LIM zinc-binding domain-containing protein

Overview
NameLIM zinc-binding domain-containing protein
Smed IDSMED30020469
Length (bp)2124
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of LIM zinc-binding domain-containing protein (SMED30020469) t-SNE clustered cells

Violin plots show distribution of expression levels for LIM zinc-binding domain-containing protein (SMED30020469) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of LIM zinc-binding domain-containing protein (SMED30020469) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for LIM zinc-binding domain-containing protein (SMED30020469) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Human
Match: LIMD2 (LIM domain containing 2 [Source:HGNC Symbol;Acc:HGNC:28142])

HSP 1 Score: 75.485 bits (184), Expect = 7.490e-16
Identity = 29/68 (42.65%), Postives = 42/68 (61.76%), Query Frame = 1
Query:  676 ENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
            +  C +C + VY  E+LV D L++H  CF C  C   LS+ ++A+  G  YCKPHF +LF+  G Y+E
Sbjct:   37 KETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAALHGEFYCKPHFQQLFKSKGNYDE 104          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Human
Match: LIMD2 (LIM domain containing 2 [Source:HGNC Symbol;Acc:HGNC:28142])

HSP 1 Score: 74.7146 bits (182), Expect = 2.399e-15
Identity = 29/68 (42.65%), Postives = 42/68 (61.76%), Query Frame = 1
Query:  676 ENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
            +  C +C + VY  E+LV D L++H  CF C  C   LS+ ++A+  G  YCKPHF +LF+  G Y+E
Sbjct:   37 KETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAALHGEFYCKPHFQQLFKSKGNYDE 104          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Human
Match: LIMD2 (LIM domain containing 2 [Source:HGNC Symbol;Acc:HGNC:28142])

HSP 1 Score: 74.7146 bits (182), Expect = 2.399e-15
Identity = 29/68 (42.65%), Postives = 42/68 (61.76%), Query Frame = 1
Query:  676 ENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
            +  C +C + VY  E+LV D L++H  CF C  C   LS+ ++A+  G  YCKPHF +LF+  G Y+E
Sbjct:   37 KETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAALHGEFYCKPHFQQLFKSKGNYDE 104          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Human
Match: LIMD2 (LIM domain containing 2 [Source:HGNC Symbol;Acc:HGNC:28142])

HSP 1 Score: 74.7146 bits (182), Expect = 2.399e-15
Identity = 29/68 (42.65%), Postives = 42/68 (61.76%), Query Frame = 1
Query:  676 ENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
            +  C +C + VY  E+LV D L++H  CF C  C   LS+ ++A+  G  YCKPHF +LF+  G Y+E
Sbjct:   37 KETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAALHGEFYCKPHFQQLFKSKGNYDE 104          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Human
Match: XIRP2 (xin actin binding repeat containing 2 [Source:HGNC Symbol;Acc:HGNC:14303])

HSP 1 Score: 76.6406 bits (187), Expect = 1.386e-13
Identity = 31/70 (44.29%), Postives = 44/70 (62.86%), Query Frame = 1
Query:  670 ADENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
            +D+  C  C + VY  E LV D   +H+ CF+C  C   LS+ N+AS  G++YCKPHF +LF+  G Y+E
Sbjct: 3296 SDKEICILCQKTVYPMECLVADKQNFHKSCFRCHHCNSKLSLGNYASLHGQIYCKPHFKQLFKSKGNYDE 3365          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Celegans
Match: F42H10.3 (LIM and SH3 domain protein F42H10.3 [Source:UniProtKB/Swiss-Prot;Acc:P34416])

HSP 1 Score: 55.8398 bits (133), Expect = 4.505e-8
Identity = 21/50 (42.00%), Postives = 30/50 (60.00%), Query Frame = 1
Query:  694 CGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHF 843
            CG+ VY  E+L   + ++H+QCFKC  C   L+M N+     R YC PH+
Sbjct:   10 CGKTVYPVEELKCLDKVWHKQCFKCTVCGMTLNMKNYKGYDKRPYCDPHY 59          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Celegans
Match: F42H10.3 (LIM and SH3 domain protein F42H10.3 [Source:UniProtKB/Swiss-Prot;Acc:P34416])

HSP 1 Score: 55.8398 bits (133), Expect = 5.132e-8
Identity = 21/50 (42.00%), Postives = 30/50 (60.00%), Query Frame = 1
Query:  694 CGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHF 843
            CG+ VY  E+L   + ++H+QCFKC  C   L+M N+     R YC PH+
Sbjct:   10 CGKTVYPVEELKCLDKVWHKQCFKCTVCGMTLNMKNYKGYDKRPYCDPHY 59          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Celegans
Match: tag-273 (pep chromosome:WBcel235:IV:14487086:14489778:-1 gene:WBGene00013289.1 transcript:Y57G11A.1c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-273)

HSP 1 Score: 48.9062 bits (115), Expect = 9.627e-7
Identity = 21/57 (36.84%), Postives = 32/57 (56.14%), Query Frame = 1
Query:  679 NNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMN--NFASNSGRLYCKPHF 843
            + C+ C + VY  E+     LLYH  CF+C+ C++ L +   +    SG LYC+ HF
Sbjct:   37 DKCSLCTKNVYRAEQFQCFGLLYHVNCFRCIDCKQALRVEKAHRCQQSGDLYCRVHF 93          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Celegans
Match: tag-273 (pep chromosome:WBcel235:IV:14487086:14505139:-1 gene:WBGene00013289.1 transcript:Y57G11A.1e.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-273)

HSP 1 Score: 52.373 bits (124), Expect = 1.041e-6
Identity = 21/57 (36.84%), Postives = 31/57 (54.39%), Query Frame = 1
Query:  679 NNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNF--ASNSGRLYCKPHF 843
            + C+ C + VY  E+     LLYH  CF+C+ C++ L +        SG LYC+ HF
Sbjct:  799 DKCSLCTKNVYRAEQFQCFGLLYHVNCFRCIDCKQALRVEKAHRCQQSGDLYCRVHF 855          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Celegans
Match: tag-273 (pep chromosome:WBcel235:IV:14487086:14505166:-1 gene:WBGene00013289.1 transcript:Y57G11A.1f.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-273)

HSP 1 Score: 52.373 bits (124), Expect = 1.074e-6
Identity = 21/57 (36.84%), Postives = 31/57 (54.39%), Query Frame = 1
Query:  679 NNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNF--ASNSGRLYCKPHF 843
            + C+ C + VY  E+     LLYH  CF+C+ C++ L +        SG LYC+ HF
Sbjct:  791 DKCSLCTKNVYRAEQFQCFGLLYHVNCFRCIDCKQALRVEKAHRCQQSGDLYCRVHF 847          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Fly
Match: Mical (gene:FBgn0053208 transcript:FBtr0347213)

HSP 1 Score: 55.8398 bits (133), Expect = 1.420e-7
Identity = 22/63 (34.92%), Postives = 30/63 (47.62%), Query Frame = 1
Query:  667 HADENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASN----SGRLYCKPHF 843
             A    C  C + VY+ EK  ++ L+ HR C KC  C   L +  +A +     GR YC  HF
Sbjct: 1068 QAASEKCRFCKQTVYLMEKTTVEGLVLHRNCLKCHHCHTNLRLGGYAFDRDDPQGRFYCTQHF 1130          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Fly
Match: Mical (gene:FBgn0053208 transcript:FBtr0347212)

HSP 1 Score: 55.8398 bits (133), Expect = 1.444e-7
Identity = 22/63 (34.92%), Postives = 30/63 (47.62%), Query Frame = 1
Query:  667 HADENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASN----SGRLYCKPHF 843
             A    C  C + VY+ EK  ++ L+ HR C KC  C   L +  +A +     GR YC  HF
Sbjct: 1068 QAASEKCRFCKQTVYLMEKTTVEGLVLHRNCLKCHHCHTNLRLGGYAFDRDDPQGRFYCTQHF 1130          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Fly
Match: Mical (gene:FBgn0053208 transcript:FBtr0082210)

HSP 1 Score: 55.8398 bits (133), Expect = 1.470e-7
Identity = 22/63 (34.92%), Postives = 30/63 (47.62%), Query Frame = 1
Query:  667 HADENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASN----SGRLYCKPHF 843
             A    C  C + VY+ EK  ++ L+ HR C KC  C   L +  +A +     GR YC  HF
Sbjct: 1068 QAASEKCRFCKQTVYLMEKTTVEGLVLHRNCLKCHHCHTNLRLGGYAFDRDDPQGRFYCTQHF 1130          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Fly
Match: Mical (gene:FBgn0053208 transcript:FBtr0082212)

HSP 1 Score: 55.8398 bits (133), Expect = 1.470e-7
Identity = 22/63 (34.92%), Postives = 30/63 (47.62%), Query Frame = 1
Query:  667 HADENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASN----SGRLYCKPHF 843
             A    C  C + VY+ EK  ++ L+ HR C KC  C   L +  +A +     GR YC  HF
Sbjct: 1068 QAASEKCRFCKQTVYLMEKTTVEGLVLHRNCLKCHHCHTNLRLGGYAFDRDDPQGRFYCTQHF 1130          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Fly
Match: Mical (gene:FBgn0053208 transcript:FBtr0082209)

HSP 1 Score: 55.8398 bits (133), Expect = 1.470e-7
Identity = 22/63 (34.92%), Postives = 30/63 (47.62%), Query Frame = 1
Query:  667 HADENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASN----SGRLYCKPHF 843
             A    C  C + VY+ EK  ++ L+ HR C KC  C   L +  +A +     GR YC  HF
Sbjct: 1068 QAASEKCRFCKQTVYLMEKTTVEGLVLHRNCLKCHHCHTNLRLGGYAFDRDDPQGRFYCTQHF 1130          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Zebrafish
Match: limd2 (LIM domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-120906-1])

HSP 1 Score: 73.1738 bits (178), Expect = 3.425e-15
Identity = 30/65 (46.15%), Postives = 42/65 (64.62%), Query Frame = 1
Query:  685 CTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
            C SC + VY  E+LV +NL++H  CF C  C   LS+ ++A+  G  YCKPHF +LF+  G Y+E
Sbjct:   27 CASCEKTVYPMERLVANNLIFHAACFCCKHCNTKLSLGSYAALQGEFYCKPHFQQLFKSKGNYDE 91          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Zebrafish
Match: xirp2a (xin actin binding repeat containing 2a [Source:ZFIN;Acc:ZDB-GENE-040108-7])

HSP 1 Score: 78.9518 bits (193), Expect = 1.021e-14
Identity = 34/85 (40.00%), Postives = 51/85 (60.00%), Query Frame = 1
Query:  685 CTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNEF-----HQQ--SNQDSNSIS 918
            C  C ++VY  E L+ D   +H+ CF+C  C   LS+  +AS  GR+YCKPH+ +LF+  G Y+E      H++  S +D N+IS
Sbjct:  266 CQVCRKRVYPMESLIADKQNFHKTCFRCAHCNSQLSLGTYASLHGRMYCKPHYKQLFKSKGNYDEGFGERPHKEHWSTKDQNNIS 350          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Zebrafish
Match: lima1a (LIM domain and actin binding 1a [Source:ZFIN;Acc:ZDB-GENE-001120-1])

HSP 1 Score: 73.559 bits (179), Expect = 4.424e-13
Identity = 29/65 (44.62%), Postives = 41/65 (63.08%), Query Frame = 1
Query:  685 CTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
            C +C + VY  EKLV +  +YH  CF+C  C   LS+ N+AS    +YCKPH+ +LF+  G Y+E
Sbjct:  246 CVTCLKTVYPLEKLVANQQIYHNTCFRCAYCNTKLSLVNYASLHNNVYCKPHYCQLFKAKGNYDE 310          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Zebrafish
Match: xirp2b (xin actin binding repeat containing 2b [Source:ZFIN;Acc:ZDB-GENE-030521-26])

HSP 1 Score: 67.3958 bits (163), Expect = 6.534e-12
Identity = 26/61 (42.62%), Postives = 37/61 (60.66%), Query Frame = 1
Query:  685 CTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSG 867
            C  C ++VY  E L+ D   +H+ CF C  C+  LS+ NF S  G LYC+PH+ +LF+  G
Sbjct:  137 CAVCKKRVYPMEGLIADKKKFHKSCFFCEHCKNKLSLGNFVSLHGHLYCQPHYKQLFKSKG 197          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Zebrafish
Match: micall1a (MICAL-like 1a [Source:ZFIN;Acc:ZDB-GENE-110119-1])

HSP 1 Score: 60.077 bits (144), Expect = 7.880e-9
Identity = 21/57 (36.84%), Postives = 36/57 (63.16%), Query Frame = 1
Query:  679 NNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNN--FASNSGRLYCKPHF 843
            + C++CG+ V++ +++++D  LYHR CF+C +C R L   +  F  + G L C  HF
Sbjct:  159 STCSACGKHVHLVQRILVDGKLYHRNCFRCRECSRTLLPGSYKFTEDPGALVCTHHF 215          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000049904.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:64558417:64561350:-1 gene:ENSXETG00000020789.1 transcript:ENSXETT00000049904.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.1738 bits (178), Expect = 1.131e-14
Identity = 30/68 (44.12%), Postives = 43/68 (63.24%), Query Frame = 1
Query:  676 ENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
            ++ C  C +KVY  E LV D  ++H  CF+C  C   LS+ N+AS  G++YCK HF +LF+  G Y+E
Sbjct:    7 QDTCIICQKKVYPMECLVADKQIFHNSCFRCSHCSNKLSLGNYASLHGQIYCKAHFKQLFKSKGNYDE 74          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Xenopus
Match: lima1 (LIM domain and actin binding 1 [Source:NCBI gene;Acc:779798])

HSP 1 Score: 77.411 bits (189), Expect = 4.469e-14
Identity = 31/65 (47.69%), Postives = 41/65 (63.08%), Query Frame = 1
Query:  685 CTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
            C SC + VY  E+L  +N +YH  CF+C  C   LS+  FAS  G +YCKPHF +LF+  G Y+E
Sbjct:  356 CFSCQKTVYPMERLFANNQVYHNGCFRCSHCSTKLSLGTFASLHGTVYCKPHFNQLFKSKGNYDE 420          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Xenopus
Match: limd2 (uncharacterized loc100145002 [Source:Xenbase;Acc:XB-GENE-5749128])

HSP 1 Score: 71.633 bits (174), Expect = 8.471e-14
Identity = 31/74 (41.89%), Postives = 46/74 (62.16%), Query Frame = 1
Query:  685 CTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE-FHQQSNQD 903
            C+SC + VY  E+LV D  ++H  CF C  C   LS+  +A+  G  YCKPHF +LF+  G Y+E F ++ ++D
Sbjct:   88 CSSCQKTVYPMERLVADKHIFHNSCFCCKHCSAKLSLGTYAALHGEFYCKPHFQQLFKSKGNYDEGFGRRPHKD 161          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Xenopus
Match: nudt13 (nudix hydrolase 13 [Source:Xenbase;Acc:XB-GENE-987788])

HSP 1 Score: 59.3066 bits (142), Expect = 2.456e-8
Identity = 24/63 (38.10%), Postives = 37/63 (58.73%), Query Frame = 1
Query:  685 CTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASN--SGRLYCKPHFLELFRQSG 867
            C  C  +VY+ E+L  +   +HR CFKC  C   L ++ +A +   G+ YCKPH+   +R+SG
Sbjct:  787 CYFCRRRVYVMERLSAEGKFFHRSCFKCDYCSTTLRLSCYAYDLEDGKFYCKPHY--CYRRSG 847          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Xenopus
Match: nudt13 (nudix hydrolase 13 [Source:Xenbase;Acc:XB-GENE-987788])

HSP 1 Score: 59.3066 bits (142), Expect = 2.496e-8
Identity = 24/63 (38.10%), Postives = 37/63 (58.73%), Query Frame = 1
Query:  685 CTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASN--SGRLYCKPHFLELFRQSG 867
            C  C  +VY+ E+L  +   +HR CFKC  C   L ++ +A +   G+ YCKPH+   +R+SG
Sbjct:  787 CYFCRRRVYVMERLSAEGKFFHRSCFKCDYCSTTLRLSCYAYDLEDGKFYCKPHY--CYRRSG 847          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Mouse
Match: Limd2 (LIM domain containing 2 [Source:MGI Symbol;Acc:MGI:1915053])

HSP 1 Score: 73.559 bits (179), Expect = 4.166e-15
Identity = 28/68 (41.18%), Postives = 42/68 (61.76%), Query Frame = 1
Query:  676 ENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
            +  C +C + VY  E+LV D L++H  CF C  C   LS+ ++A+  G  YC+PHF +LF+  G Y+E
Sbjct:   38 KETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAAMHGEFYCRPHFQQLFKSKGNYDE 105          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Mouse
Match: Limd2 (LIM domain containing 2 [Source:MGI Symbol;Acc:MGI:1915053])

HSP 1 Score: 73.559 bits (179), Expect = 4.166e-15
Identity = 28/68 (41.18%), Postives = 42/68 (61.76%), Query Frame = 1
Query:  676 ENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
            +  C +C + VY  E+LV D L++H  CF C  C   LS+ ++A+  G  YC+PHF +LF+  G Y+E
Sbjct:   38 KETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAAMHGEFYCRPHFQQLFKSKGNYDE 105          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Mouse
Match: Limd2 (LIM domain containing 2 [Source:MGI Symbol;Acc:MGI:1915053])

HSP 1 Score: 73.559 bits (179), Expect = 4.166e-15
Identity = 28/68 (41.18%), Postives = 42/68 (61.76%), Query Frame = 1
Query:  676 ENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
            +  C +C + VY  E+LV D L++H  CF C  C   LS+ ++A+  G  YC+PHF +LF+  G Y+E
Sbjct:   38 KETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAAMHGEFYCRPHFQQLFKSKGNYDE 105          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Mouse
Match: Xirp2 (xin actin-binding repeat containing 2 [Source:MGI Symbol;Acc:MGI:2685198])

HSP 1 Score: 78.1814 bits (191), Expect = 2.934e-14
Identity = 31/70 (44.29%), Postives = 44/70 (62.86%), Query Frame = 1
Query:  670 ADENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
            +D+  C  C + VY  E L+ D   +H+ CF+C  C   LS+ N+AS  GR+YCKPHF +LF+  G Y+E
Sbjct: 3252 SDKEICIICQKTVYPMECLIADKQNFHKSCFRCHHCSSKLSLGNYASLHGRIYCKPHFKQLFKSKGNYDE 3321          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Mouse
Match: Xirp2 (xin actin-binding repeat containing 2 [Source:MGI Symbol;Acc:MGI:2685198])

HSP 1 Score: 77.0258 bits (188), Expect = 5.619e-14
Identity = 33/78 (42.31%), Postives = 48/78 (61.54%), Query Frame = 1
Query:  673 DENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE-FHQQSNQD 903
            D+  C  C + VY  E L+ D   +H+ CF+C  C   LS+ N+AS  GR+YCKPHF +LF+  G Y+E F  + ++D
Sbjct:  399 DKEICIICQKTVYPMECLIADKQNFHKSCFRCHHCSSKLSLGNYASLHGRIYCKPHFKQLFKSKGNYDEGFGHKQHKD 476          
BLAST of LIM zinc-binding domain-containing protein vs. UniProt/SwissProt
Match: sp|Q1LZA7|LIMD2_BOVIN (LIM domain-containing protein 2 OS=Bos taurus OX=9913 GN=LIMD2 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 9.744e-15
Identity = 29/68 (42.65%), Postives = 42/68 (61.76%), Query Frame = 1
Query:  676 ENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
            +  C +C + VY  E+LV D L++H  CF C  C   LS+ ++A+  G  YCKPHF +LF+  G Y+E
Sbjct:   38 KETCAACQKTVYPMERLVADKLIFHSSCFCCKHCHTKLSLGSYAALHGEFYCKPHFQQLFKSKGNYDE 105          
BLAST of LIM zinc-binding domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9BT23|LIMD2_HUMAN (LIM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=LIMD2 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.152e-14
Identity = 29/68 (42.65%), Postives = 42/68 (61.76%), Query Frame = 1
Query:  676 ENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
            +  C +C + VY  E+LV D L++H  CF C  C   LS+ ++A+  G  YCKPHF +LF+  G Y+E
Sbjct:   37 KETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAALHGEFYCKPHFQQLFKSKGNYDE 104          
BLAST of LIM zinc-binding domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4KM31|LIMD2_RAT (LIM domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Limd2 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.997e-14
Identity = 29/68 (42.65%), Postives = 42/68 (61.76%), Query Frame = 1
Query:  676 ENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
            +  C +C + VY  E+LV D L++H  CF C  C   LS+ ++A+  G  YCKPHF +LF+  G Y+E
Sbjct:   38 KETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAAMHGEFYCKPHFQQLFKSKGNYDE 105          
BLAST of LIM zinc-binding domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BGB5|LIMD2_MOUSE (LIM domain-containing protein 2 OS=Mus musculus OX=10090 GN=Limd2 PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 2.914e-14
Identity = 28/68 (41.18%), Postives = 42/68 (61.76%), Query Frame = 1
Query:  676 ENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
            +  C +C + VY  E+LV D L++H  CF C  C   LS+ ++A+  G  YC+PHF +LF+  G Y+E
Sbjct:   38 KETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAAMHGEFYCRPHFQQLFKSKGNYDE 105          
BLAST of LIM zinc-binding domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9M047|WLI2B_ARATH (LIM domain-containing protein WLIM2b OS=Arabidopsis thaliana OX=3702 GN=WLIM2B PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 9.454e-14
Identity = 29/70 (41.43%), Postives = 45/70 (64.29%), Query Frame = 1
Query:  670 ADENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
              +  C +C + VY  E L  D + YH+ CFKC  C+  L +++++S  G LYCKPHF +LF++SG +N+
Sbjct:    5 GTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKPHFEQLFKESGSFNK 74          

HSP 2 Score: 64.3142 bits (155), Expect = 2.474e-10
Identity = 27/71 (38.03%), Postives = 42/71 (59.15%), Query Frame = 1
Query:  670 ADENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNEF 882
              +  C +C + VY  EK+ +++  YH+ CFKC      +S +N+A+  G LYCK HF +LF++ G YN  
Sbjct:  103 GTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYNHL 173          
BLAST of LIM zinc-binding domain-containing protein vs. TrEMBL
Match: R7VFT4 (LIM zinc-binding domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_114151 PE=4 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.975e-19
Identity = 34/65 (52.31%), Postives = 47/65 (72.31%), Query Frame = 1
Query:  685 CTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
            C +CG++VY  EK++ D  +YH+ CFKC  C+ +LSM NFAS  G ++CKPHF+ELF+  G Y E
Sbjct:    3 CKTCGKRVYEMEKIIADKAIYHKSCFKCCHCKSVLSMRNFASLDGEMFCKPHFIELFKSKGNYEE 67          
BLAST of LIM zinc-binding domain-containing protein vs. TrEMBL
Match: A0A267GIF7 (LIM zinc-binding domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025250g2 PE=4 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 1.842e-18
Identity = 96/374 (25.67%), Postives = 154/374 (41.18%), Query Frame = 1
Query:  685 CTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNEFHQQSNQDSNSISTNYDKINENGTAGTGNTQEDELPPPQITRNIVEKFRLLESNLSADSLLPRQLSSGQHNVKCYQSTNAVLDNNHHTFNDKADDVT--DEFPTPGITKNLLSLWSNFESKS--LYSSASGTPKKVNKNNSPKASVSFQ--------------------------SFDIVRHNDS-VEDRYPAPNTAKSLAAKFKGEA---------PMLNQFVVKRS---SSVNRNILIPNFVNQSAEVVSSSTLNDDWLQSRNSNP-NEGSENIP-IQRSDLISSESKRETDEFPEEGITKNLVGLF 1671
            C  C +KVY  E+L  D  +YH+ C++C KC R+LS+ NF     +LYC+PH+LE+FR  G Y     Q++ D  +              G  N  +D +   Q   N+  +F   ES+  +  ++    S G H      S N    +         D V    E P PG +K++L+++ N E+            P ++    +P     +Q                            D+VR  D    D  P  N  +S    +K +          P  ++ + +R+   S VN NI +P   +     VS S  +DD  +  +  P +E SEN P +  +D+    +    DE P++GIT+NL  +F
Sbjct:  239 CRLCQKKVYPMEQLTSDGHVYHKSCYRCHKCNRLLSVGNFGVLDNQLYCQPHYLEIFRMRGHY-----QASADRPAAE----------IVGRDNPVDDGISQVQKLSNLKSRF---ESSGDSSVVVTPPGSGGHHPTPG--SRNGAHSDPPADVVRSGDAVPAEGELPPPGASKSVLAMFRNLETGGQQPAKDQQQQPGRLKGAVAPTQRRPYQPQPNMDFDYTAPVRSAAESESSPVERPPDVVRSGDPNPADELPPANFTRSALQMWKNKEVEGGKVAPNPETSERLRQRARETSGVNNNIRLPGAASVG---VSGSRDSDDAERPSSPQPRDESSENEPSVPPADVARWGAGDGNDEMPKQGITQNLRSMF 589          
BLAST of LIM zinc-binding domain-containing protein vs. TrEMBL
Match: A0A267FBF0 (LIM zinc-binding domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000523g2 PE=4 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 3.302e-18
Identity = 96/376 (25.53%), Postives = 154/376 (40.96%), Query Frame = 1
Query:  685 CTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNEFHQQSNQDSNSISTNYDKINENGTAGTGNTQEDELPPPQITRNIVEKFRLLESNLSADSLLPRQLSSGQHNVKCYQSTNAVLDNNHHTFNDKADDVT--DEFPTPGITKNLLSLWSNFESKS--LYSSASGTPKKVNKNNSPKASVSFQ--------------------------SFDIVRHNDS-VEDRYPAPNTAKSLAAKFKGEA---------PMLNQFVVKRS---SSVNRNILIPNFVNQSAEVVSSSTLNDDWLQSRNSNP---NEGSENIP-IQRSDLISSESKRETDEFPEEGITKNLVGLF 1671
            C  C +KVY  E+L  D  +YH+ C++C KC R+LS+ NF     +LYC+PH+LE+FR  G Y     Q++ D  +              G  N  +D +   Q   N+  +F   ES+  +  ++    S G H      S N    +         D V    E P PG +K++L+++ N E+            P ++    +P     +Q                            D+VR  D    D  P  N  +S    +K +          P  ++ + +R+   S VN NI +P   +     VS S  +DD  +  +  P   +E SEN P +  +D+    +    DE P++GIT+NL  +F
Sbjct:  246 CRLCQKKVYPMEQLTSDGHVYHKSCYRCHKCNRLLSVGNFGVLDNQLYCQPHYLEIFRMRGHY-----QASADRPAAE----------IVGRDNPVDDGISQVQKLSNLKSRF---ESSGDSSVVVTPPSSGGHHPTPG--SRNGAHSDPPADVVRSGDAVPAEGELPPPGASKSVLAMFRNLETGGQQPAKDQQQQPGRLKGAVAPTQRRPYQPQPNMDFDYTAPVRSAAESESSPVERPPDVVRSGDPNPADELPPANFTRSALQMWKNKEVEGGKVAPNPETSERLRQRARETSGVNNNIRLPGAASVG---VSGSRDSDDAERPSSPQPQPRDESSENEPSVPPADVARWGAGDGNDEMPKQGITQNLRSMF 598          
BLAST of LIM zinc-binding domain-containing protein vs. TrEMBL
Match: A0A4E0RYL6 (LIM zinc-binding domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_001712 PE=4 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 3.313e-18
Identity = 70/249 (28.11%), Postives = 112/249 (44.98%), Query Frame = 1
Query:  679 NNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNEFHQQSNQDSNSISTNYDKINENGTA-GTGNTQEDEL--PPPQITRNIVEKFRLLESNLS---ADSLLPRQLSSGQHNVKCYQSTNA-VLDNNHHTFNDKADDVTDEFPTPGITKNLLSLWSNFESKSLYSSASGTPKKVNKNNSPKASVSFQSFDIVRHNDSVEDRYPAPNTAKSLAAKFKG 1404
            N C  C   VY  E + +   +YH+QCF+C KC+R+LS+ N++   G  YC+PH+ E+FR  G+Y            +   NY+++  + +A  +G + E +L  PPPQ+TR +V KF+ + S+     AD  L    S  Q+N     ST    L  +   F+     V+   P P   +    L    +          TP   N +  P          +VR + + E+  P P   +++ AKF  
Sbjct:  273 NRCFVCNSPVYTLEAICVIGRIYHKQCFRCQKCQRVLSVGNYSVGEGNPYCQPHYKEIFRVIGRYQ----------GASMNNYNEVRLHESAVQSGTSSETDLYRPPPQLTRTLVAKFQQMCSDSVYPIADGRLSSIGSERQYNGNARSSTTCPALIRSSQIFS----PVSPTLPVPTPFQQASQLMGVTQRNGSMELVVNTPTPANSDRPP----------LVR-SATDENDLPNPGITRNMVAKFSA 496          
BLAST of LIM zinc-binding domain-containing protein vs. TrEMBL
Match: G7YPY5 (LIM domain and actin-binding protein 1 OS=Clonorchis sinensis OX=79923 GN=CLF_106432 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 7.381e-18
Identity = 71/248 (28.63%), Postives = 113/248 (45.56%), Query Frame = 1
Query:  655 VTSGHADEN-NCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE--------------FHQQSNQDSNSISTNYDKINENGTAGTGNTQEDELPPPQITRNIVEKFRLLESNLSAD---------------SLLP---------RQLSSGQH----------NVKCYQST--------NAVLDNNHHTFNDKADDVTDEFPTPGITKNLLSLWSNF 1227
            + S  A+E   C++C + VY  E L + + ++H+ CF+C KC+RILS+  F   +G  YC+PH++ELFR  G++                 HQ + Q S    T  D+                 PPP++T+ +V KF+ + SN+S                 SL P         R LS G+H          N+K ++          N VL+++ +  N+      +EFP PGITK+L++ +S F
Sbjct:  160 IISSQANEKPRCSACQKVVYPLEGLHVMDRVFHKSCFRCRKCQRILSVRTFNVGNGHPYCEPHYVELFRARGRFGVTARDKAVEEDDDYLLHQTAIQSSTPAETAKDR-----------------PPPRVTQTLVAKFQQM-SNVSKSSHDVRGEPLTIPRPMSLTPENTTREVRARSLSLGKHTIPTPFLQASNLKVHKEVPLPEDTVKNQVLNSHPNMQNN------EEFPYPGITKDLIAKFSKF 383          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Cavefish
Match: limd2 (LIM domain containing 2 [Source:NCBI gene;Acc:103034267])

HSP 1 Score: 70.4774 bits (171), Expect = 2.210e-14
Identity = 28/65 (43.08%), Postives = 41/65 (63.08%), Query Frame = 1
Query:  685 CTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
            C +C + VY  E+LV +NL++H  CF C  C   LS+  +A+  G  YCKPH+ +LF+  G Y+E
Sbjct:   27 CAACQKTVYPMERLVANNLIFHTVCFCCKHCNAKLSLGTYAALQGEFYCKPHYQQLFKSKGNYDE 91          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Cavefish
Match: lima1a (LIM domain and actin binding 1a [Source:ZFIN;Acc:ZDB-GENE-001120-1])

HSP 1 Score: 74.7146 bits (182), Expect = 1.956e-13
Identity = 29/66 (43.94%), Postives = 41/66 (62.12%), Query Frame = 1
Query:  682 NCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
            +C  C + VY  E+LV +  +YH  CF+C  C   LS+ N+AS    +YCKPHF +LF+  G Y+E
Sbjct:  312 SCVMCLKTVYPLERLVANQQIYHNTCFRCAHCNTKLSLVNYASLHSTVYCKPHFCQLFKAKGNYDE 377          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000001570.2 (uncharacterized LOC103022480 [Source:NCBI gene;Acc:103022480])

HSP 1 Score: 69.707 bits (169), Expect = 8.979e-12
Identity = 26/65 (40.00%), Postives = 39/65 (60.00%), Query Frame = 1
Query:  685 CTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
            C +C   VY  E++V D  + H  CF C  CR  LS++N++S  G  YC  H+ +LF++ G Y+E
Sbjct:  322 CYACETPVYPMERIVADEHVLHTSCFCCKHCRTKLSLHNYSSLYGEFYCVSHYQQLFKRKGNYDE 386          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000032509.1 (uncharacterized LOC103022480 [Source:NCBI gene;Acc:103022480])

HSP 1 Score: 69.3218 bits (168), Expect = 1.089e-11
Identity = 26/65 (40.00%), Postives = 39/65 (60.00%), Query Frame = 1
Query:  685 CTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
            C +C   VY  E++V D  + H  CF C  CR  LS++N++S  G  YC  H+ +LF++ G Y+E
Sbjct:   91 CYACETPVYPMERIVADEHVLHTSCFCCKHCRTKLSLHNYSSLYGEFYCVSHYQQLFKRKGNYDE 155          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000002215.2 (pep primary_assembly:Astyanax_mexicanus-2.0:3:23527930:23529000:-1 gene:ENSAMXG00000002170.2 transcript:ENSAMXT00000002215.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 4.575e-11
Identity = 29/82 (35.37%), Postives = 44/82 (53.66%), Query Frame = 1
Query:  718 EKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE--FHQQSNQDSNSISTNYDKINENGTAG 957
            EK+  D  ++H+ CF C  C++ LS+ N+A   G  YC  H+ +LFR+ G Y+E   HQQ         + + +   NGT G
Sbjct:    2 EKMTADKFIFHKSCFCCKHCKQKLSLRNYAPLYGEFYCVFHYQQLFRKKGNYDEGFGHQQHK-------SRWLRSKSNGTDG 76          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Sea Lamprey
Match: mical3b (Danio rerio microtubule associated monooxygenase, calponin and LIM domain containing 3b (mical3b), mRNA. [Source:RefSeq mRNA;Acc:NM_001353875])

HSP 1 Score: 64.6994 bits (156), Expect = 4.936e-11
Identity = 51/186 (27.42%), Postives = 76/186 (40.86%), Query Frame = 1
Query:  451 EVITIGDFNDEDENQSSPENHNKTMADRWSSNDYNTVLRINNVNDRKVKSIS-------WDKEPHDTVNK---SARESVTSGHADENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASN--SGRLYCKPHFLELFRQSGKYNEFHQQSNQDSNSISTNYDKINENGTAGTGNTQ 972
            EV  +G      +  S  E       DRW   +        + N  KVKS++        +  P  +  K   S R+         + C  CG +VY+ E+L  +   +HR CFKC  C   L +  FA +   G+ YCKPH+   +R SG    F Q+  Q + +   +   +   GTAG    Q
Sbjct:  673 EVDGLGKRRRTGQKASDEEEMQARREDRWGIGNGERRADAVSGNQNKVKSMANQLLAKFEENAPLQSNLKRQGSLRKEFPQNLGGSDTCYFCGRRVYVMERLSAEGKFFHRGCFKCNYCDVTLRLGAFAFDVEDGKFYCKPHY--CYRLSG----FMQRKMQRTMAALAS---LPGAGTAGASPLQ 849          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Sea Lamprey
Match: csrp2 (cysteine and glycine-rich protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1863])

HSP 1 Score: 48.9062 bits (115), Expect = 8.571e-7
Identity = 28/85 (32.94%), Postives = 41/85 (48.24%), Query Frame = 1
Query:  613 KEPHDTVNKSARESVTSGHADENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSG 867
            ++   +VNK A+     G AD   C+ C + VY  EK+V     +H+ CF+C KC + L         G LYCK  + + F   G
Sbjct:   99 RQGGASVNKLAQR--FGGAADA--CSRCTKPVYAAEKIVGAGKPWHKSCFRCAKCGKGLESTTVTDRDGELYCKGCYAKYFGPKG 179          

HSP 2 Score: 46.595 bits (109), Expect = 5.357e-6
Identity = 17/54 (31.48%), Postives = 31/54 (57.41%), Query Frame = 1
Query:  682 NCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHF 843
            +C +CG+ V+  E++  D   YHR CF+C+ C + L  +    +   +YC+P +
Sbjct:    9 HCGTCGKVVFHAEEVQCDGRSYHRPCFQCLVCHKALETSTVTVHGDEIYCQPCY 62          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005882.1 (pep scaffold:Pmarinus_7.0:GL476535:329859:333216:1 gene:ENSPMAG00000005319.1 transcript:ENSPMAT00000005882.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.0542 bits (105), Expect = 1.827e-6
Identity = 21/52 (40.38%), Postives = 27/52 (51.92%), Query Frame = 1
Query:  685 CTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPH 840
            C  C   VY  EKL      +H+ CF C +C  +L++NNF S   R YC  H
Sbjct:    5 CARCQHPVYPLEKLDCLGQTWHKMCFYCEECETVLTVNNFKSFEKRPYCHAH 56          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Sea Lamprey
Match: csrp2 (cysteine and glycine-rich protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1863])

HSP 1 Score: 46.595 bits (109), Expect = 4.541e-6
Identity = 18/58 (31.03%), Postives = 30/58 (51.72%), Query Frame = 1
Query:  682 NCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELF 855
             C+ C + VY  E+++     +H+QCF+C KC + L         G +YCK  + + F
Sbjct:  122 KCSRCDKSVYAAERVIGGGKPWHKQCFRCAKCGKGLESTTVTDKDGEIYCKACYAKNF 179          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Sea Lamprey
Match: csrp2 (cysteine and glycine-rich protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1863])

HSP 1 Score: 45.8246 bits (107), Expect = 8.566e-6
Identity = 17/54 (31.48%), Postives = 29/54 (53.70%), Query Frame = 1
Query:  682 NCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHF 843
             C  C + VY  E+++ D   YHR CF+C  CR+ L     A++   ++C+  +
Sbjct:   10 RCGRCAKAVYQAEEVICDGQRYHRLCFRCSVCRKGLDSTTLATHGDEIFCRSCY 63          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Nematostella
Match: EDO50008 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF11])

HSP 1 Score: 71.633 bits (174), Expect = 3.030e-15
Identity = 29/68 (42.65%), Postives = 43/68 (63.24%), Query Frame = 1
Query:  676 ENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
            +  C  C + VY  E+L  D  +YH+ CFKC +C   L + N+A+  G++YCKPHF +LF+  G Y+E
Sbjct:   19 QEKCEVCNKTVYPMERLAADKKVYHKFCFKCNECNNTLRLGNYAALQGKVYCKPHFKQLFKVKGNYDE 86          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Nematostella
Match: EDO25454 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DWF5])

HSP 1 Score: 56.9954 bits (136), Expect = 1.027e-10
Identity = 21/51 (41.18%), Postives = 30/51 (58.82%), Query Frame = 1
Query:  679 NNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYC 831
            + C  CG  VY  EK   D+ + HRQC KC+ C+R L++ NF     ++YC
Sbjct:    1 DKCAVCGTTVYQMEKCKFDDCILHRQCMKCVVCKRHLTVGNFVMTESKIYC 51          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Nematostella
Match: EDO32617 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUJ8])

HSP 1 Score: 49.6766 bits (117), Expect = 7.713e-8
Identity = 22/62 (35.48%), Postives = 34/62 (54.84%), Query Frame = 1
Query:  685 CTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCK-PHFLELFRQSG 867
            C SC ++VY  EK+      +HR C +C KC++ L+  + A + G+ YC  P +  LF   G
Sbjct:    4 CPSCAKEVYFAEKVTSLGKDWHRACLRCEKCKKTLTCGSHAQHEGKPYCNIPCYSALFGPKG 65          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Nematostella
Match: EDO47999 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKJ7])

HSP 1 Score: 53.1434 bits (126), Expect = 4.214e-7
Identity = 21/56 (37.50%), Postives = 34/56 (60.71%), Query Frame = 1
Query:  610 DKEPHDTVNKSARESVTSGHADENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKC 777
            +++P DT+    +   + G A    C  CGE+VY+ E+LV +  L+HR CF+C +C
Sbjct:  377 EEKPEDTIAPMMQCMPSLGTA----CLICGERVYLMERLVAERRLFHRACFRCSRC 428          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Nematostella
Match: EDO35326 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLW0])

HSP 1 Score: 49.2914 bits (116), Expect = 5.918e-7
Identity = 21/50 (42.00%), Postives = 32/50 (64.00%), Query Frame = 1
Query:  685 CTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCK 834
            C  CG+ VY  E++ ++N  +H++CF C  CR+ L   N AS+ G +YCK
Sbjct:    4 CPRCGDNVYHAEEVSMENHKFHKKCFSCKDCRKKLDSTNAASHDGEVYCK 53          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Medaka
Match: limd2 (LIM domain containing 2 [Source:NCBI gene;Acc:101173786])

HSP 1 Score: 71.2478 bits (173), Expect = 1.388e-14
Identity = 30/65 (46.15%), Postives = 41/65 (63.08%), Query Frame = 1
Query:  685 CTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
            CTSC + VY  E+LV ++ ++H  CF C  C   LS+  FA+  G  YCKPHF +LF+  G Y+E
Sbjct:   28 CTSCEKTVYPMERLVANDQVFHLSCFCCKHCNAKLSLGTFAALQGEFYCKPHFQQLFKSKGNYDE 92          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Medaka
Match: limd2 (LIM domain containing 2 [Source:NCBI gene;Acc:101173786])

HSP 1 Score: 72.0182 bits (175), Expect = 3.698e-14
Identity = 30/65 (46.15%), Postives = 41/65 (63.08%), Query Frame = 1
Query:  685 CTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
            CTSC + VY  E+LV ++ ++H  CF C  C   LS+  FA+  G  YCKPHF +LF+  G Y+E
Sbjct:   94 CTSCEKTVYPMERLVANDQVFHLSCFCCKHCNAKLSLGTFAALQGEFYCKPHFQQLFKSKGNYDE 158          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Medaka
Match: limd2 (LIM domain containing 2 [Source:NCBI gene;Acc:101173786])

HSP 1 Score: 71.633 bits (174), Expect = 4.076e-14
Identity = 30/65 (46.15%), Postives = 41/65 (63.08%), Query Frame = 1
Query:  685 CTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
            CTSC + VY  E+LV ++ ++H  CF C  C   LS+  FA+  G  YCKPHF +LF+  G Y+E
Sbjct:   79 CTSCEKTVYPMERLVANDQVFHLSCFCCKHCNAKLSLGTFAALQGEFYCKPHFQQLFKSKGNYDE 143          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Medaka
Match: lima1a (LIM domain and actin-binding protein 1 [Source:NCBI gene;Acc:101156656])

HSP 1 Score: 75.8702 bits (185), Expect = 8.350e-14
Identity = 29/65 (44.62%), Postives = 41/65 (63.08%), Query Frame = 1
Query:  685 CTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
            C +C + VY  E+LV +  +YH  CF+C  C   LS+ N+AS    +YCKPHF +LF+  G Y+E
Sbjct:  294 CVTCQKTVYPLERLVANQHVYHSSCFRCSHCNTKLSLVNYASLHNVVYCKPHFCQLFKAKGNYDE 358          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Medaka
Match: lima1a (LIM domain and actin-binding protein 1 [Source:NCBI gene;Acc:101156656])

HSP 1 Score: 75.485 bits (184), Expect = 8.992e-14
Identity = 29/65 (44.62%), Postives = 41/65 (63.08%), Query Frame = 1
Query:  685 CTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNE 879
            C +C + VY  E+LV +  +YH  CF+C  C   LS+ N+AS    +YCKPHF +LF+  G Y+E
Sbjct:  271 CVTCQKTVYPLERLVANQHVYHSSCFRCSHCNTKLSLVNYASLHNVVYCKPHFCQLFKAKGNYDE 335          
BLAST of LIM zinc-binding domain-containing protein vs. Planmine SMEST
Match: SMESG000026096.1 (SMESG000026096.1)

HSP 1 Score: 1014.6 bits (2622), Expect = 0.000e+0
Identity = 490/496 (98.79%), Postives = 493/496 (99.40%), Query Frame = 1
Query:   73 MSLNNTLVYFNGYANDFTDLDAESPDHHLNMNELPNKEWPEKQGNFDTSPILDTQVWRGFNTDNYGITKLVSSEEDLVCSSPEQENKKSNPAQYHSENWEKEFPFNLNNHSIIHDMDPSADGFASNEVITIGDFNDEDENQSSPENHNKTMADRWSSNDYNTVLRINNVNDRKVKSISWDKEPHDTVNKSARESVTSGHADENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNEFHQQSNQDSNSISTNYDKINENGTAGTGNTQEDELPPPQITRNIVEKFRLLESNLSADSLLPRQLSSGQHNVKCYQSTNAVLDNNHHTFNDKADDVTDEFPTPGITKNLLSLWSNFESKSLYSSASGTPKKVNKNNSPKASVSFQSFDIVRHNDSVEDRYPAPNTAKSLAAKFKGEAPMLNQFVVKRSSSVNRNILIPNFVNQSAEVVSSSTLNDDWLQSRNSNPNE 1560
            MSLNNTLVYFNGYANDFTDLDAESPDHHLNMNELPNKEWPEKQGNFDTSPILDTQVWRGF+TDNYGITKLVSSEEDLVCSSPEQENKKSNPAQYHSENWEKEFPFNLNNHSIIHDMDPSADGFASNEVITIGDFNDEDENQSSPENHNKTMADRWSSNDYNTVLRINNVNDRKVKSISWD+EPHD VNKSARESV SGH DENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNEFHQQSNQDSNSISTNYDKINENGTAGTGNTQEDELPPPQITRNIVEKFRLLESNLSADSLLPRQLSSGQHNVKCYQSTNAVLDNNHHT+NDKADDVTDEFPTPGITKNLLSLWSNFESKSLYSSASGTPKKVNKNNSPKASVSFQSFDIVRHNDSVEDRYPAPNTAKSLAAKFKGEAPMLNQFVVKRSSSVNRNILIPNFVNQSAEVVSSSTLNDDWLQSRNSNPNE
Sbjct:    1 MSLNNTLVYFNGYANDFTDLDAESPDHHLNMNELPNKEWPEKQGNFDTSPILDTQVWRGFHTDNYGITKLVSSEEDLVCSSPEQENKKSNPAQYHSENWEKEFPFNLNNHSIIHDMDPSADGFASNEVITIGDFNDEDENQSSPENHNKTMADRWSSNDYNTVLRINNVNDRKVKSISWDREPHDAVNKSARESVISGHVDENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNEFHQQSNQDSNSISTNYDKINENGTAGTGNTQEDELPPPQITRNIVEKFRLLESNLSADSLLPRQLSSGQHNVKCYQSTNAVLDNNHHTYNDKADDVTDEFPTPGITKNLLSLWSNFESKSLYSSASGTPKKVNKNNSPKASVSFQSFDIVRHNDSVEDRYPAPNTAKSLAAKFKGEAPMLNQFVVKRSSSVNRNILIPNFVNQSAEVVSSSTLNDDWLQSRNSNPNE 496          

HSP 2 Score: 70.0922 bits (170), Expect = 1.433e-17
Identity = 31/31 (100.00%), Postives = 31/31 (100.00%), Query Frame = 2
Query: 1604 VKAREKLTNSPRRGSPRIWSACFDRWKLYIN 1696
            VKAREKLTNSPRRGSPRIWSACFDRWKLYIN
Sbjct:  497 VKAREKLTNSPRRGSPRIWSACFDRWKLYIN 527          

HSP 3 Score: 39.2762 bits (90), Expect = 1.433e-17
Identity = 17/20 (85.00%), Postives = 18/20 (90.00%), Query Frame = 3
Query: 1737 KLLFSDLWSNLHFPNSLRDE 1796
            KL  +DLWSNLHFPNSLRDE
Sbjct:  523 KLYINDLWSNLHFPNSLRDE 542          
BLAST of LIM zinc-binding domain-containing protein vs. Planmine SMEST
Match: SMESG000044487.1 (SMESG000044487.1)

HSP 1 Score: 105.916 bits (263), Expect = 3.797e-24
Identity = 77/253 (30.43%), Postives = 111/253 (43.87%), Query Frame = 1
Query:  682 NCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNEFHQQSNQDSNSISTNYDKINENGTAGTGNTQEDELPPPQITRNIVEKFRLLESNLSADSLLPRQLSSGQHNVKCYQSTNAVLDNNHHTFNDKAD-DVTDEFPTPGITKNLLSLWSNFE---SKSLYSSASGTPKKVN--KNNSPKASVSFQSFDIVRHNDSVEDRYPAPNTAKSLAAKFKGEAPMLN 1422
            NC  C +KVY  EKLV ++  +H+ CF+C KC+  LS  N++ N  R YC PH++ELF++ G+Y+E     N +    +TN   IN+  T        DELP P  T+ IV KF+  E+                               N  + N  A+ D  DE P P  TK L+  +S  +   S+         P+  N   N + +        D+VR ND  +D  P     K+L  +F G    LN
Sbjct:  202 NCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDEV--DDNVEKEIPATN--DINDVLT--------DELPAPDTTKKIVAKFQNFET------------------------------GNTSSINQNANVDSVDELPAPNTTKILMEKFSAIQQDNSEGKCKPQIDIPRHSNGHSNGTSENVPVVLPTDVVRANDPSQDNRPEQGITKNLVNRFHGMGGSLN 412          

HSP 2 Score: 51.2174 bits (121), Expect = 1.824e-6
Identity = 52/178 (29.21%), Postives = 73/178 (41.01%), Query Frame = 1
Query: 1147 NDKADDVTDEFPTPGITKNLLSLWSNFESKSLYSSASGTPKKVNKNNSPKASVSFQSFDIVRHNDSVEDRYPAPNTAKSLAAKFKGEAPMLNQFVVKRSSSVNRNILIPNFVNQSAEVVSSSTLNDDWLQSRNSNPNEGSENIPIQRSDLISSESKRETDEFPEEGITKNLVGLFRSM 1680
            ND  D +TDE P P  TK +++ + NFE+        G    +N+N    A+V           DSV D  PAPNT K L  KF           +++ +S  +    P                 D  +  N + N  SEN+P+     +   +    D  PE+GITKNLV  F  M
Sbjct:  280 NDINDVLTDELPAPDTTKKIVAKFQNFET--------GNTSSINQN----ANV-----------DSV-DELPAPNTTKILMEKFSA---------IQQDNSEGK--CKPQI---------------DIPRHSNGHSNGTSENVPVVLPTDVVRANDPSQDNRPEQGITKNLVNRFHGM 407          
BLAST of LIM zinc-binding domain-containing protein vs. Planmine SMEST
Match: SMESG000001219.1 (SMESG000001219.1)

HSP 1 Score: 102.064 bits (253), Expect = 1.755e-23
Identity = 70/233 (30.04%), Postives = 114/233 (48.93%), Query Frame = 1
Query:  664 GHADENN--CTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKY-------NEFHQQSNQ--------DSNSISTNYDKINENGTAG------------------------TGNTQEDELPPPQITRNIVEKFRLLESNLSADSLLPRQLSSGQHNVKCYQSTNA-VLDNNHHTFNDKADDV---TDEFPTPGITKNLLSLWSNF 1227
            G +D+N   C  C  K+Y  EKL +D  LYH+ CF+C KC+ +LS+ NF  ++  +YCK HF+ELF+  GKY       NE   Q+ +        D+ S+   + ++ E+G+                          + + Q++ELPPP+  + +V +F+ +ES  +  S  P ++   Q   K   +TNA +  +N  T  +   D    T+E P  G T+NLL+ + N 
Sbjct:   83 GSSDKNLDLCLICESKIYPMEKLTVDGRLYHKGCFRCSKCKTVLSVTNFNLSNNSIYCKIHFMELFKIRGKYDDVISIGNEIVSQNEEPTETIPSTDTKSLLEKFRQL-ESGSVSYQSSLSKNSNNTVRYVKPTDDVVRSQDIQQEELPPPETAKAMVARFQAMESKKNIPS--PERVQQMQSQAKVNSTTNANIRFHNSSTQPNPIRDSFNETEELPEEGTTRNLLNKFQNL 312          
BLAST of LIM zinc-binding domain-containing protein vs. Planmine SMEST
Match: SMESG000040062.1 (SMESG000040062.1)

HSP 1 Score: 73.559 bits (179), Expect = 9.952e-14
Identity = 33/91 (36.26%), Postives = 52/91 (57.14%), Query Frame = 1
Query:  622 HDTVNKSARESVTSGHADENN----CTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNEF 882
            H + +K  + S  S   D++N    C  C + VY  EK+ +D+ LYH+ CF+C  C+++LS          L+CKPH++E FR  GKY++ 
Sbjct:  135 HQSQSKKTKTSFQSKLKDQSNSDSKCDVCQKTVYPMEKVSMDSKLYHKNCFRCCVCQKMLSPTVVTKFKDNLFCKPHYIEKFRIRGKYDDI 225          
BLAST of LIM zinc-binding domain-containing protein vs. Planmine SMEST
Match: SMESG000072162.1 (SMESG000072162.1)

HSP 1 Score: 59.6918 bits (143), Expect = 3.833e-11
Identity = 25/57 (43.86%), Postives = 36/57 (63.16%), Query Frame = 1
Query:  685 CTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELF 855
            C  C + VY  E++   +L++HR CF+C +C   L +NN+A + G LYCK HF EL 
Sbjct:   10 CQRCQKSVYANERMEAGSLIWHRLCFRCAQCDMSLKLNNYAQDKGVLYCKKHFNELI 66          
The following BLAST results are available for this feature:
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LIMD27.490e-1642.65LIM domain containing 2 [Source:HGNC Symbol;Acc:HG... [more]
LIMD22.399e-1542.65LIM domain containing 2 [Source:HGNC Symbol;Acc:HG... [more]
LIMD22.399e-1542.65LIM domain containing 2 [Source:HGNC Symbol;Acc:HG... [more]
LIMD22.399e-1542.65LIM domain containing 2 [Source:HGNC Symbol;Acc:HG... [more]
XIRP21.386e-1344.29xin actin binding repeat containing 2 [Source:HGNC... [more]
back to top
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F42H10.34.505e-842.00LIM and SH3 domain protein F42H10.3 [Source:UniPr... [more]
F42H10.35.132e-842.00LIM and SH3 domain protein F42H10.3 [Source:UniPr... [more]
tag-2739.627e-736.84pep chromosome:WBcel235:IV:14487086:14489778:-1 ge... [more]
tag-2731.041e-636.84pep chromosome:WBcel235:IV:14487086:14505139:-1 ge... [more]
tag-2731.074e-636.84pep chromosome:WBcel235:IV:14487086:14505166:-1 ge... [more]
back to top
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mical1.420e-734.92gene:FBgn0053208 transcript:FBtr0347213[more]
Mical1.444e-734.92gene:FBgn0053208 transcript:FBtr0347212[more]
Mical1.470e-734.92gene:FBgn0053208 transcript:FBtr0082210[more]
Mical1.470e-734.92gene:FBgn0053208 transcript:FBtr0082212[more]
Mical1.470e-734.92gene:FBgn0053208 transcript:FBtr0082209[more]
back to top
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
limd23.425e-1546.15LIM domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
xirp2a1.021e-1440.00xin actin binding repeat containing 2a [Source:ZFI... [more]
lima1a4.424e-1344.62LIM domain and actin binding 1a [Source:ZFIN;Acc:Z... [more]
xirp2b6.534e-1242.62xin actin binding repeat containing 2b [Source:ZFI... [more]
micall1a7.880e-936.84MICAL-like 1a [Source:ZFIN;Acc:ZDB-GENE-110119-1][more]
back to top
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000049904.11.131e-1444.12pep primary_assembly:Xenopus_tropicalis_v9.1:9:645... [more]
lima14.469e-1447.69LIM domain and actin binding 1 [Source:NCBI gene;A... [more]
limd28.471e-1441.89uncharacterized loc100145002 [Source:Xenbase;Acc:X... [more]
nudt132.456e-838.10nudix hydrolase 13 [Source:Xenbase;Acc:XB-GENE-987... [more]
nudt132.496e-838.10nudix hydrolase 13 [Source:Xenbase;Acc:XB-GENE-987... [more]
back to top
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Limd24.166e-1541.18LIM domain containing 2 [Source:MGI Symbol;Acc:MGI... [more]
Limd24.166e-1541.18LIM domain containing 2 [Source:MGI Symbol;Acc:MGI... [more]
Limd24.166e-1541.18LIM domain containing 2 [Source:MGI Symbol;Acc:MGI... [more]
Xirp22.934e-1444.29xin actin-binding repeat containing 2 [Source:MGI ... [more]
Xirp25.619e-1442.31xin actin-binding repeat containing 2 [Source:MGI ... [more]
back to top
BLAST of LIM zinc-binding domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q1LZA7|LIMD2_BOVIN9.744e-1542.65LIM domain-containing protein 2 OS=Bos taurus OX=9... [more]
sp|Q9BT23|LIMD2_HUMAN1.152e-1442.65LIM domain-containing protein 2 OS=Homo sapiens OX... [more]
sp|Q4KM31|LIMD2_RAT1.997e-1442.65LIM domain-containing protein 2 OS=Rattus norvegic... [more]
sp|Q8BGB5|LIMD2_MOUSE2.914e-1441.18LIM domain-containing protein 2 OS=Mus musculus OX... [more]
sp|Q9M047|WLI2B_ARATH9.454e-1441.43LIM domain-containing protein WLIM2b OS=Arabidopsi... [more]
back to top
BLAST of LIM zinc-binding domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7VFT41.975e-1952.31LIM zinc-binding domain-containing protein OS=Capi... [more]
A0A267GIF71.842e-1825.67LIM zinc-binding domain-containing protein (Fragme... [more]
A0A267FBF03.302e-1825.53LIM zinc-binding domain-containing protein (Fragme... [more]
A0A4E0RYL63.313e-1828.11LIM zinc-binding domain-containing protein OS=Fasc... [more]
G7YPY57.381e-1828.63LIM domain and actin-binding protein 1 OS=Clonorch... [more]
back to top
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
limd22.210e-1443.08LIM domain containing 2 [Source:NCBI gene;Acc:1030... [more]
lima1a1.956e-1343.94LIM domain and actin binding 1a [Source:ZFIN;Acc:Z... [more]
ENSAMXT00000001570.28.979e-1240.00uncharacterized LOC103022480 [Source:NCBI gene;Acc... [more]
ENSAMXT00000032509.11.089e-1140.00uncharacterized LOC103022480 [Source:NCBI gene;Acc... [more]
ENSAMXT00000002215.24.575e-1135.37pep primary_assembly:Astyanax_mexicanus-2.0:3:2352... [more]
back to top
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mical3b4.936e-1127.42Danio rerio microtubule associated monooxygenase, ... [more]
csrp28.571e-732.94cysteine and glycine-rich protein 2 [Source:ZFIN;A... [more]
ENSPMAT00000005882.11.827e-640.38pep scaffold:Pmarinus_7.0:GL476535:329859:333216:1... [more]
csrp24.541e-631.03cysteine and glycine-rich protein 2 [Source:ZFIN;A... [more]
csrp28.566e-631.48cysteine and glycine-rich protein 2 [Source:ZFIN;A... [more]
back to top
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO500083.030e-1542.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO254541.027e-1041.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
EDO326177.713e-835.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479994.214e-737.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353265.918e-742.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
limd21.388e-1446.15LIM domain containing 2 [Source:NCBI gene;Acc:1011... [more]
limd23.698e-1446.15LIM domain containing 2 [Source:NCBI gene;Acc:1011... [more]
limd24.076e-1446.15LIM domain containing 2 [Source:NCBI gene;Acc:1011... [more]
lima1a8.350e-1444.62LIM domain and actin-binding protein 1 [Source:NCB... [more]
lima1a8.992e-1444.62LIM domain and actin-binding protein 1 [Source:NCB... [more]
back to top
BLAST of LIM zinc-binding domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026096.11.433e-1798.79SMESG000026096.1[more]
SMESG000044487.13.797e-2430.43SMESG000044487.1[more]
SMESG000001219.11.755e-2330.04SMESG000001219.1[more]
SMESG000040062.19.952e-1436.26SMESG000040062.1[more]
SMESG000072162.13.833e-1143.86SMESG000072162.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020469 ID=SMED30020469|Name=LIM zinc-binding domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2124bp
GTTTTGTTTTATTGTTCTATATCAATTATTTAAAAAGCTAAATATTATAC
AAATTATAAATTTTACTTAAAAATGTCGCTAAATAATACTTTAGTATATT
TTAACGGATATGCAAATGATTTTACCGATCTTGATGCTGAATCTCCAGAT
CATCATCTAAACATGAATGAATTACCCAATAAGGAATGGCCCGAAAAGCA
AGGTAACTTCGATACTAGTCCAATACTCGATACACAAGTTTGGCGAGGAT
TCAATACCGATAATTACGGTATAACCAAACTCGTTTCAAGTGAAGAGGAT
TTAGTTTGCAGCAGCCCGGAGCAAGAAAATAAGAAATCTAATCCAGCACA
ATACCATTCAGAAAATTGGGAAAAGGAATTTCCATTTAATCTCAATAACC
ACAGTATTATTCATGACATGGATCCTTCGGCTGATGGGTTTGCTTCCAAC
GAAGTGATTACAATTGGAGATTTCAATGATGAAGATGAAAATCAGTCAAG
TCCTGAAAATCACAATAAAACGATGGCCGATCGTTGGAGTTCAAATGATT
ATAACACCGTATTACGCATCAATAACGTCAATGACCGAAAAGTGAAATCG
ATAAGTTGGGACAAGGAACCCCACGACACAGTCAATAAATCGGCACGGGA
ATCTGTCACCAGTGGCCATGCCGATGAGAACAATTGTACGAGCTGTGGAG
AAAAGGTATACATCACCGAGAAATTGGTTATCGACAATTTGCTTTATCAT
CGTCAGTGTTTTAAATGTATGAAATGCCGACGAATTCTGAGTATGAATAA
TTTTGCATCTAATTCCGGTCGCCTTTATTGTAAACCGCATTTTTTGGAAT
TGTTTCGACAATCAGGAAAATACAATGAATTTCACCAGCAGTCCAACCAA
GATTCAAATTCAATTTCAACCAATTATGACAAAATCAATGAAAACGGAAC
CGCAGGCACCGGCAACACACAAGAAGATGAGTTGCCACCTCCACAAATTA
CGAGGAATATTGTAGAGAAATTCCGTTTATTAGAATCAAACTTATCAGCT
GACTCATTGTTACCAAGGCAGTTATCTAGTGGGCAGCATAATGTGAAATG
TTATCAGTCGACAAATGCCGTATTGGATAATAATCATCATACTTTTAATG
ATAAAGCTGATGATGTCACAGATGAGTTTCCTACTCCGGGAATTACTAAA
AATCTCTTGTCTCTTTGGAGTAATTTTGAAAGCAAATCTCTGTACTCATC
TGCTTCAGGCACCCCGAAGAAAGTAAATAAAAATAATTCTCCAAAAGCCT
CTGTTTCATTTCAATCGTTTGATATAGTGCGACACAATGATTCTGTTGAA
GACAGATATCCAGCTCCGAATACCGCTAAATCTCTTGCTGCTAAGTTCAA
AGGCGAGGCTCCAATGCTAAATCAATTTGTAGTCAAACGTAGCTCAAGTG
TTAACCGGAACATTCTTATTCCTAATTTTGTTAATCAAAGTGCTGAAGTG
GTATCTAGTTCCACACTAAATGACGATTGGTTACAGTCAAGAAATTCGAA
TCCCAACGAAGGTTCTGAGAATATTCCAATTCAAAGGTCGGATTTAATTT
CTAGTGAAAGCAAGAGAGAAACTGACGAATTCCCCGAGGAGGGGATCACC
AAGAATTTGGTCGGCTTGTTTCGATCGATGGAAGTTATACATCAATGGCA
AATCATTTTTAAAAATATAATTTTACGTGTTAATTAAAATTACTATTTTC
AGATTTATGGAGCAATTTGCATTTTCCAAACTCACTTCGAGATGAATAAT
AATTATTTGTTGATTTGTTTATTACAATTGATTGCGTCACAAAATTAATG
ATTTATGGATTTCGCGCAATAGTTAAATTGATTTTGCAATTTATTAATTT
AAATTTGTTTAAATATTAATCAAAATTTTCCATTTTCAGATTAATTTTTA
ATGAAGCGAAATTTAAAATATTTGTTTTCGAATCATTTCCAAGTGTGTAT
TGTGATGCTCTGGTGTAGTTGTGTACAGTGGATTCAATATTAACAGATAA
ATGTGCAACATATTTATGATATTTATATGCTCGTCTGGGTTGTCATTACA
AGATACATTTTATTATCAAGTCAG
back to top

protein sequence of SMED30020469-orf-1

>SMED30020469-orf-1 ID=SMED30020469-orf-1|Name=SMED30020469-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=555bp
MSLNNTLVYFNGYANDFTDLDAESPDHHLNMNELPNKEWPEKQGNFDTSP
ILDTQVWRGFNTDNYGITKLVSSEEDLVCSSPEQENKKSNPAQYHSENWE
KEFPFNLNNHSIIHDMDPSADGFASNEVITIGDFNDEDENQSSPENHNKT
MADRWSSNDYNTVLRINNVNDRKVKSISWDKEPHDTVNKSARESVTSGHA
DENNCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGR
LYCKPHFLELFRQSGKYNEFHQQSNQDSNSISTNYDKINENGTAGTGNTQ
EDELPPPQITRNIVEKFRLLESNLSADSLLPRQLSSGQHNVKCYQSTNAV
LDNNHHTFNDKADDVTDEFPTPGITKNLLSLWSNFESKSLYSSASGTPKK
VNKNNSPKASVSFQSFDIVRHNDSVEDRYPAPNTAKSLAAKFKGEAPMLN
QFVVKRSSSVNRNILIPNFVNQSAEVVSSSTLNDDWLQSRNSNPNEGSEN
IPIQRSDLISSESKRETDEFPEEGITKNLVGLFRSMEVIHQWQIIFKNII
LRVN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000017photoreceptor neuron
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003117parapharyngeal cell
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: molecular function
TermDefinition
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: INTERPRO
TermDefinition
IPR001781Znf_LIM
IPR019774Aromatic-AA_hydroxylase_C
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001781Zinc finger, LIM-typeSMARTSM00132lim_4coord: 204..256
e-value: 1.6E-10
score: 51.0
IPR001781Zinc finger, LIM-typePFAMPF00412LIMcoord: 205..260
e-value: 7.2E-12
score: 45.4
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 205..239
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 203..263
score: 13.246
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 199..308
e-value: 3.0E-18
score: 68.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 490..508
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 490..521
NoneNo IPR availablePANTHERPTHR24206FAMILY NOT NAMEDcoord: 106..343
NoneNo IPR availableCDDcd09358LIM_Mical_likecoord: 205..257
e-value: 5.79766E-26
score: 98.4949
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 231..270
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 201..230