGNHETDNMNQMYGFEGEVKAKYTAQMFQLFSEVFQWLPLAQCINSKVLVMHGGLFSEDGVTLDDIRKIDRNRQPPDSGPMCDLLWSDPQPQNGRSVSKRGVSCQFGPDVTESFLEKNKLDYIIRSHEVKAEGYEVTHSGKCITVFSAPNYCDQMGNKGAYIHLRG---SDLKPEFHQFTAVPHPNVKPMAYANTLMQL 466          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: PPP1CB (serine/threonine-protein phosphatase PP1-beta catalytic subunit [Source:NCBI gene;Acc:101155811])

HSP 1 Score: 218.394 bits (555), Expect = 8.553e-65
Identity = 113/258 (43.80%), Postives = 164/258 (63.57%), Query Frame = 1
Query:  691 IILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMS-RGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGS 1461
            + +K  + +LS+ P L+E++ P      ICGDIHGQY DL  +FE  G P + N YLF GD+VDRG  S+E I  LL +K+ YP +F++ RGNHE  ++N++YGF  E K ++++ + + FT+ FN LP+A +I+++I   HGGL  D   ++E I+ I R    P+TGL+CDLLWSDP    +G   + RGV   FG DV  KF  ++ LD I R+H+V ++GYE     + VT+FSAPNYC    N G  +++  S
Sbjct:   37 LCIKSREIFLSQ-PILLELEAP----LKICGDIHGQYTDLLRLFEYGGFPPEAN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQ-SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDES 287          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ENSORLT00000019964.2 (protein phosphatase 1 catalytic subunit gamma [Source:NCBI gene;Acc:101161814])

HSP 1 Score: 218.009 bits (554), Expect = 1.039e-64
Identity = 119/293 (40.61%), Postives = 176/293 (60.07%), Query Frame = 1
Query:  691 IILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMS-RGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPN-VRPMAYANSLLSMLA 1563
            + LK  + +LS+ P L+E++ P      ICGDIHGQY+DL  +FE  G P + N YLF GD+VDRG  S+E I  LL +K+ YP +F++ RGNHE  ++N++YGF  E K +Y++ + + FT+ FN LP+A +++++I   HGGL  D   ++E I+ I R    P+ GL+CDLLWSDP     G   + RGV   FG +V  KF  ++ LD I R+H+V ++GYE     + VT+FSAPNYC    N GA +++  +       Q     E   PN  RP+    ++++  A
Sbjct:   38 LCLKSREIFLSQ-PILLELEAP----LKICGDIHGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ-SMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGSEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSF--QILKPAEKKKPNGSRPVTPPRNMVTKQA 321          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ENSORLT00000013925.2 (serine/threonine-protein phosphatase PP1-beta catalytic subunit [Source:NCBI gene;Acc:101158483])

HSP 1 Score: 217.238 bits (552), Expect = 2.221e-64
Identity = 111/255 (43.53%), Postives = 163/255 (63.92%), Query Frame = 1
Query:  691 IILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMS-RGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINI 1452
            + +K  + +LS+ P L+E++ P      ICGDIHGQY DL  +FE  G P + N YLF GD+VDRG  S+E I  LL +K+ YP +F++ RGNHE  ++N++YGF  E K ++++ + + FT+ FN LP+A +++++I   HGGL  D   ++E I+ I R    P+TGL+CDLLWSDP    +G   + RGV   FG DV  KF  ++ LD I R+H+V ++GYE     + VT+FSAPNYC    N G  +++
Sbjct:   37 LCIKSREIFLSQ-PILLELEAP----LKICGDIHGQYTDLLRLFEYGGFPPEAN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ-SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSV 284          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000019044.1 (SMESG000019044.1)

HSP 1 Score: 1041.18 bits (2691), Expect = 0.000e+0
Identity = 497/498 (99.80%), Postives = 497/498 (99.80%), Query Frame = 1
Query:   70 MTSENGDSSKIQKAEEHKIKANEFFKNGDYNNAIVEYEKSIEIMPSAVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEEKKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRPMAYANSLLSMLA 1563
            MTSENGDSSKIQKAEEHKIKANEFFKNGDYNNAIVEYEKSIEIMPSAVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEEKKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKL SLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRPMAYANSLLSMLA
Sbjct:    1 MTSENGDSSKIQKAEEHKIKANEFFKNGDYNNAIVEYEKSIEIMPSAVYYSNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLAQQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEEKKSTLDLTDINEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLSSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRPMAYANSLLSMLA 498          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000076282.1 (SMESG000076282.1)

HSP 1 Score: 241.506 bits (615), Expect = 3.063e-70
Identity = 132/342 (38.60%), Postives = 189/342 (55.26%), Query Frame = 1
Query:  523 NEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSV---TMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQ------PPETGL-------MCDLLWSDPQMSRG-RAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSF 1497
            N+I +E+ Y GP ++              + +T + +  LI  F  ++ LH  Y   +L Q +  L   P++ E D+      TICGD+HGQ  DL  IFE N  P   NPY+FNGDF+DRG  SVE    L  F +LYP   ++ RGNHE + MN  YGF  EV+ KY     +++ +F ++F WLPLA +I+ +I   HGG+     + LE +KNIDR++       P ++ L       + D+LWSDP+  +G R    RG GC FGPD+T +F  + K   ++RSHE K  GYE  H D  +T+FSA NY DT  N+GA++ +  S    + P+  SF
Sbjct:  110 NDIPLETDYSGPIIQ--------------FPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGI--SNRIQLETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKS----LEPKIISF 431          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000076282.1 (SMESG000076282.1)

HSP 1 Score: 241.121 bits (614), Expect = 3.797e-70
Identity = 132/342 (38.60%), Postives = 189/342 (55.26%), Query Frame = 1
Query:  523 NEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKKLHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSV---TMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQ------PPETGL-------MCDLLWSDPQMSRG-RAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINIKGSYNSKMAPQFFSF 1497
            N+I +E+ Y GP ++              + +T + +  LI  F  ++ LH  Y   +L Q +  L   P++ E D+      TICGD+HGQ  DL  IFE N  P   NPY+FNGDF+DRG  SVE    L  F +LYP   ++ RGNHE + MN  YGF  EV+ KY     +++ +F ++F WLPLA +I+ +I   HGG+     + LE +KNIDR++       P ++ L       + D+LWSDP+  +G R    RG GC FGPD+T +F  + K   ++RSHE K  GYE  H D  +T+FSA NY DT  N+GA++ +  S    + P+  SF
Sbjct:  114 NDIPLETDYSGPIIQ--------------FPLTLTVITSLINAFNNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGI--SNRIQLETLKNIDRSKYISALNCPSDSELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKS----LEPKIISF 435          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000024840.1 (SMESG000024840.1)

HSP 1 Score: 220.32 bits (560), Expect = 6.126e-66
Identity = 107/241 (44.40%), Postives = 157/241 (65.15%), Query Frame = 1
Query:  733 SLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMS-RGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINI 1452
            SL+E++ P      ICGDIHGQY DL  +F+  G P   N YLF GD+VDRG  S+EC+  LL +K+ +P +F++ RGNHES  +N++YGF  EVK +YS+ + +MFT++FN LP A LI+++I+  HGGL        + +++I R  + P+ GL CD+LW+DP+   +G   + RGV   FG D  E+F  +N +D I R+H+V ++GYE     + VT+FSAPNYC    N GA +++
Sbjct:   47 SLLELEAP----LKICGDIHGQYVDLLRLFDYGGYPPTAN-YLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFA-KQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSV 281          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000024840.1 (SMESG000024840.1)

HSP 1 Score: 220.32 bits (560), Expect = 6.913e-66
Identity = 107/241 (44.40%), Postives = 157/241 (65.15%), Query Frame = 1
Query:  733 SLVEIDVPETSKFTICGDIHGQYFDLCNIFEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGNHESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHGGLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMS-RGRAPSKRGVGCQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCDTMHNRGAYINI 1452
            SL+E++ P      ICGDIHGQY DL  +F+  G P   N YLF GD+VDRG  S+EC+  LL +K+ +P +F++ RGNHES  +N++YGF  EVK +YS+ + +MFT++FN LP A LI+++I+  HGGL        + +++I R  + P+ GL CD+LW+DP+   +G   + RGV   FG D  E+F  +N +D I R+H+V ++GYE     + VT+FSAPNYC    N GA +++
Sbjct:   50 SLLELEAP----LKICGDIHGQYVDLLRLFDYGGYPPTAN-YLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFA-KQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSV 284          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP5C0.000e+061.68protein phosphatase 5 catalytic subunit [Source:HG... [more]
PPP5C0.000e+060.84protein phosphatase 5 catalytic subunit [Source:HG... [more]
PPP5C1.942e-17259.11protein phosphatase 5 catalytic subunit [Source:HG... [more]
PPP1CC5.937e-6540.61protein phosphatase 1 catalytic subunit gamma [Sou... [more]
PPP1CA1.358e-6443.92protein phosphatase 1 catalytic subunit alpha [Sou... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pph-50.000e+060.21Serine/threonine-protein phosphatase 5 [Source:Un... [more]
pef-16.157e-6736.81Serine/threonine-protein phosphatase with EF-hands... [more]
pef-12.570e-6636.26Serine/threonine-protein phosphatase with EF-hands... [more]
pef-17.731e-6636.26Serine/threonine-protein phosphatase with EF-hands... [more]
gsp-15.582e-6545.75Serine/threonine-protein phosphatase PP1-alpha [S... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PpD30.000e+061.27gene:FBgn0005777 transcript:FBtr0082129[more]
PpD30.000e+061.27gene:FBgn0005777 transcript:FBtr0082128[more]
PpD30.000e+061.27gene:FBgn0005777 transcript:FBtr0331693[more]
PpD54.016e-6542.18gene:FBgn0005778 transcript:FBtr0071806[more]
rdgC9.187e-6539.09gene:FBgn0265959 transcript:FBtr0342946[more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp5c0.000e+063.51protein phosphatase 5, catalytic subunit [Source:Z... [more]
ppp1cb8.966e-6543.80protein phosphatase 1, catalytic subunit, beta iso... [more]
CABZ01076667.19.516e-6540.07protein phosphatase 1, catalytic subunit, gamma is... [more]
ppp1cab8.775e-6442.75protein phosphatase 1, catalytic subunit, alpha is... [more]
ppp1caa8.886e-6442.35protein phosphatase 1, catalytic subunit, alpha is... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp5c0.000e+060.00protein phosphatase 5, catalytic subunit [Source:N... [more]
ppp5c0.000e+058.74protein phosphatase 5, catalytic subunit [Source:N... [more]
ppp5c0.000e+058.02protein phosphatase 5, catalytic subunit [Source:N... [more]
ppp1cc5.546e-6540.61protein phosphatase 1, catalytic subunit, gamma is... [more]
ppp1cc6.905e-6540.61protein phosphatase 1, catalytic subunit, gamma is... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppp5c0.000e+061.07protein phosphatase 5, catalytic subunit [Source:M... [more]
Ppp5c0.000e+058.81protein phosphatase 5, catalytic subunit [Source:M... [more]
Ppef11.081e-6836.58protein phosphatase with EF hand calcium-binding d... [more]
Ppp1cc4.293e-6540.61protein phosphatase 1 catalytic subunit gamma [Sou... [more]
Ppp1ca8.317e-6543.92protein phosphatase 1 catalytic subunit alpha [Sou... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P53041|PPP5_HUMAN0.000e+061.68Serine/threonine-protein phosphatase 5 OS=Homo sap... [more]
sp|P53042|PPP5_RAT0.000e+061.27Serine/threonine-protein phosphatase 5 OS=Rattus n... [more]
sp|Q60676|PPP5_MOUSE0.000e+061.07Serine/threonine-protein phosphatase 5 OS=Mus musc... [more]
sp|Q9NES8|PPP5_CAEEL0.000e+060.21Serine/threonine-protein phosphatase 5 OS=Caenorha... [more]
sp|Q84XU2|PPP5_ARATH3.816e-17047.97Serine/threonine-protein phosphatase 5 OS=Arabidop... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PE570.000e+067.62Serine/threonine-protein phosphatase 5 OS=Schistoc... [more]
G4V8L20.000e+067.01TPR_REGION domain-containing protein OS=Schistosom... [more]
A0A075A2N40.000e+066.12TPR_REGION domain-containing protein OS=Opisthorch... [more]
A0A4S2KWR10.000e+065.91TPR_REGION domain-containing protein OS=Opisthorch... [more]
A0A095A3U80.000e+066.40Serine/threonine-protein phosphatase 5 OS=Schistos... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp5c0.000e+063.58protein phosphatase 5 catalytic subunit [Source:NC... [more]
ppp1cb3.278e-6544.19serine/threonine-protein phosphatase PP1-beta cata... [more]
ppp1cb5.242e-6544.19serine/threonine-protein phosphatase PP1-beta cata... [more]
PPP1CB7.121e-6543.80serine/threonine-protein phosphatase PP1-beta cata... [more]
PPP1CB8.606e-6543.80serine/threonine-protein phosphatase PP1-beta cata... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp5c0.000e+059.96protein phosphatase 5, catalytic subunit [Source:Z... [more]
ppp1cab1.811e-6443.92protein phosphatase 1, catalytic subunit, alpha is... [more]
ENSPMAT00000010086.13.125e-5944.74pep scaffold:Pmarinus_7.0:GL479411:90249:92178:-1 ... [more]
ppp3cb2.999e-5836.45protein phosphatase 3, catalytic subunit, beta iso... [more]
ppp1cb4.802e-5144.39protein phosphatase 1, catalytic subunit, beta iso... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PPT11.896e-11940.08Protein serine/threonine phosphatase; regulates Hs... [more]
GLC79.098e-6842.01Type 1 S/T protein phosphatase (PP1) catalytic sub... [more]
PPH219.779e-6238.51Catalytic subunit of protein phosphatase 2A (PP2A)... [more]
PPH222.623e-6138.18Catalytic subunit of protein phosphatase 2A (PP2A)... [more]
PPQ17.354e-5843.27Protein phosphatase that regulates the mating resp... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO470341.826e-7239.03Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO446487.375e-6744.31Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO297593.052e-6038.28Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO499361.526e-5939.93Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO362728.656e-5938.06Serine/threonine-protein phosphatase [Source:UniP... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp5c0.000e+062.25protein phosphatase 5 catalytic subunit [Source:NC... [more]
ppp5c0.000e+059.04protein phosphatase 5 catalytic subunit [Source:NC... [more]
PPP1CB8.553e-6543.80serine/threonine-protein phosphatase PP1-beta cata... [more]
ENSORLT00000019964.21.039e-6440.61protein phosphatase 1 catalytic subunit gamma [Sou... [more]
ENSORLT00000013925.22.221e-6443.53serine/threonine-protein phosphatase PP1-beta cata... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019044.10.000e+099.80SMESG000019044.1[more]
SMESG000076282.13.063e-7038.60SMESG000076282.1[more]
SMESG000076282.13.797e-7038.60SMESG000076282.1[more]
SMESG000024840.16.126e-6644.40SMESG000024840.1[more]
SMESG000024840.16.913e-6644.40SMESG000024840.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020485 ID=SMED30020485|Name=Serine/threonine-protein phosphatase|organism=Schmidtea mediterranea sexual|type=transcript|length=2105bp
TCTTCCGATCTTGCGTAAAGGCTGATATTTGATTTATTCAATTTTAATTA
ATAAATTTTTTTGTGTATAATGACATCAGAAAATGGAGATTCTTCTAAAA
TCCAAAAAGCAGAAGAACATAAAATCAAAGCAAATGAATTTTTTAAAAAC
GGTGATTACAATAATGCAATTGTTGAATACGAAAAATCAATTGAAATAAT
GCCATCAGCTGTTTATTATTCAAATAGAAGCTTCGCTTATTTGAAAACAG
AATGTTTTGGCTATGCTCTTATAGATGCTGATTTAGCAATCAGTCTTGAT
CCAAATTACGTTAAGGGTTATTATCGCAGAGCGTCAGCAAATATGGCCTT
GGGAAAATTTAAATTAGCACAACAAGACTTTGAAACAGTTGTTAGAATCT
ATAAAAATGACAAAGATGCTAAAATGAAACTAGAAGAATGTCGAAAAATC
GTTCGCAGGCGAGCGTTTGAAAAAGCTATAGCTGTAGAAGAGAAAAAATC
AACTCTGGATTTAACAGATATAAATGAAATTATAATCGAATCGTCATACG
ATGGTCCACATTTGGAAGAGATTGAAGTAACCTCTGACAAATGCAGATGT
TACGAGAATTATGCAGTCACCGAATCATTTATGCTTCATTTGATTCAACA
TTTCAAGCAGCAAAAGAAATTGCACAGAAAATATGCATTAATTATATTGA
AGCAAATCAAAGATTATCTTTCTAAGTTGCCCAGCTTAGTCGAGATCGAT
GTTCCAGAGACTTCAAAATTTACGATTTGTGGTGATATCCACGGTCAATA
TTTTGATTTGTGCAATATTTTCGAAATGAATGGACTGCCAAGCAAAGAAA
ATCCATATTTATTCAACGGTGACTTCGTTGACCGAGGCTCATTCTCCGTT
GAATGCATTTTTACACTTCTTGGATTCAAACTGTTGTACCCAAATCATTT
CTACATGGCGAGAGGAAATCACGAATCCGAGAATATGAATCAAATGTACG
GTTTCGAAGGAGAAGTGAAAGCCAAATATTCCGTTACCATGGTTGAAATG
TTCACAGAAGTTTTCAATTGGTTGCCTTTAGCTCATTTAATCAACAAACG
CATATTGGCCATGCACGGAGGTCTGTTCCGTGACGAAGACGTCACATTGG
AGGACATAAAGAACATCGATAGAAACCGACAACCACCGGAAACCGGGTTG
ATGTGTGATTTGTTGTGGTCGGATCCGCAGATGTCACGAGGACGAGCACC
ATCGAAACGAGGCGTTGGATGCCAATTTGGACCGGACGTAACGGAGAAAT
TCTGCTGCCAGAACAAACTGGATTACATAGTACGTAGCCACGAGGTGAAA
GACGAGGGCTATGAATTGACCCACTATGACAGGTGTGTGACGGTGTTCAG
TGCCCCTAACTACTGTGACACAATGCACAACCGAGGCGCTTATATCAACA
TCAAGGGCAGCTATAATAGCAAGATGGCTCCACAATTCTTTTCATTCAAA
GAGGTCCCACATCCGAATGTTAGGCCAATGGCGTATGCGAATAGCTTGCT
CTCGATGCTTGCATAACCGATTGATTTTGGTCGAAAACGTTTTTGAGAAA
ACTCACAATTTTTGGCAAAAAAAAAAATTATTTCAATTGCAACCACTATG
AATTTGTAATGAATATAATTAATTGATTTGATCTAATTCGTTACTAAATG
CTCAATGTAGATATTTTCTGTTTCTTCAAGTGACTTATCTAAATGATAAT
GTTGAATGTTTTCTTGATTATTTATTGTCGACATTTCTCCAGCAATAAAT
CGGGATTATAATTTTACAATTGATCCGTAAACATACTTCCCAACATTTTT
TAATTGAACATTTTTAAAGTATAATTCTCGAGTCTTGCCATTGATGACAT
TGCACATCGTATATCAATGCTATTTCCATTTTCGGCGTTTTATCGAAATC
AATTCGAAAAATTTGGATTTTAAATTTGAGTTGGTTTTGTTCCAATTTGC
CATATATATGTTGGAATGAAACCAAATAAACAATGTGGAATTCATTTTAA
AAATATGATATTTAAACAATCATTAAATATTTGCCAATTTTGTGTTGTGA
GATCG
back to top

protein sequence of SMED30020485-orf-1

>SMED30020485-orf-1 ID=SMED30020485-orf-1|Name=SMED30020485-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=499bp
MTSENGDSSKIQKAEEHKIKANEFFKNGDYNNAIVEYEKSIEIMPSAVYY
SNRSFAYLKTECFGYALIDADLAISLDPNYVKGYYRRASANMALGKFKLA
QQDFETVVRIYKNDKDAKMKLEECRKIVRRRAFEKAIAVEEKKSTLDLTD
INEIIIESSYDGPHLEEIEVTSDKCRCYENYAVTESFMLHLIQHFKQQKK
LHRKYALIILKQIKDYLSKLPSLVEIDVPETSKFTICGDIHGQYFDLCNI
FEMNGLPSKENPYLFNGDFVDRGSFSVECIFTLLGFKLLYPNHFYMARGN
HESENMNQMYGFEGEVKAKYSVTMVEMFTEVFNWLPLAHLINKRILAMHG
GLFRDEDVTLEDIKNIDRNRQPPETGLMCDLLWSDPQMSRGRAPSKRGVG
CQFGPDVTEKFCCQNKLDYIVRSHEVKDEGYELTHYDRCVTVFSAPNYCD
TMHNRGAYINIKGSYNSKMAPQFFSFKEVPHPNVRPMAYANSLLSMLA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR011236Ser/Thr_PPase_5
IPR041753PP5_C
IPR006186Ser/Thr-sp_prot-phosphatase
IPR019734TPR_repeat
IPR013235PPP_dom
IPR011990TPR-like_helical_dom_sf
IPR004843Calcineurin-like_PHP_ApaH
IPR029052Metallo-depent_PP-like
IPR013026TPR-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0005515protein binding
GO:0004721phosphoprotein phosphatase activity
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatasePRINTSPR00114STPHPHTASEcoord: 438..454
score: 57.94
coord: 296..320
score: 48.47
coord: 360..387
score: 50.67
coord: 416..436
score: 38.54
coord: 263..290
score: 55.83
coord: 330..356
score: 44.1
coord: 233..260
score: 48.42
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphataseSMARTSM00156pp2a_7coord: 201..480
e-value: 1.4E-132
score: 456.5
IPR019734Tetratricopeptide repeatSMARTSM00028tpr_5coord: 48..80
e-value: 150.0
score: 4.7
coord: 14..47
e-value: 0.037
score: 23.2
coord: 81..114
e-value: 0.042
score: 23.0
IPR019734Tetratricopeptide repeatPFAMPF13181TPR_8coord: 82..114
e-value: 0.013
score: 15.6
coord: 21..43
e-value: 0.1
score: 12.8
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 14..47
score: 8.703
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 81..114
score: 7.08
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 3..165
e-value: 6.5E-51
score: 174.4
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 12..141
NoneNo IPR availablePIRSFPIRSF033096PPPtase_5coord: 1..498
e-value: 1.3E-215
score: 714.0
NoneNo IPR availablePANTHERPTHR45668FAMILY NOT NAMEDcoord: 9..496
NoneNo IPR availableSUPERFAMILYSSF56300Metallo-dependent phosphatasescoord: 188..495
IPR004843Calcineurin-like phosphoesterase domain, ApaH typePFAMPF00149Metallophoscoord: 233..426
e-value: 3.7E-35
score: 122.3
IPR013235PPP domainPFAMPF08321PPP5coord: 121..225
e-value: 7.5E-29
score: 99.9
IPR029052Metallo-dependent phosphatase-likeGENE3DG3DSA:3.60.21.10coord: 174..498
e-value: 5.8E-131
score: 438.1
IPR011236Serine/threonine protein phosphatase 5PANTHERPTHR45668:SF5SERINE/THREONINE-PROTEIN PHOSPHATASE 5coord: 9..496
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 14..47
score: 8.957
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 47..114
score: 11.484
IPR041753PP5, C-terminal metallophosphatase domainCDDcd07417MPP_PP5_Ccoord: 160..491
e-value: 0.0
score: 591.539