MFS domain-containing protein

Overview
NameMFS domain-containing protein
Smed IDSMED30020480
Length (bp)1325
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MFS domain-containing protein (SMED30020480) t-SNE clustered cells

Violin plots show distribution of expression levels for MFS domain-containing protein (SMED30020480) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MFS domain-containing protein (SMED30020480) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MFS domain-containing protein (SMED30020480) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020480

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30020480SMESG000062792.1 dd_Smed_v4_634_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30020480SMESG000062792.1 dd_Smed_v6_634_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30020480SMESG000062792.1 OX_Smed_1.0.21586ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
goblet cellSMED30020480SMESG000062792.1 dd_Smed_v6_634_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MFS domain-containing protein vs. Ensembl Zebrafish
Match: rpz3 (rapunzel 3 [Source:ZFIN;Acc:ZDB-GENE-030131-4784])

HSP 1 Score: 67.0106 bits (162), Expect = 1.166e-11
Identity = 68/282 (24.11%), Postives = 123/282 (43.62%), Query Frame = 3
Query:  207 PLLKSIGYFSKVIMAQFETESKELTYMKEQFKIINDKMDTVDQQFDEVKKAINWNVVKVQYFNHETAIGLLQDMILSISDAPSNVRQMMMDRFRITYDQTYYNAADK----LYESFTNPQRIFSENLVTASCQTFNFHRRKVEKFFLGNIQLILKG-LEVESFYLTTKNLTSNQDYWAEQWNKKINQISAIMEETINSIKGNWHSQLQKDAEEFNVKNYGKGNKEYLEEFYNFLTDKFSWREWFLVVYNPITGGDNHYVSVYGGIINLRSRGHNIAVASRDK 1037
            PL ++     K+++     ESKE+TY+K+QF ++  K+D +  Q  ++   I    +  Q+F+ E  +       + I +A    +++   + R+  D  +    +K    LY++       F E ++    Q    +RR +E F +   +L+  G + +  +   T+   + Q+   E W+ KI +I   M+ETI     ++  Q + D +    +      +E   E  +FLT KF W  W + V           +S  G I NLR+ G N    S  K
Sbjct:   39 PLFEAAAPVLKLVLNN--VESKEVTYVKDQFLVVRSKLDVLSCQLQDIDSEIRRRRLDTQFFSVEENMRNQFRKYIDILEAKPEYKEV---KKRLFLDHFFITGGEKNLCLLYDAVMG-NSTFGEPILEVVEQYEARNRRVLEDFCVRLKELLCLGIIALLGYCFLTQGEEAEQEKIQE-WSTKIQEIETKMKETIEKCVQSFPEQAELDIKRLLKEKEEANLQETARELLDFLTKKFDWVCWSIRV-----------ISNMGKISNLRA-GQNFQCVSGQK 301          
BLAST of MFS domain-containing protein vs. Ensembl Zebrafish
Match: rpz6 (rapunzel 6 [Source:ZFIN;Acc:ZDB-GENE-170530-5])

HSP 1 Score: 63.5438 bits (153), Expect = 1.470e-10
Identity = 66/264 (25.00%), Postives = 113/264 (42.80%), Query Frame = 3
Query:  261 TESKELTYMKEQFKIINDKMDTVDQQFDEVKKAINWNVVKVQYFNHETAIGLLQDMILSISDAPSNVRQMMMDRFRITYDQTYYNAADK----LYESFTNPQRIFSENLVTASCQTFNFHRRKVEKFFLGNIQLILKG-LEVESFYLTTKNLTSNQDYWAEQWNKKINQISAIMEETINSIKGNWHSQLQKDAEEFNVKNYGKGNKEYLEEFYNFLTDKFSWREWFLVVYNPITGGDNHYVSVYGGIINLRSRGHNIAVASRDK 1037
             ESKE+TY+K+QF ++  K+D +  Q +++   I    +  Q+F  E  I       + I +A    +++   R R+          +K    LY++       F E ++    Q    +RR +E F +   +L+  G + +  +   T+   + Q+   E W+ KI +I   M+ETI     ++  Q + D +    +      +E   E  +FLT KF W  W + V           +S  G I NLR+ G N    S  K
Sbjct:   55 VESKEVTYVKDQFLVVRSKLDVLSSQIEDINCEIKKGRLDSQFFTVEENICNQFRKYIDILEAKPEYKEV---RKRLFLQHFPKTGGEKNLYMLYDAVMG-NSTFGEPILEVVEQYEARNRRVLEDFCVRLKELLCLGIIALLGYCFLTQGEEAEQEKIQE-WSTKIEEIETKMKETIEKCVQSFPEQAELDIKRLLKEKEEANLQETARELLDFLTKKFDWVCWSIRV-----------ISNMGKISNLRA-GQNFQCVSGQK 301          
BLAST of MFS domain-containing protein vs. Ensembl Zebrafish
Match: rpz4 (rapunzel 4 [Source:ZFIN;Acc:ZDB-GENE-050417-472])

HSP 1 Score: 54.299 bits (129), Expect = 1.343e-7
Identity = 53/235 (22.55%), Postives = 103/235 (43.83%), Query Frame = 3
Query:  261 TESKELTYMKEQFKIINDKMDTVDQQFDEVKKAINWNVVKVQYFNHETAIGLLQDMILSISDAPSNVRQMMMDRFRITYDQTYYNAADK----LYESFTNPQRIFS-ENLVTASCQTFNFHRRKVEKFFLGNIQLILKGLEVESFYLTTKNLTSNQDYWAEQWNKKINQISAIMEETINSIKGNWHSQLQKDAEEFNVKNYGKGNKEYLEEFYNFLTDKFSWREWFLVVYNPITG 950
             ESKE  YMKEQF+ + D+++ V ++  ++ + I  + V   YF  E  +       + + +A    R++    F   +++T     DK    LY + T     FS E+++  +       RR VE++     +L   GL     +   K     ++   ++W++K+  + + M   I     ++ +Q + DA+        K N++  +     L  K+ W  W + ++N  TG
Sbjct:   55 VESKEAEYMKEQFQKVRDRLEVVSEEVQQINQEIKKSGVDATYFTVEENLTNQFRKFMDVLNAKPKFREVRKKTFLDHFNRT---GGDKNLHTLYSAVTGDN--FSGESVLEITLNYEQKSRRAVEEYCATLKKLFCVGLIALLGHAALKG-DDEEEKLLQEWSEKMKVVQSKMIVVIEDCINSFPTQSELDAKRIVRDQSDKSNQQLADMLVEHLKKKYDWVCWSVRIFNSPTG 283          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: V4B6X2 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_237783 PE=4 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 8.072e-40
Identity = 96/304 (31.58%), Postives = 152/304 (50.00%), Query Frame = 3
Query:  207 PLLKSIGYFSKVIMAQF-ETESKELTYMKEQFKIINDKMDTVDQQFDEVKKAINWNVVKVQYFNHETAIGLLQDMILSISDAPSNVRQMMMDRFRITYDQTYYNAADKLYESFTNPQRIFSENLVTASCQTFNFHRRKVEKFFLGNIQLILKGLEVESFYLTTKNLTSNQDYWAEQWNKKINQISAIMEETINSIKGNWHSQLQKDAEEFNVKN--YGKGNKEYLEEFYNFLTDKFSWREWFLVVYNPITGGDNHYVSVYGGIINLRSRGHNIAVASRDKEDNNFNSNLISQVLDNL----PRS 1097
            P L  +G F   IM  F  +ES EL  +K  +  ++++ D VD QF EVK+ I+W+ +++QY + E  I  +     +I        +     F   ++  Y N+  KLY+   N  R+F + L TA  +   + R K + F LG +QL++K  ++E  Y   K  T+    +  QW  +   I   M  T NSI   +H+Q  KD + + +K+      N ++    Y FLT K+SWR+W  + YN ITG + HYV   GG +  R+ G N+ VAS D+   + N      V++N+    PR+
Sbjct:   62 PFLGIVGPFVSFIMGFFGHSESAELKAIKRLYTEVDNRFDKVDLQFIEVKRLIDWSKIQIQYSDIEQKINAVNQEFENIYKFSIGAVKTTASAFVKNFESDYQNSGSKLYDGIMNEGRVFGDGLFTAIIKYSEYDRGKSQTFMLGLLQLLMKAAKLELTYHQLKGHTAALHDYQNQWRTRFTHIRIKMMSTDNSIVSQYHTQSGKDIDNYLIKHPKNTMNNNDFNNMLYGFLTKKYSWRDWLTITYNDITGSNVHYVGECGGYLKFRNHGRNVVVASVDRRKGHINMAQAQSVVNNVDSCHPRT 365          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A267E0I7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026172g1 PE=4 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 1.687e-39
Identity = 104/351 (29.63%), Postives = 164/351 (46.72%), Query Frame = 3
Query:  261 TESKELTYMKEQFKIINDKMDTVDQQFDEVKKAINWNVVKVQYFNHETAIGLLQDMILSISDAPSNVRQMMMDRFRITYDQTYYNAADKLYESFTNPQRIFSENLVTASCQTFNFHRRKVEKFFLGNIQLILKGLEVESFYLTTKNLTSNQDYWAEQWNKKINQISAIMEETINSIKGNWHSQLQKDAEEFNVKNYGKGNKEYLEEFYNFLTDKFSWREWFLVVYNPITGGDNHYVSVYGGIINLRSRG-HNIAVASRDKEDNNFNSNLISQVLDNLPR----SFNTKGKGLAESLLMDQLIPAIQRVHKYSLAAVIEWGAGVWFISNNQFRAYKKYTGPRGRTYNIIVMG 1298
            TES E+ +++EQF  ++ K+D++  Q D+VK+ I W   +V Y N+ET I     ++ +   AP + R+++  +F   +      A  KLY++      + +ENL  A       HRR V  F L   +LI++G ++E  Y    +     +     WN ++ ++   M    N IK  +HSQ+  D     + N    NK++    Y FL DKF  R WF + Y  ++GGD H+VS  GG +  R+ G  N+ VAS DK  + F+    +  LD+  R    S       L  S + +    A       +    I WG  VWF   +    Y+K +  RG   N I+ G
Sbjct:  117 TESAEMKFLREQFAQVHAKLDSISLQLDDVKRLIEWRTTRVMYANYETFIIAASSILNNYVAAPESSREVLKRQFIAAFQHNPL-APLKLYQAIVEKDFVIAENLAAAVVHYTQNHRRHVINFLLAMQRLIMRGAQLEIAYEKMVHGDGAGNVAKTVWNGRMEKLLIRMMRLENEIKSKYHSQMTSDIGGVILNNRHLSNKDFSGHMYRFLADKFDHRNWFSLAYKDVSGGDKHWVSFCGGDLRFRTHGSRNVVVASADKRSSRFSQPRGNAALDDAQRVGSGSHAESWTNLIRSKIGNSCADA-------AFVGSICWGCDVWFTMRSDRYVYRKMSN-RG-DINTIIFG 457          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: V4AXV0 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_238695 PE=4 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 4.726e-39
Identity = 101/318 (31.76%), Postives = 156/318 (49.06%), Query Frame = 3
Query:  162 SDFV---KTTQAISKWGL---PLLKSIGYFSKVIMAQF-ETESKELTYMKEQFKIINDKMDTVDQQFDEVKKAINWNVVKVQYFNHETAIGLLQDMILSISDAPSNVRQMMMDRFRITYDQTYYNAADKLYESFTNPQRIFSENLVTASCQTFNFHRRKVEKFFLGNIQLILKGLEVESFYLTTKNLTSNQDYWAEQWNKKINQISAIMEETINSIKGNWHSQLQKDAEEFNVKN--YGKGNKEYLEEFYNFLTDKFSWREWFLVVYNPITGGDNHYVSVYGGIINLRSRGHNIAVASRDKEDNNFNSNLISQVLDNL 1088
             DFV   K T  I K      P L  +G F   IM  F ++ES EL  +K  +  ++++ D VD QF EVK+ I+W+ ++VQY + E  I  +     +I    +   +     F   Y+  Y N+  KLY+   N  R+F + L TA  +   + R K + F LG +QL++K  ++E  Y   K   +    +  QW  +   I   M  T +SI   +H+Q  KD + + +K+      N ++    Y FL+ K+ WR+WF V YN ITG + HYV   GG I  R+ G N+ VAS D    + N      +++N+
Sbjct:   41 GDFVVAKKFTNVIGKLATAVTPFLGIVGPFVSFIMGFFGQSESAELKAIKRLYTEVDNRFDKVDLQFIEVKRMIDWSKIQVQYSDIEQKINAVNKAFENIYKFSTAAVKTTTSAFVSNYESDYQNSGSKLYDGIMNEGRVFGDGLFTAVVKYSEYDRVKSQTFMLGLLQLLMKAAKLELTYHQLKGHKAALHDYQNQWRTRFTHIRIKMMSTDSSIVSQYHTQSGKDIDNYLIKHQKNTMNNNDFNNALYAFLSKKYFWRDWFTVTYNDITGSNVHYVGECGGHIKFRNHGRNVVVASVDSRKGHINMGQALSIVNNV 358          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A1I8HMN9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 5.078e-38
Identity = 97/325 (29.85%), Postives = 153/325 (47.08%), Query Frame = 3
Query:  261 TESKELTYMKEQFKIINDKMDTVDQQFDEVKKAINWNVVKVQYFNHETAIGLLQDMILSISDAPSNVRQMMMDRFRITYDQTYYNAADKLYESFTNPQRIFSENLVTASCQTFNFHRRKVEKFFLGNIQLILKGLEVESFYLTTKNLTSNQDYWAEQWNKKINQISAIMEETINSIKGNWHSQLQKDAEEFNVKNYGKGNKEYLEEFYNFLTDKFSWREWFLVVYNPITGGDNHYVSVYGGIINLRSRG-HNIAVASRDKEDNNFNSNLISQVLDNLPR----SFNTKGKGLAESLLMDQLIPAIQRVHKYSLAAVIEWGAGVWF 1220
            TES E+ +++EQF  ++ K+D++  Q D+VK+ I W   +V Y N+ET I     ++ +   AP + R+++  +F   +      A  KLY++      + +ENL  A       HRR V  F L   +LI++G ++E  Y    +     +     WN ++ ++   M    N IK  +HSQ+  D     + N    NK++    Y FL DKF  R WF + Y  ++GGD H+VS  GG +  R+ G  N+ VAS DK  + F+    +  LD+  R    S       L  S + +    A       +    I WG  VWF
Sbjct: 1443 TESAEMKFLREQFAQVHAKLDSISLQLDDVKRLIEWRTTRVMYANYETFIIAASSILNNYVAAPESSREVLKRQFIAAFQHNPL-APLKLYQAIVEKDFVIAENLAAAVVHYTQNHRRHVINFLLAMQRLIMRGAQLEIAYEKMVHGDGAGNVAKTVWNGRMEKLLIRMMRLENEIKSKYHSQMTSDIGGVILNNRHLSNKDFSGHMYRFLADKFDHRNWFSLAYKDVSGGDKHWVSFCGGDLRFRTHGSRNVVVASADKRSSRFSQPRGNAALDDAQRVGSGSHAESWTNLIRSKIGNSCADA-------AFVGSICWGCDVWF 1759          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A1I8HCC0 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 5.684e-38
Identity = 97/325 (29.85%), Postives = 153/325 (47.08%), Query Frame = 3
Query:  261 TESKELTYMKEQFKIINDKMDTVDQQFDEVKKAINWNVVKVQYFNHETAIGLLQDMILSISDAPSNVRQMMMDRFRITYDQTYYNAADKLYESFTNPQRIFSENLVTASCQTFNFHRRKVEKFFLGNIQLILKGLEVESFYLTTKNLTSNQDYWAEQWNKKINQISAIMEETINSIKGNWHSQLQKDAEEFNVKNYGKGNKEYLEEFYNFLTDKFSWREWFLVVYNPITGGDNHYVSVYGGIINLRSRG-HNIAVASRDKEDNNFNSNLISQVLDNLPR----SFNTKGKGLAESLLMDQLIPAIQRVHKYSLAAVIEWGAGVWF 1220
            TES E+ +++EQF  ++ K+D++  Q D+VK+ I W   +V Y N+ET I     ++ +   AP + R+++  +F   +      A  KLY++      + +ENL  A       HRR V  F L   +LI++G ++E  Y    +     +     WN ++ ++   M    N IK  +HSQ+  D     + N    NK++    Y FL DKF  R WF + Y  ++GGD H+VS  GG +  R+ G  N+ VAS DK  + F+    +  LD+  R    S       L  S + +    A       +    I WG  VWF
Sbjct: 1548 TESAEMKFLREQFAQVHAKLDSISLQLDDVKRLIEWRTTRVMYANYETFIIAASSILNNYVAAPESSREVLKRQFIAAFQHNPL-APLKLYQAIVEKDFVIAENLAAAVVHYTQNHRRHVINFLLAMQRLIMRGAQLEIAYEKMVHGDGAGNVAKTVWNGRMEKLLIRMMRLENEIKSKYHSQMTSDIGGVILNNRHLSNKDFSGHMYRFLADKFDHRNWFSLAYKDVSGGDKHWVSFCGGDLRFRTHGSRNVVVASADKRSSRFSQPRGNAALDDAQRVGSGSHAESWTNLIRSKIGNSCADA-------AFVGSICWGCDVWF 1864          

HSP 2 Score: 140.969 bits (354), Expect = 5.080e-32
Identity = 94/344 (27.33%), Postives = 154/344 (44.77%), Query Frame = 3
Query:  264 ESKELTYMKEQFKIINDKMDTVDQQFDEVKKAINWNVVKVQYFNHETAIGLLQDMILSISDAPSNVRQMMMDRFRITYDQTYYNAADKLYESFTNPQRIFSENLVTASCQTFNFHRRKVEKFFLGNIQLILKGLEVESFYLTTKNLTSNQDYWAEQWNKKINQISAIMEETINSIKGNWHSQLQKDAEEFNVKNYGKGNKEYLEEFYNFLTDKFSWREWFLVVYNPITGGDNHYVSVYGGIINLRSR-GHNIAVASRDKEDNNFNSNLISQVLDNLPRSFNTKGKGLAESLLMDQLIPAI-QRVHKYSLAAVIEWGAGVWFISNNQFRAYKKYTGPRGRTYNII 1289
            ES E+ +M+EQFK ++ K+D++  Q +EVK+ I W   +V Y N+E+ I     ++ S   A   + + +  R  +T  +    AA KLY++        S+NL  A       HRR V  F L   +L+++G ++E  Y    +           W+ ++ ++   M++  N +   +HSQ+  D     + N    NK++    Y FL DKF  R W  + Y  ++GGD H+VS  GG    R+  G N+ VAS +   + F     +  LD   R     G G       + +   I       +    I WG  VWF   +    Y+K +  RG    ++
Sbjct: 2296 ESAEMKFMREQFKEVHAKLDSISLQLEEVKRLIEWQTTRVTYANYESFIVATTHLLDSYVGANDAMTREVHKRQFLTAFRKNPIAALKLYQAVVETDLTISDNLGVAVVHYTQNHRRNVMNFLLAMQRLVMRGAQLEIAYEKMVHGDHAATVTQALWDTRMEKMLTRMQQVENGVLSKYHSQMTSDIGRVILDNRHLSNKDFSGHMYRFLADKFDRRYWIALSYKDVSGGDKHWVSYCGGDARFRTHGGRNVVVASSNPGSSRFTRAKGNAALDAAQRV----GSGSHAESWTNLIRSKIGNSCSDAAFVGSICWGCDVWFTMRSDRYVYRKMSN-RGDINTVV 2634          
BLAST of MFS domain-containing protein vs. Ensembl Cavefish
Match: rpz6 (uncharacterized LOC103039477 [Source:NCBI gene;Acc:103039477])

HSP 1 Score: 58.151 bits (139), Expect = 6.576e-9
Identity = 59/241 (24.48%), Postives = 103/241 (42.74%), Query Frame = 3
Query:  240 VIMAQFETESKELTYMKEQFKIINDKMDTVDQQFDEVKKAINWNVVKVQYFNHETAIGLLQDMILSISDAPSNVRQMMMDRFRITYDQT-----YYNAADKLYESFTNPQRIFSENLVTASCQTFNFHRRKVEKFFLGNIQLILKGLEVESFYLTTKNLTSNQDYWAE---QWNKKINQISAIMEETINSIKGNWHSQLQKDAEEFNVKNYGKGNKEYLEEFYNFLTDKFSWREWFLVVYN 938
            V +A    +SKE+ Y+KEQF  + +K+D +  Q +++   I    +  QYF+ E  I       L I +A    R++    F   + +T      Y+  D L  S T     F  +++    +    +RR +E F +   +L   GL      L    LT  +D   E   +W++KI ++   M+ +I      +  Q + D +    +   K  ++  +E   FL  K+ W  W + V N
Sbjct:   48 VRLALDNVQSKEVVYVKEQFLAVRNKLDVLSNQLEDIDCEIKKGRLDYQYFSVEENIRNQFRKYLDILEAKPQFREVKKRLFLEHFSKTGGEKNLYDLYDALMGSST-----FGGSVLEVVEEYEARNRRVLEDFCVRMKELYCLGL---IALLGHCALTQGEDVEQEKIQEWSEKIQEVETKMKASIEECVAFFAEQAKLDVQRLIQEKEDKSLQDIAQELLTFLVRKYDWVSWSVRVIN 280          
BLAST of MFS domain-containing protein vs. Ensembl Cavefish
Match: rpz4 (uncharacterized LOC103039774 [Source:NCBI gene;Acc:103039774])

HSP 1 Score: 54.299 bits (129), Expect = 1.113e-7
Identity = 67/279 (24.01%), Postives = 116/279 (41.58%), Query Frame = 3
Query:  165 DFVKTTQAISKWGLPLLKSIG---------YFSKVIMAQFETESKELTYMKEQFKIINDKMDTVDQQFDEVKKAINWNVVKVQYFNHETAIGLLQDMILSISDAPSNVRQMMMDRFRITYDQTYYNAADK----LYESFTNPQRIFS-ENLVTASCQTFNFHRRKVEKFFLGNIQLILKGLEVESFYLTTKNLTSNQDY---WAEQWNKKINQISAIMEETINSIKGNWHSQLQKDAEEFNVKNYGKGNKEYLEEFYNFLTDKFSWREWFLVVYNPITG 950
            D V+T   + + G  ++ SI              V +A    ESKE  YMKEQF+ + ++++ V ++   + + +  +     YF+ E  +       + I +A    R++    F   + +T     DK    LY + T     FS E+++  S       RR VE F     QL   GL     +   K     +     WA++  +   +++A++E+ INS    + SQ + D +     N  K N++        L  K+ W  W + V+N  TG
Sbjct:   14 DVVETVMEVFEQGAEVVASIAGDLFPVFAIAAPIVKLALDNVESKEAEYMKEQFQRVRERLEVVSEEIQRINEEVKKSGADAAYFSVEENLTNQFRKYMDILNAKPKFREVKKKLFLEHFSKT---GGDKNLNILYNAVTGDN--FSGESVLEISLNYEQKSRRAVEDFCARLKQLFCVGLIALMGHAALKGGEDEEGLLKDWADKMKEVQLKMNAVIEDCINS----FPSQAEIDIKRLVRDNRDKPNQQLANMILEALKKKYDWIGWSIRVFNSPTG 283          
BLAST of MFS domain-containing protein vs. Ensembl Cavefish
Match: rpz5 (rapunzel 5 [Source:ZFIN;Acc:ZDB-GENE-030131-4678])

HSP 1 Score: 50.8322 bits (120), Expect = 1.546e-6
Identity = 48/248 (19.35%), Postives = 104/248 (41.94%), Query Frame = 3
Query:  207 PLLKSIGYFSKVIMAQFETESKELTYMKEQFKIINDKMDTVDQQFDEVKKAINWNVVKVQYFNHETAI----GLLQDMILSISDAPSNVRQMMMDRFRITYDQTYYNAADKLYESFTNPQRIFSENLVTASCQTFNFHRRKVEKFFLGNIQLILKGLEVESFYLTTKNLTSNQDYWAEQWNKKINQISAIMEETINSIKGNWHSQLQKDAEEFNVKNYGKGNKEYLEEFYNFLTDKFSWREWFLVVYN 938
            P+L+++   S  I++    E KE  Y+ EQF+ +N K++ +  + +++   +    +  Q F+ E  +       QD +L+        ++  +  F  T      +A   LY + T  +    + ++     T    RR VE+F     +L L G+     +   K+  +  +   ++W  ++  +   M+  ++    N+  Q + D E   V+     + ++ +     L  K+ W  W + V+N
Sbjct:   66 PILEAVFVASAEILSN--PEGKEAKYLAEQFERVNQKLEGIQDEIEKIALELQRTSMNKQNFDREAQMISQYEKFQDFVLAKPKFKEKKKEKFISHFENTDGDLNIDA---LYNAVTG-ENTSGDAMLDTVVTTEQRSRRAVEEFCAQLKKLFLVGIIAVMGHAALKD-GAVGEMMVKKWQDRMEDVERRMKAAVDECINNFPEQAKMDVEHQLVEKPASVDPDFAKNLLEALVKKYDWVSWSIRVFN 306          
BLAST of MFS domain-containing protein vs. Ensembl Medaka
Match: rpz4 (uncharacterized LOC101175680 [Source:NCBI gene;Acc:101175680])

HSP 1 Score: 51.2174 bits (121), Expect = 1.233e-6
Identity = 54/239 (22.59%), Postives = 96/239 (40.17%), Query Frame = 3
Query:  240 VIMAQFETESKELTYMKEQFKIINDKMDTVDQQFDEVKKAINWNVVKVQYFNHETAIGLLQDMILSISDAPSNVRQMMMDRFRITYDQTYYNAADKLYESFTNPQRIFSENLVTASCQTFNFHRRKVEKF-------FLGNIQLILKGLEVESFYLTTKNLTSNQDYWAEQWNKKINQISAIMEETINSIKGNWHSQLQKDAEEFNVKNYGKGNKEYLEEFYNFLTDKFSWREWFLVVY 935
            V +A    ES E  +MK+QF+ + D++D V ++   + + I  + +  ++F+ E  I       + I +A     ++    F   + ++  N       S       F E L+          RR +E++       F   I  +L    V+ F    + L      WAE+      +I+A++EE I S    + +Q + D E       G  NK+  +     L  K+ W  W + VY
Sbjct:  115 VQLALDNVESSEAAFMKDQFQKVRDRLDVVSEEIQRINEEIKKSRIDTEFFSVEENIRNQFRKYMEILNAKPQFTEVKKQNFLKHFSKSGGNKNLHSLYSVVVGDGFFGEPLLVTILNYEEKSRRPIEEYCARLKNLFCIGIIALLGHAAVDGFNEGEELLKE----WAEKMTNVQEKINAVVEECIVS----FPNQAKTDCERLVRDQEGLDNKQLADALIGILKKKYDWVGWSVRVY 345          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000062792.1 (SMESG000062792.1)

HSP 1 Score: 815.839 bits (2106), Expect = 0.000e+0
Identity = 424/426 (99.53%), Postives = 426/426 (100.00%), Query Frame = 3
Query:   21 MKFXXXXXXXXXXXXXPIYGLDTSPGXXXXXXXXXXXXXXXFNSIKESDFVKTTQAISKWGLPLLKSIGYFSKVIMAQFETESKELTYMKEQFKIINDKMDTVDQQFDEVKKAINWNVVKVQYFNHETAIGLLQDMILSISDAPSNVRQMMMDRFRITYDQTYYNAADKLYESFTNPQRIFSENLVTASCQTFNFHRRKVEKFFLGNIQLILKGLEVESFYLTTKNLTSNQDYWAEQWNKKINQISAIMEETINSIKGNWHSQLQKDAEEFNVKNYGKGNKEYLEEFYNFLTDKFSWREWFLVVYNPITGGDNHYVSVYGGIINLRSRGHNIAVASRDKEDNNFNSNLISQVLDNLPRSFNTKGKGLAESLLMDQLIPAIQRVHKYSLAAVIEWGAGVWFISNNQFRAYKKYTGPRGRTYNIIVMG 1298
            MKFCCYILCLCLSSLIPIYGLDTSPGKILEEASKLEKAKEIFNSIKESDFVKTTQAISKWGLPLLKSIGYFSKVIMAQFETESKELTYMKEQFKIINDKMDTVDQQFDEVKKAINWNVVKVQYFNHETAIGLLQDMILSISDAPSNVRQMMMDRFRITYDQTYYNAADKLYESFTNPQRIFSENLVTASCQTFNFHRRKVEKFFLGNIQLILKGLEVESFYLTTKNLTSNQDYWAEQWNKKINQISAIMEETINSIKGNWHSQLQKDAEEFNVKNYGKGNKEYLEEFYNFLTDKFSWREWFLVVYNPITGGDNHYVSVYGGIINLRSRGHNIAVASRDKEDNNFN+NLISQVLDNLPRSFNT+GKGLAESLLMDQLIPAIQRVHKYSLAAVIEWGAGVWFISNNQFRAYKKYTGPRGRTYNIIVMG
Sbjct:    1 MKFCCYILCLCLSSLIPIYGLDTSPGKILEEASKLEKAKEIFNSIKESDFVKTTQAISKWGLPLLKSIGYFSKVIMAQFETESKELTYMKEQFKIINDKMDTVDQQFDEVKKAINWNVVKVQYFNHETAIGLLQDMILSISDAPSNVRQMMMDRFRITYDQTYYNAADKLYESFTNPQRIFSENLVTASCQTFNFHRRKVEKFFLGNIQLILKGLEVESFYLTTKNLTSNQDYWAEQWNKKINQISAIMEETINSIKGNWHSQLQKDAEEFNVKNYGKGNKEYLEEFYNFLTDKFSWREWFLVVYNPITGGDNHYVSVYGGIINLRSRGHNIAVASRDKEDNNFNANLISQVLDNLPRSFNTRGKGLAESLLMDQLIPAIQRVHKYSLAAVIEWGAGVWFISNNQFRAYKKYTGPRGRTYNIIVMG 426          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000004912.1 (SMESG000004912.1)

HSP 1 Score: 327.02 bits (837), Expect = 2.889e-108
Identity = 155/340 (45.59%), Postives = 232/340 (68.24%), Query Frame = 3
Query:  144 FNSIKESDFVKTTQAISKWGLPLLKSIGYFSKVIMAQFETESKELTYMKEQFKIINDKMDTVDQQFDEVKKAINWNVVKVQYFNHETAIGLLQDMILSISDAPSNVRQMMMDRFRITYDQTYYNAADKLYESFTNPQRIFSENLVTASCQTFNFHRRKVEKFFLGNIQLILKGLEVESFYLTTKNLTSNQDYWAEQWNKKINQISAIMEETINSIKGNWHSQLQKDAEEFNVKNYGKGNKEYLEEFYNFLTDKFSWREWFLVVYNPITGGDNHYVSVYGGIINLRSRGHNIAVASRDKEDNNFNSNLISQVLDNLPRSFNTKGKGLAESLLMDQLIPAIQ 1163
            F++IKESD  KT +AI+KWG PLL++IG F+K+IM QFE++SKELT+MKEQFKI+N+KMD VDQQF+EVK+ ++WNVVK+QY  +E  + +LQ +I  I+D+P+++R + +D+F ++YDQ Y NAA+ LY+ F N  ++FSENLV A  +    HR ++EKFF+GNIQLI+K LEVE+FY+  KN TS + +W  +W+ ++N +  IM+     I  NW +Q   D EEFN +N  K ++ Y ++ YNFL DKF  R W ++VY+P+  G +H +    GI  ++  GHN+AV+S        N N  + +   +P++  + G G A  +L+  L P ++
Sbjct:   46 FDNIKESDMYKTGKAIAKWGKPLLEAIGSFAKIIMVQFESDSKELTFMKEQFKILNEKMDYVDQQFEEVKRLMDWNVVKIQYGKYEMHVYMLQHLIQIIADSPASLRHITIDKFLLSYDQVYDNAAENLYQGFINQNKVFSENLVLAIRKYTKDHRYQIEKFFMGNIQLIIKCLEVETFYINLKNFTSIEKFWQVKWSDRMNSLMDIMKTVSEKISENWEAQSNMDIEEFNAENGKKSHENYAKDLYNFLNDKFRNRIWLVLVYDPLDSGTDHALKACNGISQMQRNGHNVAVSSLPFGTRALNKNYYASICSRIPQNIGSWGHGPAHFVLLHYLQPKME 385          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000052592.1 (SMESG000052592.1)

HSP 1 Score: 156.377 bits (394), Expect = 9.796e-43
Identity = 102/378 (26.98%), Postives = 189/378 (50.00%), Query Frame = 3
Query:  144 FNSIKESDFVKTTQAISKWGLPLLKSIGYFSKVIMAQFETESKELTYMKEQFKIINDKMDTVDQQFDEVKKAINWNVVKVQYFNHETAIGLLQDMILSISDAPSNVRQMMMDRFRITYDQTYYNAADKLYESFTNPQRIFSENLVTASCQTFNFHRRKVEKFFLGNIQLILKGLEVESFYLTTK-NLTSNQDYWAEQWNKKINQISAIMEETINSIKGNWHSQLQKDAEEFNVKNYGKGNKEYLEEFYNFLTDKFSWREWFLVVYNPITGGDNHYVSVYGGIINLRSRGHNIAVASRDKEDNNFNSNLIS---QVLDNLPRSFNTKGKGLAESL----LMDQLIPAIQRVHKYSLAAVIEWGAGVWFISNNQFRAYKK 1253
            F  ++E +F KT   IS    P+  +I     V+    E ES E+  MK++F  +N+++D    +F  +K+ I+W+ V++ + + E  I  L  M+ ++ + P   R+     F  TY+  Y  A D L+ +  N ++I+S NL+ A+       R +V++F +G ++LI + +++E+ Y+  K N      +    W KK+  +   +E+     K  ++ Q QKD +     +Y + N+ ++   Y+F   K++WREWF++VY  ++G  +H V    G    R+ G NI V+S D+ + +     I+   Q++ N    +N++ +G   S        +++P           A + WG+ VWFI N +   Y+K
Sbjct:   59 FKFLEEKNFFKTLTQISSVAGPIFSAISAILTVVFMFIEIESPEMALMKKEFANLNNRIDKWGVEFQIIKRKIDWSAVQINFADIENNIITLHKMLSTLPEVPIANRETQAALFINTYEINYKAAGDILHRAMLNIEQIYSVNLLRAAQLYMENDRNQVQEFMVGMMKLITQAVQIEAAYVGLKYNNEEASKFTQSLWEKKLAVLKDKLEQIDTDTKNKYNEQYQKDLDNLLATHYSQSNERFVTIAYDFFATKYNWREWFVLVYKELSGFKDHAVVTCQGTHRFRTHGRNIIVSSVDQSEGDAAMAHINRNKQIIGN----YNSQWQGGEHSKHWVEYWGRVLPLCSDA---DTRASVAWGSNVWFI-NTRLVVYQK 428          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000052591.1 (SMESG000052591.1)

HSP 1 Score: 129.798 bits (325), Expect = 3.970e-33
Identity = 87/311 (27.97%), Postives = 150/311 (48.23%), Query Frame = 3
Query:  333 QQFDEVKKAINWNVVKVQYFNHETAIGLLQDMILSISDAPSNVRQMMMDRFRITYDQTYYNAADKLYESFTNPQRIFSENLVTASCQTFNFHRRKVEKFFLGNIQLILKGLEVESFYLTTK-NLTSNQDYWAEQWNKKINQISAIMEETINSIKGNWHSQLQKDAEEFNVKNYGKGNKEYLEEFYNFLTDKFSWREWFLVVYNPITGGDNHYVSVYGGIINLRSRGHNIAVASRDKEDNNFNSNLIS---QVLDNLPRSFNTKGKGLAESLLMDQLIPAIQRVHKYSLAAVIEWGAGVWFISNNQFRAYKK 1253
            + F+EV+ +I+W VV++ + + E  I  +Q +         N ++    +F  +Y+  Y    D LY    N  + FS NL  AS +   F R+KV+ F +   +L+++ + +E+ +   K     N  +    W ++   + A ME      K  + +Q Q D +E+ +      N+++ +  YN+L+ K++WR+WF+VVY PI+G  +H VS   G    R+ G NI V+S DKED     + I    Q++ +     + K         MD+L+P     +       + WG+ VWF +N     YKK
Sbjct:  100 EDFNEVRYSIDWAVVQINFEDLENRILTVQRLSTEFMSIDDNEKEFSAKQFLHSYEANYKATGDLLYSVMININQSFSGNLFRASQKFTQFDRKKVQTFMVELAKLLVQAVNIEANFANLKYENDENVKFLNSMWRERFKTLKATMEAVDLDTKEQFRNQYQMDLDEYLMTRESLTNEQFNQVLYNYLSTKYNWRDWFVVVYAPISGFKDHTVSTCQGTYRFRTNGRNIIVSSVDKEDGISAGSHIERNKQIIGSYSDWKSDKEYSRGWVSFMDKLLP---NCNDADTRLSVAWGSNVWF-TNTNLVVYKK 406          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000027656.1 (SMESG000027656.1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.522e-17
Identity = 75/320 (23.44%), Postives = 134/320 (41.88%), Query Frame = 3
Query:  168 FVKTTQAISKWGLPLLKSIGYFSKVIMAQFETESKELTYMKEQFKIINDKMDTVDQQFDEVKKAINWNVVKVQYFNHETAIGLLQDMILSISDAPSNVRQMMMDRFRITYDQTYYNAADKLYESFTNPQRIFSENLVTASCQTFNFHRRKVEKFFLGNIQLILKGLEVESFYLTTKNLTSNQDYWAEQWNKKINQISAIMEETINSIKGNWHSQLQKDAEEFNVKNYGKGNKEYLEEFYNFLTDKFSWREWFLVVYNPITGGDNHYVSVYGGIINL-RSRGHNIAVASRDKEDNNFNSNLISQVLDNLPRSFNTKGKGLA 1124
            F K +  +   G   +      S V M   + +S EL  +KE F+ +N+K+DT+  +   ++  I  +  +  Y    T+I    +   ++++A  +  +   D F   Y+ ++  A   +Y++ T     F  N+V         +  K+ +F    +QLI KGL VE  YL   N ++      E W  KIN++S      I + + NW     +  +E + +  G  N+ + E     L +    R W  + YN  +G   H  S Y  +  +   R H+ +V S  K     +  L     DN  +  N + + +A
Sbjct:   59 FAKLSGVLGSLGPAAMAISAILSIVTMFLPKEDSPELKAIKEGFEKVNNKLDTISSKIGSLENIIELSSARAAYVKTVTSI---NNNYETLNEAKKSNSKEGYDYFAKQYENSFEFATANMYDAMTGSTGPFGFNMVNLYKTHVRCNPVKLSQFCTMGLQLITKGLTVEGAYLGYMNFSAKAKGKTETWTTKINEVSKQCSAVIEACESNWKEFAYQQYKETHRELEGD-NQAFAERLAKDLENVAPQRSWLTIAYNDASGFGPHTYSTYYEVHTIWNERNHDTSVFSVPK-----SPKLTGSDYDNFVKLINGQKEAIA 369          
The following BLAST results are available for this feature:
BLAST of MFS domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rpz31.166e-1124.11rapunzel 3 [Source:ZFIN;Acc:ZDB-GENE-030131-4784][more]
rpz61.470e-1025.00rapunzel 6 [Source:ZFIN;Acc:ZDB-GENE-170530-5][more]
rpz41.343e-722.55rapunzel 4 [Source:ZFIN;Acc:ZDB-GENE-050417-472][more]
back to top
BLAST of MFS domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4B6X28.072e-4031.58Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A267E0I71.687e-3929.63Uncharacterized protein OS=Macrostomum lignano OX=... [more]
V4AXV04.726e-3931.76Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A1I8HMN95.078e-3829.85Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HCC05.684e-3829.85MFS domain-containing protein OS=Macrostomum ligna... [more]
back to top
BLAST of MFS domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rpz66.576e-924.48uncharacterized LOC103039477 [Source:NCBI gene;Acc... [more]
rpz41.113e-724.01uncharacterized LOC103039774 [Source:NCBI gene;Acc... [more]
rpz51.546e-619.35rapunzel 5 [Source:ZFIN;Acc:ZDB-GENE-030131-4678][more]
back to top
BLAST of MFS domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpz41.233e-622.59uncharacterized LOC101175680 [Source:NCBI gene;Acc... [more]
back to top
BLAST of MFS domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062792.10.000e+099.53SMESG000062792.1[more]
SMESG000004912.12.889e-10845.59SMESG000004912.1[more]
SMESG000052592.19.796e-4326.98SMESG000052592.1[more]
SMESG000052591.13.970e-3327.97SMESG000052591.1[more]
SMESG000027656.11.522e-1723.44SMESG000027656.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020480 ID=SMED30020480|Name=MFS domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1325bp
AATAAATTTATCAAATAACAATGAAATTTTGTTGTTATATTCTTTGCTTA
TGTCTGTCATCGCTGATTCCGATTTATGGACTCGATACTTCTCCTGGAAA
AATTCTAGAAGAGGCCTCAAAACTCGAAAAAGCGAAAGAAATTTTTAACA
GCATTAAAGAAAGCGATTTTGTCAAGACAACCCAAGCCATTTCCAAATGG
GGTTTGCCTCTTTTGAAATCTATCGGCTACTTTTCCAAAGTGATCATGGC
ACAATTTGAAACTGAATCAAAAGAACTGACATACATGAAAGAACAATTTA
AGATAATCAACGACAAGATGGATACTGTCGATCAACAGTTTGATGAAGTA
AAGAAAGCCATAAATTGGAATGTTGTAAAAGTACAATACTTTAATCATGA
AACGGCCATTGGACTTCTGCAAGACATGATTTTAAGTATTTCAGATGCCC
CTTCAAACGTCCGTCAAATGATGATGGACCGCTTTAGAATTACGTATGAT
CAAACCTATTATAACGCGGCAGATAAACTTTACGAATCATTCACGAACCC
ACAGCGAATATTTAGTGAAAATTTAGTTACCGCTTCGTGCCAAACTTTCA
ATTTTCACAGGCGTAAAGTTGAAAAGTTCTTTTTGGGAAACATTCAACTA
ATATTAAAAGGATTGGAGGTAGAATCCTTTTATTTGACCACCAAAAATCT
AACTTCAAATCAAGATTATTGGGCTGAGCAGTGGAATAAGAAGATTAATC
AAATCTCCGCAATCATGGAAGAAACAATTAATTCTATCAAAGGAAATTGG
CATTCGCAGTTACAAAAAGACGCAGAAGAATTTAATGTGAAAAATTATGG
AAAAGGAAACAAAGAATATTTGGAAGAATTTTATAATTTTTTAACTGACA
AATTTTCATGGCGAGAATGGTTTCTAGTCGTCTACAATCCAATAACAGGT
GGTGACAATCATTACGTTTCAGTGTACGGTGGTATCATAAATTTAAGATC
AAGGGGACACAATATTGCGGTTGCTAGTCGAGATAAAGAAGATAATAACT
TTAATTCCAACTTGATTAGCCAAGTCCTGGATAACCTTCCAAGATCTTTC
AATACTAAAGGAAAAGGTCTCGCAGAAAGTTTATTAATGGATCAGTTAAT
ACCAGCAATACAACGAGTTCACAAATATTCACTAGCCGCTGTCATTGAAT
GGGGTGCTGGGGTATGGTTTATATCAAACAACCAATTTCGAGCATATAAA
AAATATACAGGTCCAAGAGGAAGGACATACAATATAATTGTTATGGGTTG
ATTTTGAATATAGTCACTGATCATT
back to top

protein sequence of SMED30020480-orf-1

>SMED30020480-orf-1 ID=SMED30020480-orf-1|Name=SMED30020480-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=427bp
MKFCCYILCLCLSSLIPIYGLDTSPGKILEEASKLEKAKEIFNSIKESDF
VKTTQAISKWGLPLLKSIGYFSKVIMAQFETESKELTYMKEQFKIINDKM
DTVDQQFDEVKKAINWNVVKVQYFNHETAIGLLQDMILSISDAPSNVRQM
MMDRFRITYDQTYYNAADKLYESFTNPQRIFSENLVTASCQTFNFHRRKV
EKFFLGNIQLILKGLEVESFYLTTKNLTSNQDYWAEQWNKKINQISAIME
ETINSIKGNWHSQLQKDAEEFNVKNYGKGNKEYLEEFYNFLTDKFSWREW
FLVVYNPITGGDNHYVSVYGGIINLRSRGHNIAVASRDKEDNNFNSNLIS
QVLDNLPRSFNTKGKGLAESLLMDQLIPAIQRVHKYSLAAVIEWGAGVWF
ISNNQFRAYKKYTGPRGRTYNIIVMG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0022857transmembrane transporter activity
GO:0003676nucleic acid binding
GO:0004527exonuclease activity
Vocabulary: biological process
TermDefinition
GO:0006310DNA recombination
GO:0015074DNA integration
GO:0055085transmembrane transport
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000067goblet cell
PLANA:0000418head
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR039051SE-CTX-like
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR039051SE-cephalotoxin-likePANTHERPTHR40472FAMILY NOT NAMEDcoord: 50..355
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.795