Small conductance calcium-activated potassium channel protein

Overview
NameSmall conductance calcium-activated potassium channel protein
Smed IDSMED30020450
Length (bp)2008
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Small conductance calcium-activated potassium channel protein (SMED30020450) t-SNE clustered cells

Violin plots show distribution of expression levels for Small conductance calcium-activated potassium channel protein (SMED30020450) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Small conductance calcium-activated potassium channel protein (SMED30020450) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Small conductance calcium-activated potassium channel protein (SMED30020450) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020450

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30020450SMESG000036688.1 SmedASXL_015375SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30020450SMESG000036688.1 dd_Smed_v4_13309_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30020450SMESG000036688.1 dd_Smed_v6_13309_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Human
Match: KCNN2 (potassium calcium-activated channel subfamily N member 2 [Source:HGNC Symbol;Acc:HGNC:6291])

HSP 1 Score: 353.214 bits (905), Expect = 3.986e-113
Identity = 167/420 (39.76%), Postives = 285/420 (67.86%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLL 1614
            +N+G KL +R++ F KR+ ++D +L+F   GI++MV +TE +        Y  +S+ S+ +K  ++L+T+ILLG ++ YH   I++FM+DN  DDW +AM+   +  + +E+++C+IHPIP +Y       T  +       P          + ++++  + MFLR+Y++ RV++LHS+++ DAS++S+GALN+I+FN RF+ K+LM + P  VL +  + L+I A+W +RACE YH   ++  NF   MW+++ITFLS+GYG++VP +YCG+ + +LTGI GAGCTALVVAV+ARKLEL++AEK+VHNF+MD +L K++K+AA NV++E WL++KN +   +       +HQR+ L++I ++R +K E+++L D A  L+++  +Q+ + + +S LN +    +  + ++++KLE L+
Sbjct:  115 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGA-----YDKASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNY-----TFTWTARLAFSYAP------STTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLI 518          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Human
Match: KCNN2 (potassium calcium-activated channel subfamily N member 2 [Source:HGNC Symbol;Acc:HGNC:6291])

HSP 1 Score: 352.058 bits (902), Expect = 2.389e-112
Identity = 169/423 (39.95%), Postives = 286/423 (67.61%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSI---RKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLL 1614
            +N+G KL +R++ F KR+ ++D +L+F   GI++MV +TE +        Y  +S+ S+ +K  ++L+T+ILLG ++ YH   I++FM+DN  DDW +AM+   +  + +E+++C+IHPIP +Y       T  +       P          + ++++  + MFLR+Y++ RV++LHS+++ DAS++S+GALN+I+FN RF+ K+LM + P  VL +  + L+I A+W +RACE YH   ++  NF   MW+++ITFLS+GYG++VP +YCG+ + +LTGI GAGCTALVVAV+ARKLEL++AEK+VHNF+MD +L K++K+AA NV++E WL++KN +   +       +HQR+ L++I   RK+R +K E+++L D A  L+++  +Q+ + + +S LN +    +  + ++++KLE L+
Sbjct:  128 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGA-----YDKASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNY-----TFTWTARLAFSYAP------STTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQARKLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLI 534          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Human
Match: KCNN3 (potassium calcium-activated channel subfamily N member 3 [Source:HGNC Symbol;Acc:HGNC:6292])

HSP 1 Score: 353.984 bits (907), Expect = 1.677e-111
Identity = 169/426 (39.67%), Postives = 293/426 (68.78%), Query Frame = 1
Query:  349 VNKREIFENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNK---RSGTRNIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELL 1611
             NKR+  +N+G KL +R++ F KR+ ++D +L+F   GI++MV +TE +    +G+ Y   S+ S+ +K  ++L+T+ILLG ++ YH   +++F++DN  DDW +AM+   +L +++E+++C+IHPIP +Y +      +  S+   +            + ++++  + MFLR+Y++ RV++LHS+++ DAS++S+GALN+I+FN RF+ K+LM + P  VL +  + L+I A+W +R CE YH   ++  NF   MW+++ITFLS+GYG++VP +YCG+ + +LTGI GAGCTALVVAV+ARKLEL++AEK+VHNF+MD +L K++K+AA NV++E WL++K+    +        +HQR+ L++I ++R +K E+++L+D A  L+++   Q+ + + ++ LN +   L+  + S++SKLE L
Sbjct:  258 ANKRK-NQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELS----WGL-YSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIPGEY-KFFWTARLAFSYTPSRA----------EADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHL 666          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Human
Match: KCNN2 (potassium calcium-activated channel subfamily N member 2 [Source:HGNC Symbol;Acc:HGNC:6291])

HSP 1 Score: 353.214 bits (905), Expect = 1.066e-110
Identity = 167/420 (39.76%), Postives = 285/420 (67.86%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLL 1614
            +N+G KL +R++ F KR+ ++D +L+F   GI++MV +TE +        Y  +S+ S+ +K  ++L+T+ILLG ++ YH   I++FM+DN  DDW +AM+   +  + +E+++C+IHPIP +Y       T  +       P          + ++++  + MFLR+Y++ RV++LHS+++ DAS++S+GALN+I+FN RF+ K+LM + P  VL +  + L+I A+W +RACE YH   ++  NF   MW+++ITFLS+GYG++VP +YCG+ + +LTGI GAGCTALVVAV+ARKLEL++AEK+VHNF+MD +L K++K+AA NV++E WL++KN +   +       +HQR+ L++I ++R +K E+++L D A  L+++  +Q+ + + +S LN +    +  + ++++KLE L+
Sbjct:  327 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGA-----YDKASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNY-----TFTWTARLAFSYAP------STTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLI 730          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Human
Match: KCNN2 (potassium calcium-activated channel subfamily N member 2 [Source:HGNC Symbol;Acc:HGNC:6291])

HSP 1 Score: 352.829 bits (904), Expect = 9.024e-110
Identity = 167/420 (39.76%), Postives = 285/420 (67.86%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLL 1614
            +N+G KL +R++ F KR+ ++D +L+F   GI++MV +TE +        Y  +S+ S+ +K  ++L+T+ILLG ++ YH   I++FM+DN  DDW +AM+   +  + +E+++C+IHPIP +Y       T  +       P          + ++++  + MFLR+Y++ RV++LHS+++ DAS++S+GALN+I+FN RF+ K+LM + P  VL +  + L+I A+W +RACE YH   ++  NF   MW+++ITFLS+GYG++VP +YCG+ + +LTGI GAGCTALVVAV+ARKLEL++AEK+VHNF+MD +L K++K+AA NV++E WL++KN +   +       +HQR+ L++I ++R +K E+++L D A  L+++  +Q+ + + +S LN +    +  + ++++KLE L+
Sbjct:  393 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGA-----YDKASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNY-----TFTWTARLAFSYAP------STTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLI 796          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Celegans
Match: kcnl-2 (KCNN (Potassium K ChaNNel, calcium activated)-Like [Source:UniProtKB/TrEMBL;Acc:G5EDA9])

HSP 1 Score: 299.671 bits (766), Expect = 1.911e-92
Identity = 165/430 (38.37%), Postives = 269/430 (62.56%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYHLELRD----NFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESV-------SVLNVKIGALDNAMQSIDSKLELLLE 1617
            +N G +L  R+    KRR ++D +L FA +GII+M+ + E   +  Y I  G+S  +S ++K  +  TT  LL F+ ++H I I++FM  N+ DDW +A+S      + +EL+IC + P+P+++          + F+  +      TL+     +NV   ++MF R+Y +CRV++LHSRV+ DAS++S+  LNR++FN RFI K+LM + P  +L +    L+I A W LR CE  ++        N+ N +W+VAITFLSVGYG+IVP++ CGRS+A++TGI G   +++VVAV+ARKLEL+RAEK+VHNF+ D +L KQ+KH+A NV++E W +FK ++   +       +HQR+ L +I ++R ++ ++++LA+N V+L +V  + S   E V         L+++I A+++ +  I  +L  L E
Sbjct:  198 DNSGGRLIRREILHEKRRHVSDRALAFAIMGIILMIIENELRTA--YVIRPGSS--LSHLLKFFIIFTTTALLSFVGYFHVIEIQLFMNANAADDWMVALSFRRTCQIGLELLICMLCPLPIEFI---------APFMNDR--FHDKTLYA----VNVFLSIMMFFRLYWLCRVMLLHSRVFTDASSRSIAGLNRVNFNARFILKTLMTICPGTMLMIFTAFLWIIAGWILRLCEREYMTPDKYNDINYVNSIWLVAITFLSVGYGDIVPKTNCGRSMAIVTGILGTCASSMVVAVIARKLELTRAEKHVHNFMQDTQLTKQLKHSAANVLRETWFIFKFRKLVEKPDFGKIRKHQRKFLLAIYEMRRVRRDQRKLAENLVSLGDVAKTSSNTYELVHDVHSTQEGLSLRITAIEHQLSDISRELSSLAE 608          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Celegans
Match: kcnl-2 (KCNN (Potassium K ChaNNel, calcium activated)-Like [Source:UniProtKB/TrEMBL;Acc:G5EDA9])

HSP 1 Score: 300.056 bits (767), Expect = 2.728e-92
Identity = 165/430 (38.37%), Postives = 269/430 (62.56%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYHLELRD----NFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESV-------SVLNVKIGALDNAMQSIDSKLELLLE 1617
            +N G +L  R+    KRR ++D +L FA +GII+M+ + E   +  Y I  G+S  +S ++K  +  TT  LL F+ ++H I I++FM  N+ DDW +A+S      + +EL+IC + P+P+++          + F+  +      TL+     +NV   ++MF R+Y +CRV++LHSRV+ DAS++S+  LNR++FN RFI K+LM + P  +L +    L+I A W LR CE  ++        N+ N +W+VAITFLSVGYG+IVP++ CGRS+A++TGI G   +++VVAV+ARKLEL+RAEK+VHNF+ D +L KQ+KH+A NV++E W +FK ++   +       +HQR+ L +I ++R ++ ++++LA+N V+L +V  + S   E V         L+++I A+++ +  I  +L  L E
Sbjct:  225 DNSGGRLIRREILHEKRRHVSDRALAFAIMGIILMIIENELRTA--YVIRPGSS--LSHLLKFFIIFTTTALLSFVGYFHVIEIQLFMNANAADDWMVALSFRRTCQIGLELLICMLCPLPIEFI---------APFMNDR--FHDKTLYA----VNVFLSIMMFFRLYWLCRVMLLHSRVFTDASSRSIAGLNRVNFNARFILKTLMTICPGTMLMIFTAFLWIIAGWILRLCEREYMTPDKYNDINYVNSIWLVAITFLSVGYGDIVPKTNCGRSMAIVTGILGTCASSMVVAVIARKLELTRAEKHVHNFMQDTQLTKQLKHSAANVLRETWFIFKFRKLVEKPDFGKIRKHQRKFLLAIYEMRRVRRDQRKLAENLVSLGDVAKTSSNTYELVHDVHSTQEGLSLRITAIEHQLSDISRELSSLAE 635          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Celegans
Match: kcnl-2 (KCNN (Potassium K ChaNNel, calcium activated)-Like [Source:UniProtKB/TrEMBL;Acc:G5EDA9])

HSP 1 Score: 299.671 bits (766), Expect = 2.804e-92
Identity = 165/430 (38.37%), Postives = 269/430 (62.56%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYHLELRD----NFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESV-------SVLNVKIGALDNAMQSIDSKLELLLE 1617
            +N G +L  R+    KRR ++D +L FA +GII+M+ + E   +  Y I  G+S  +S ++K  +  TT  LL F+ ++H I I++FM  N+ DDW +A+S      + +EL+IC + P+P+++          + F+  +      TL+     +NV   ++MF R+Y +CRV++LHSRV+ DAS++S+  LNR++FN RFI K+LM + P  +L +    L+I A W LR CE  ++        N+ N +W+VAITFLSVGYG+IVP++ CGRS+A++TGI G   +++VVAV+ARKLEL+RAEK+VHNF+ D +L KQ+KH+A NV++E W +FK ++   +       +HQR+ L +I ++R ++ ++++LA+N V+L +V  + S   E V         L+++I A+++ +  I  +L  L E
Sbjct:  205 DNSGGRLIRREILHEKRRHVSDRALAFAIMGIILMIIENELRTA--YVIRPGSS--LSHLLKFFIIFTTTALLSFVGYFHVIEIQLFMNANAADDWMVALSFRRTCQIGLELLICMLCPLPIEFI---------APFMNDR--FHDKTLYA----VNVFLSIMMFFRLYWLCRVMLLHSRVFTDASSRSIAGLNRVNFNARFILKTLMTICPGTMLMIFTAFLWIIAGWILRLCEREYMTPDKYNDINYVNSIWLVAITFLSVGYGDIVPKTNCGRSMAIVTGILGTCASSMVVAVIARKLELTRAEKHVHNFMQDTQLTKQLKHSAANVLRETWFIFKFRKLVEKPDFGKIRKHQRKFLLAIYEMRRVRRDQRKLAENLVSLGDVAKTSSNTYELVHDVHSTQEGLSLRITAIEHQLSDISRELSSLAE 615          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Celegans
Match: kcnl-2 (KCNN (Potassium K ChaNNel, calcium activated)-Like [Source:UniProtKB/TrEMBL;Acc:G5EDA9])

HSP 1 Score: 300.056 bits (767), Expect = 3.844e-92
Identity = 165/430 (38.37%), Postives = 269/430 (62.56%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYHLELRD----NFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESV-------SVLNVKIGALDNAMQSIDSKLELLLE 1617
            +N G +L  R+    KRR ++D +L FA +GII+M+ + E   +  Y I  G+S  +S ++K  +  TT  LL F+ ++H I I++FM  N+ DDW +A+S      + +EL+IC + P+P+++          + F+  +      TL+     +NV   ++MF R+Y +CRV++LHSRV+ DAS++S+  LNR++FN RFI K+LM + P  +L +    L+I A W LR CE  ++        N+ N +W+VAITFLSVGYG+IVP++ CGRS+A++TGI G   +++VVAV+ARKLEL+RAEK+VHNF+ D +L KQ+KH+A NV++E W +FK ++   +       +HQR+ L +I ++R ++ ++++LA+N V+L +V  + S   E V         L+++I A+++ +  I  +L  L E
Sbjct:  225 DNSGGRLIRREILHEKRRHVSDRALAFAIMGIILMIIENELRTA--YVIRPGSS--LSHLLKFFIIFTTTALLSFVGYFHVIEIQLFMNANAADDWMVALSFRRTCQIGLELLICMLCPLPIEFI---------APFMNDR--FHDKTLYA----VNVFLSIMMFFRLYWLCRVMLLHSRVFTDASSRSIAGLNRVNFNARFILKTLMTICPGTMLMIFTAFLWIIAGWILRLCEREYMTPDKYNDINYVNSIWLVAITFLSVGYGDIVPKTNCGRSMAIVTGILGTCASSMVVAVIARKLELTRAEKHVHNFMQDTQLTKQLKHSAANVLRETWFIFKFRKLVEKPDFGKIRKHQRKFLLAIYEMRRVRRDQRKLAENLVSLGDVAKTSSNTYELVHDVHSTQEGLSLRITAIEHQLSDISRELSSLAE 635          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Celegans
Match: kcnl-2 (KCNN (Potassium K ChaNNel, calcium activated)-Like [Source:UniProtKB/TrEMBL;Acc:G5EDA9])

HSP 1 Score: 299.671 bits (766), Expect = 3.862e-92
Identity = 165/430 (38.37%), Postives = 269/430 (62.56%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYHLELRD----NFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESV-------SVLNVKIGALDNAMQSIDSKLELLLE 1617
            +N G +L  R+    KRR ++D +L FA +GII+M+ + E   +  Y I  G+S  +S ++K  +  TT  LL F+ ++H I I++FM  N+ DDW +A+S      + +EL+IC + P+P+++          + F+  +      TL+     +NV   ++MF R+Y +CRV++LHSRV+ DAS++S+  LNR++FN RFI K+LM + P  +L +    L+I A W LR CE  ++        N+ N +W+VAITFLSVGYG+IVP++ CGRS+A++TGI G   +++VVAV+ARKLEL+RAEK+VHNF+ D +L KQ+KH+A NV++E W +FK ++   +       +HQR+ L +I ++R ++ ++++LA+N V+L +V  + S   E V         L+++I A+++ +  I  +L  L E
Sbjct:  205 DNSGGRLIRREILHEKRRHVSDRALAFAIMGIILMIIENELRTA--YVIRPGSS--LSHLLKFFIIFTTTALLSFVGYFHVIEIQLFMNANAADDWMVALSFRRTCQIGLELLICMLCPLPIEFI---------APFMNDR--FHDKTLYA----VNVFLSIMMFFRLYWLCRVMLLHSRVFTDASSRSIAGLNRVNFNARFILKTLMTICPGTMLMIFTAFLWIIAGWILRLCEREYMTPDKYNDINYVNSIWLVAITFLSVGYGDIVPKTNCGRSMAIVTGILGTCASSMVVAVIARKLELTRAEKHVHNFMQDTQLTKQLKHSAANVLRETWFIFKFRKLVEKPDFGKIRKHQRKFLLAIYEMRRVRRDQRKLAENLVSLGDVAKTSSNTYELVHDVHSTQEGLSLRITAIEHQLSDISRELSSLAE 615          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Fly
Match: SK (gene:FBgn0029761 transcript:FBtr0300467)

HSP 1 Score: 362.844 bits (930), Expect = 8.655e-118
Identity = 190/455 (41.76%), Postives = 290/455 (63.74%), Query Frame = 1
Query:  286 YQTYTNEVCNNEKPENPKPFHVNKREIFENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYH--KICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDY-FQ-----VNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYHLELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLLE 1617
            Y+ Y  E        + KP   N  +   NVG +L  RK+ F KR+ I+D +LV    GII+MV + E + +G Y      +S  S  +K  ++++TVILLG +V YH  ++ + +FM+DN  DDW +AM+   +  + +EL IC+IHPIP +Y FQ      N   TI +  V                P +V   L MFLR+Y++CRV++LHS+++ DAS++S+GALNRI+FN RF+ K+LM + P  VL + ++ L+I ASW LR CE +H E   N  N MW++AITFLSVG+G+IVP +YCGR IAV TGI GAGCTAL+VAV++RKLEL+RAEK+VHNF+MD +L K++K+AA NV++E WL++K+ R   R        HQR+ L +I  +R +K ++++L DNA  + ++  +Q+ + E +S ++ +  A++  + +++ K++ + E
Sbjct:   34 YEMYMEERALTGGNTSRKP-STNSAKHKPNVGYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENELSSAGVYT----KASFYSTALKTLISVSTVILLGLIVAYHALEVQVRLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEYYFQWTTKLANKNKTIGTEMV----------------PYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDEEHANLLNAMWLIAITFLSVGFGDIVPNTYCGRGIAVSTGIMGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIISDMSSRQDAIEERLTNLEDKMQSIQE 467          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Fly
Match: SK (gene:FBgn0029761 transcript:FBtr0301949)

HSP 1 Score: 359.377 bits (921), Expect = 1.552e-116
Identity = 186/453 (41.06%), Postives = 286/453 (63.13%), Query Frame = 1
Query:  286 YQTYTNEVCNNEKPENPKPFHVNKREIFENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDY-FQ-----VNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYHLELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLLE 1617
            Y+ Y  E        + KP   N  +   NVG +L  RK+ F KR+ I+D +LV    GII+MV + E + +G Y      +S  S  +K  ++++TVILLG +V YH + +++FM+DN  DDW +AM+   +  + +EL IC+IHPIP +Y FQ      N   TI +  V                P +V   L MFLR+Y++CRV++LHS+++ DAS++S+GALNRI+FN RF+ K+LM + P  VL + ++ L+I ASW LR CE +H E   N  N MW+ AITFL VGYG+IVP +YCGR I +  G+ GAGCTAL+VAV++RKLEL+RAEK+VHNF+MD +L K++K+AA NV++E WL++K+ R   R        HQR+ L +I  +R +K ++++L DNA  + ++  +Q+ + E +S ++ +  A++  + +++ K++ + E
Sbjct:   34 YEMYMEERALTGGNTSRKP-STNSAKHKPNVGYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENELSSAGVYT----KASFYSTALKTLISVSTVILLGLIVAYHALEVQLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEYYFQWTTKLANKNKTIGTEMV----------------PYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDEEHANLLNSMWLTAITFLCVGYGDIVPNTYCGRGITLTCGMVGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIISDMSSRQDAIEERLTNLEDKMQSIQE 465          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Fly
Match: SK (gene:FBgn0029761 transcript:FBtr0344555)

HSP 1 Score: 364.385 bits (934), Expect = 5.488e-116
Identity = 184/426 (43.19%), Postives = 281/426 (65.96%), Query Frame = 1
Query:  373 NVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYH--KICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDY-FQ-----VNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYHLELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLLE 1617
            NVG +L  RK+ F KR+ I+D +LV    GII+MV + E + +G Y      +S  S  +K  ++++TVILLG +V YH  ++ + +FM+DN  DDW +AM+   +  + +EL IC+IHPIP +Y FQ      N   TI +  V                P +V   L MFLR+Y++CRV++LHS+++ DAS++S+GALNRI+FN RF+ K+LM + P  VL + ++ L+I ASW LR CE +H E   N  N MW++AITFLSVG+G+IVP +YCGR IAV TGI GAGCTAL+VAV++RKLEL+RAEK+VHNF+MD +L K++K+AA NV++E WL++K+ R   R        HQR+ L +I  +R +K ++++L DNA  + ++  +Q+ + E +S ++ +  A++  + +++ K++ + E
Sbjct:   62 NVGYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENELSSAGVYT----KASFYSTALKTLISVSTVILLGLIVAYHALEVQVRLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEYYFQWTTKLANKNKTIGTEMV----------------PYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDEEHANLLNAMWLIAITFLSVGFGDIVPNTYCGRGIAVSTGIMGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIISDMSSRQDAIEERLTNLEDKMQSIQE 467          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Fly
Match: SK (gene:FBgn0029761 transcript:FBtr0301952)

HSP 1 Score: 359.377 bits (921), Expect = 8.115e-116
Identity = 186/453 (41.06%), Postives = 286/453 (63.13%), Query Frame = 1
Query:  286 YQTYTNEVCNNEKPENPKPFHVNKREIFENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDY-FQ-----VNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYHLELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLLE 1617
            Y+ Y  E        + KP   N  +   NVG +L  RK+ F KR+ I+D +LV    GII+MV + E + +G Y      +S  S  +K  ++++TVILLG +V YH + +++FM+DN  DDW +AM+   +  + +EL IC+IHPIP +Y FQ      N   TI +  V                P +V   L MFLR+Y++CRV++LHS+++ DAS++S+GALNRI+FN RF+ K+LM + P  VL + ++ L+I ASW LR CE +H E   N  N MW+ AITFL VGYG+IVP +YCGR I +  G+ GAGCTAL+VAV++RKLEL+RAEK+VHNF+MD +L K++K+AA NV++E WL++K+ R   R        HQR+ L +I  +R +K ++++L DNA  + ++  +Q+ + E +S ++ +  A++  + +++ K++ + E
Sbjct:   34 YEMYMEERALTGGNTSRKP-STNSAKHKPNVGYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENELSSAGVYT----KASFYSTALKTLISVSTVILLGLIVAYHALEVQLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEYYFQWTTKLANKNKTIGTEMV----------------PYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDEEHANLLNSMWLTAITFLCVGYGDIVPNTYCGRGITLTCGMVGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIISDMSSRQDAIEERLTNLEDKMQSIQE 465          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Fly
Match: SK (gene:FBgn0029761 transcript:FBtr0301953)

HSP 1 Score: 369.007 bits (946), Expect = 1.450e-115
Identity = 190/453 (41.94%), Postives = 290/453 (64.02%), Query Frame = 1
Query:  286 YQTYTNEVCNNEKPENPKPFHVNKREIFENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDY-FQ-----VNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYHLELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLLE 1617
            Y+ Y  E        + KP   N  +   NVG +L  RK+ F KR+ I+D +LV    GII+MV + E + +G Y      +S  S  +K  ++++TVILLG +V YH + +++FM+DN  DDW +AM+   +  + +EL IC+IHPIP +Y FQ      N   TI +  V                P +V   L MFLR+Y++CRV++LHS+++ DAS++S+GALNRI+FN RF+ K+LM + P  VL + ++ L+I ASW LR CE +H E   N  N MW++AITFLSVG+G+IVP +YCGR IAV TGI GAGCTAL+VAV++RKLEL+RAEK+VHNF+MD +L K++K+AA NV++E WL++K+ R   R        HQR+ L +I  +R +K ++++L DNA  + ++  +Q+ + E +S ++ +  A++  + +++ K++ + E
Sbjct:  439 YEMYMEERALTGGNTSRKP-STNSAKHKPNVGYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENELSSAGVYT----KASFYSTALKTLISVSTVILLGLIVAYHALEVQLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEYYFQWTTKLANKNKTIGTEMV----------------PYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDEEHANLLNAMWLIAITFLSVGFGDIVPNTYCGRGIAVSTGIMGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIISDMSSRQDAIEERLTNLEDKMQSIQE 870          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Zebrafish
Match: kcnn3 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 3 [Source:ZFIN;Acc:ZDB-GENE-100921-56])

HSP 1 Score: 358.992 bits (920), Expect = 3.071e-113
Identity = 171/419 (40.81%), Postives = 291/419 (69.45%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELL 1611
            +N+G KL +R++ F KR+ ++D +L+F   GI++MV +TE +    +G+ Y  SS+ S+ +K  ++L+T+ILLG ++ YH   +++F++DN  DDW +AM++  VL +A+ELI+ ++HP+P D F+      +  S+   +            + +++V  + MFLR+Y++ RV++LHS+++ DAS++S+GALN++HFN RF+ K+LM + P  VL +  + L+I A+W +R CE YH   ++  NF   MW+++ITFLS+GYG++VP +YCG+ + +LTGI GAGCTALVVAV+ARKLEL++AEK+VHNF+MD +L K++K+AA NV++E WL++K+ +   +   +   +HQR+ L++I ++R +K E+++L+D A  L+++   QS + E +S LN +   L+  M S++ ++E L
Sbjct:  291 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELS----WGV-YSKSSMYSLALKCLISLSTIILLGLIIAYHAREVQLFVIDNGADDWRIAMTMERVLLIALELIVSAVHPVPGD-FKFMWRARLAFSYAPSQA----------EADLDMVLSVPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKVHFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDAQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLMKKIDHSRVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQSVMYELMSELNDRSEDLERQMLSLEQRVERL 693          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Zebrafish
Match: kcnn3 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 3 [Source:ZFIN;Acc:ZDB-GENE-100921-56])

HSP 1 Score: 358.992 bits (920), Expect = 3.071e-113
Identity = 171/419 (40.81%), Postives = 291/419 (69.45%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELL 1611
            +N+G KL +R++ F KR+ ++D +L+F   GI++MV +TE +    +G+ Y  SS+ S+ +K  ++L+T+ILLG ++ YH   +++F++DN  DDW +AM++  VL +A+ELI+ ++HP+P D F+      +  S+   +            + +++V  + MFLR+Y++ RV++LHS+++ DAS++S+GALN++HFN RF+ K+LM + P  VL +  + L+I A+W +R CE YH   ++  NF   MW+++ITFLS+GYG++VP +YCG+ + +LTGI GAGCTALVVAV+ARKLEL++AEK+VHNF+MD +L K++K+AA NV++E WL++K+ +   +   +   +HQR+ L++I ++R +K E+++L+D A  L+++   QS + E +S LN +   L+  M S++ ++E L
Sbjct:  291 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELS----WGV-YSKSSMYSLALKCLISLSTIILLGLIIAYHAREVQLFVIDNGADDWRIAMTMERVLLIALELIVSAVHPVPGD-FKFMWRARLAFSYAPSQA----------EADLDMVLSVPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKVHFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDAQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLMKKIDHSRVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQSVMYELMSELNDRSEDLERQMLSLEQRVERL 693          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Zebrafish
Match: kcnn1a (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1a [Source:ZFIN;Acc:ZDB-GENE-070912-703])

HSP 1 Score: 343.199 bits (879), Expect = 6.011e-110
Identity = 168/417 (40.29%), Postives = 280/417 (67.15%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLE 1605
            +++G KL +R++ F KR+ ++D +L+F   GI++MV +TE +    +G+ Y   S  S  +K  ++L+TVILLG ++ YH   I++FM+DN  DDW +AM+   +  + +EL++C+IHPIP  Y     V T  +       P       V  + ++++  + MFLR+Y++ RV++LHS+++ DAS++S+GALN+I+FN RF+ K+LM + P  VL +  +  +I A+W +R CE YH   E+  NF   MW+++ITFLS+GYG++VP +YCG+ + +LTGI GAGCTALVVAV+ARKLEL++AEK+VHNF+MD +L K++K+ A NV++E WL++K+ +   +       +HQR+ L++I ++R +K E+++L D A  L+++  +Q+ + + VS L  +   LD  + +++ KL+
Sbjct:   75 KDIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELS----WGV-YTKESSYSFALKCLISLSTVILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFIVLELLVCAIHPIPGQY-----VFTWTARLAFTYVP------SVADADVDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLVSELQERSEELDKRIGTLEDKLD 475          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Zebrafish
Match: kcnn1b (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1b [Source:ZFIN;Acc:ZDB-GENE-060503-397])

HSP 1 Score: 341.273 bits (874), Expect = 3.827e-109
Identity = 172/426 (40.38%), Postives = 281/426 (65.96%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQ-------SCLSESVSVLNVKIGALDNAMQSIDSKLELL 1611
            +++G KL +R++ F KR+ ++D +L+F   GI++MV +TE +    +G+ Y   S  S  +K  ++L+TVILL  ++ YH   I++FM+DN  DDW +AM+   +L + +EL++C+IHPIP  Y     V T  +       P       V  + ++++  + MFLR+Y++ RV++LHS+++ DAS++S+GALN+I+FN RF+ K+LM + P  VL +  +  +I A+W +  CE YH  +E+  NF   MW+++ITFLS+GYG++VP +YCG+ + +LTGI GAGCTALVVAV+ARKLEL++AEK+VHNF+MD +L K++K+ A NV++E WL++K+ +   +       +HQR+ L++I ++R +K E+++L D A  L+++  +Q       S L E    L  +IG L+  + SI+S L+ L
Sbjct:   76 KDIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELS----WGV-YTKESSYSFALKCLISLSTVILLCLIIMYHAREIQLFMVDNGADDWRIAMTYERILFIVLELLVCAIHPIPGQY-----VFTWTARLAFTYTP------SVADADVDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVHVCERYHDKVEVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLVSELQERSEELEKRIGHLETKLDSINSSLQAL 485          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Zebrafish
Match: kcnn2 (potassium calcium-activated channel subfamily N member 2 [Source:ZFIN;Acc:ZDB-GENE-091116-41])

HSP 1 Score: 340.502 bits (872), Expect = 1.291e-108
Identity = 164/399 (41.10%), Postives = 275/399 (68.92%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNK---RSGTRNIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLN 1551
            +N+G KL +R++ F KR+ ++D +L+F   GI++MV +TE +        YG  S+ S+ +K  ++L+T+ILLG ++ YH   I++FM+DN+ DDW +AM+   +  + +E+++C+IHPIP +Y       T  +       P K        + ++++  + MFLR+Y++ RV++LHS+++ DAS++S+GALN+I+FN RF+ K+LM + P  VL +  + L+I A+W +RACE YH  +++  NF   MW+++ITFL++GYG++VP +YCG+ + +LTGI GAGCTALVVAV+A+KLEL++AEK+VHNF+MD +L K++K+ A NV++E WL++KN    R        +HQR+ L++I ++R +K E+++L D A +L+++  +Q+ + + VS LN
Sbjct:  101 QNIGQKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGA-----YGKESLYSLALKCLISLSTIILLGLIIIYHAREIQLFMVDNAADDWRIAMTYERIFFICLEILVCAIHPIPGNY-----TFTWTARLAFSYAPSK------TDADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFTISLWIIAAWTVRACERYHDNMDVTSNFLGAMWLISITFLTIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVAKKLELTKAEKHVHNFMMDTQLTKRVKNTAANVLRETWLIYKNTKLVRKMDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANSLVDLAKTQNVMYDLVSDLN 483          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Xenopus
Match: KCNN2 (potassium channel, calcium activated intermediate/small conductance subfamily N alpha, member 2 [Source:NCBI gene;Acc:100145581])

HSP 1 Score: 353.214 bits (905), Expect = 4.703e-112
Identity = 167/420 (39.76%), Postives = 283/420 (67.38%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLL 1614
            +N+G KL +R++ F KR+ ++D +L+F   GI++MV +TE +        Y   S+ S+ +K  ++L+T+ILLG ++ YH   I++FM+DN  DDW +AM+   +  + +E+++C+IHPIP +Y           +F          T     + ++++  + MFLR+Y++ RV++LHS+++ DAS++S+GALN+I+FN RF+ K+LM + P  VL +  + L+I A+W +RACE YH   ++  NF   MW+++ITFLS+GYG++VP +YCG+ + +LTGI GAGCTALVVAV+ARKLEL++AEK+VHNF+MD +L K++K+AA NV++E WL++KN +   +       +HQR+ L++I ++R +K E+++L D A  L+++  +Q+ + + +S LN +    +  +  +++KLE L+
Sbjct:  197 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGA-----YDKGSLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNY-----------TFTWTARLAFSYTPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHARVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVVLETKLETLI 600          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Xenopus
Match: KCNN2 (potassium channel, calcium activated intermediate/small conductance subfamily N alpha, member 2 [Source:NCBI gene;Acc:100145581])

HSP 1 Score: 352.829 bits (904), Expect = 4.788e-111
Identity = 167/420 (39.76%), Postives = 283/420 (67.38%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLL 1614
            +N+G KL +R++ F KR+ ++D +L+F   GI++MV +TE +        Y   S+ S+ +K  ++L+T+ILLG ++ YH   I++FM+DN  DDW +AM+   +  + +E+++C+IHPIP +Y           +F          T     + ++++  + MFLR+Y++ RV++LHS+++ DAS++S+GALN+I+FN RF+ K+LM + P  VL +  + L+I A+W +RACE YH   ++  NF   MW+++ITFLS+GYG++VP +YCG+ + +LTGI GAGCTALVVAV+ARKLEL++AEK+VHNF+MD +L K++K+AA NV++E WL++KN +   +       +HQR+ L++I ++R +K E+++L D A  L+++  +Q+ + + +S LN +    +  +  +++KLE L+
Sbjct:  276 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGA-----YDKGSLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNY-----------TFTWTARLAFSYTPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHARVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVVLETKLETLI 679          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Xenopus
Match: KCNN2 (potassium channel, calcium activated intermediate/small conductance subfamily N alpha, member 2 [Source:NCBI gene;Acc:100145581])

HSP 1 Score: 352.829 bits (904), Expect = 6.774e-111
Identity = 167/420 (39.76%), Postives = 283/420 (67.38%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLL 1614
            +N+G KL +R++ F KR+ ++D +L+F   GI++MV +TE +        Y   S+ S+ +K  ++L+T+ILLG ++ YH   I++FM+DN  DDW +AM+   +  + +E+++C+IHPIP +Y           +F          T     + ++++  + MFLR+Y++ RV++LHS+++ DAS++S+GALN+I+FN RF+ K+LM + P  VL +  + L+I A+W +RACE YH   ++  NF   MW+++ITFLS+GYG++VP +YCG+ + +LTGI GAGCTALVVAV+ARKLEL++AEK+VHNF+MD +L K++K+AA NV++E WL++KN +   +       +HQR+ L++I ++R +K E+++L D A  L+++  +Q+ + + +S LN +    +  +  +++KLE L+
Sbjct:  287 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGA-----YDKGSLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNY-----------TFTWTARLAFSYTPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHARVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVVLETKLETLI 690          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Xenopus
Match: wdr17 (WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-1000178])

HSP 1 Score: 345.125 bits (884), Expect = 8.746e-111
Identity = 179/475 (37.68%), Postives = 298/475 (62.74%), Query Frame = 1
Query:  202 QENKNRKMNNIKSEDSQIPLIENSVSKYYQTYTNEVCNNEKPENPKPFHVNKREIFENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNK---RSGTRNIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELL 1611
            Q+ + + +  + S   ++ + +N  SK        V    + E P+    N     +NVG KL +R++ F KR+ ++D +L+F   GI++MV +TE +    +G+ Y   S  S  +K  ++L+T ILLG ++ YH   I++FM+DN  DDW +AM+   +  + +EL +C+IHPIP  Y           SF          T  V  + I+++  + MFLR+Y++ RV++LHS+++ DAS++S+GALN+I+FN RF+ K+LM + P  VL +  +  +I A+W +R CE YH   E+  NF   MW+++ITFLS+GYG++VP +YCG+ + +LTGI GAGCTALVVAV+ARKLEL++AEK+VHNF+MD +L K++K+AA NV++E WL++K+    R        +HQR+ L++I  +R +K E+++L D A  L+++  +Q+ + + +S L  +   L+  + ++++K++ L
Sbjct:   27 QDPETQPLQTLHSPGVEVVVSKNDPSKASHRSLRGVEEGSQ-EAPRGQKKN-----QNVGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELS----WGV-YTKESSYSFALKCLISLSTAILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFITLELTVCAIHPIPGQY-----------SFTWTARLAFFYTTSVANADIDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLSKRVKNAAANVLRETWLIYKHTKLVRKIDHAKVRKHQRKFLQAIHLLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLMSELQERNEDLEKRIITLETKIDSL 479          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Xenopus
Match: wdr17 (WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-1000178])

HSP 1 Score: 345.125 bits (884), Expect = 1.206e-110
Identity = 179/475 (37.68%), Postives = 298/475 (62.74%), Query Frame = 1
Query:  202 QENKNRKMNNIKSEDSQIPLIENSVSKYYQTYTNEVCNNEKPENPKPFHVNKREIFENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNK---RSGTRNIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELL 1611
            Q+ + + +  + S   ++ + +N  SK        V    + E P+    N     +NVG KL +R++ F KR+ ++D +L+F   GI++MV +TE +    +G+ Y   S  S  +K  ++L+T ILLG ++ YH   I++FM+DN  DDW +AM+   +  + +EL +C+IHPIP  Y           SF          T  V  + I+++  + MFLR+Y++ RV++LHS+++ DAS++S+GALN+I+FN RF+ K+LM + P  VL +  +  +I A+W +R CE YH   E+  NF   MW+++ITFLS+GYG++VP +YCG+ + +LTGI GAGCTALVVAV+ARKLEL++AEK+VHNF+MD +L K++K+AA NV++E WL++K+    R        +HQR+ L++I  +R +K E+++L D A  L+++  +Q+ + + +S L  +   L+  + ++++K++ L
Sbjct:   19 QDPETQPLQTLHSPGVEVVVSKNDPSKASHRSLRGVEEGSQ-EAPRGQKKN-----QNVGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELS----WGV-YTKESSYSFALKCLISLSTAILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFITLELTVCAIHPIPGQY-----------SFTWTARLAFFYTTSVANADIDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLSKRVKNAAANVLRETWLIYKHTKLVRKIDHAKVRKHQRKFLQAIHLLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLMSELQERNEDLEKRIITLETKIDSL 471          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Mouse
Match: Kcnn2 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2 [Source:MGI Symbol;Acc:MGI:2153182])

HSP 1 Score: 353.599 bits (906), Expect = 1.894e-113
Identity = 167/420 (39.76%), Postives = 285/420 (67.86%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLL 1614
            +N+G KL +R++ F KR+ ++D +L+F   GI++MV +TE +        Y  +S+ S+ +K  ++L+T+ILLG ++ YH   I++FM+DN  DDW +AM+   +  + +E+++C+IHPIP +Y       T  +       P          + ++++  + MFLR+Y++ RV++LHS+++ DAS++S+GALN+I+FN RF+ K+LM + P  VL +  + L+I A+W +RACE YH   ++  NF   MW+++ITFLS+GYG++VP +YCG+ + +LTGI GAGCTALVVAV+ARKLEL++AEK+VHNF+MD +L K++K+AA NV++E WL++KN +   +       +HQR+ L++I ++R +K E+++L D A  L+++  +Q+ + + +S LN +    +  + ++++KLE L+
Sbjct:  110 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGA-----YDKASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNY-----TFTWTARLAFSYAP------STTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLI 513          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Mouse
Match: Kcnn2 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2 [Source:MGI Symbol;Acc:MGI:2153182])

HSP 1 Score: 353.599 bits (906), Expect = 1.894e-113
Identity = 167/420 (39.76%), Postives = 285/420 (67.86%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLL 1614
            +N+G KL +R++ F KR+ ++D +L+F   GI++MV +TE +        Y  +S+ S+ +K  ++L+T+ILLG ++ YH   I++FM+DN  DDW +AM+   +  + +E+++C+IHPIP +Y       T  +       P          + ++++  + MFLR+Y++ RV++LHS+++ DAS++S+GALN+I+FN RF+ K+LM + P  VL +  + L+I A+W +RACE YH   ++  NF   MW+++ITFLS+GYG++VP +YCG+ + +LTGI GAGCTALVVAV+ARKLEL++AEK+VHNF+MD +L K++K+AA NV++E WL++KN +   +       +HQR+ L++I ++R +K E+++L D A  L+++  +Q+ + + +S LN +    +  + ++++KLE L+
Sbjct:  110 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGA-----YDKASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNY-----TFTWTARLAFSYAP------STTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLI 513          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Mouse
Match: Kcnn3 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 3 [Source:MGI Symbol;Acc:MGI:2153183])

HSP 1 Score: 353.984 bits (907), Expect = 1.132e-111
Identity = 170/426 (39.91%), Postives = 293/426 (68.78%), Query Frame = 1
Query:  349 VNKREIFENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNK---RSGTRNIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELL 1611
             NKR+  +N+G KL +R++ F KR+ ++D +L+F   GI++MV +TE +    +G+ Y   S+ S+ +K  ++L+TVILLG ++ YH   +++F++DN  DDW +AM+   +L +++E+++C+IHPIP +Y +      +  S+   +            + ++++  + MFLR+Y++ RV++LHS+++ DAS++S+GALN+I+FN RF+ K+LM + P  VL +  + L+I A+W +R CE YH   ++  NF   MW+++ITFLS+GYG++VP +YCG+ + +LTGI GAGCTALVVAV+ARKLEL++AEK+VHNF+MD +L K++K+AA NV++E WL++K+    +        +HQR+ L++I ++R +K E+++L+D A  L+++   Q+ + + ++ LN +   L+  + S++SKLE L
Sbjct:  259 ANKRK-NQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELS----WGL-YSKDSMFSLALKCLISLSTVILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIPGEY-KFFWTARLAFSYTPSRA----------EADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRGVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHL 667          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Mouse
Match: Kcnn2 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2 [Source:MGI Symbol;Acc:MGI:2153182])

HSP 1 Score: 353.599 bits (906), Expect = 1.748e-110
Identity = 167/420 (39.76%), Postives = 285/420 (67.86%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLL 1614
            +N+G KL +R++ F KR+ ++D +L+F   GI++MV +TE +        Y  +S+ S+ +K  ++L+T+ILLG ++ YH   I++FM+DN  DDW +AM+   +  + +E+++C+IHPIP +Y       T  +       P          + ++++  + MFLR+Y++ RV++LHS+++ DAS++S+GALN+I+FN RF+ K+LM + P  VL +  + L+I A+W +RACE YH   ++  NF   MW+++ITFLS+GYG++VP +YCG+ + +LTGI GAGCTALVVAV+ARKLEL++AEK+VHNF+MD +L K++K+AA NV++E WL++KN +   +       +HQR+ L++I ++R +K E+++L D A  L+++  +Q+ + + +S LN +    +  + ++++KLE L+
Sbjct:  375 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGA-----YDKASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNY-----TFTWTARLAFSYAP------STTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLI 778          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Mouse
Match: Kcnn1 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1 [Source:MGI Symbol;Acc:MGI:1933993])

HSP 1 Score: 343.969 bits (881), Expect = 3.875e-110
Identity = 169/418 (40.43%), Postives = 279/418 (66.75%), Query Frame = 1
Query:  373 NVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKR---SGTRNIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELL 1611
             V  +L +R++ F KR+ ++D +L+F   GI++MV +TE +    +G+ Y   S+ S  +K  ++L+TVILLG ++ YH   I++F++DN  DDW +AM+   V  +++EL++C+IHP+P  +++      +  S V               + ++V+  + MFLR+Y++ RV++LHSR++ DAS++S+GALNR+ FN RF+ K+LM + P  VL +  +  +I A+W +R CE YH   E+  NF   MW+++ITFLS+GYG++VP +YCG+ + +LTGI GAGCTALVVAV+ARKLEL++AEK+VHNF+MD +L K++K+AA NV++E WL++K+ R      +    +HQR+ L++I ++R +K E+ ++ D A  L E+  +QS   E VS L  +   L+  + +++S+L++L
Sbjct:   86 TVSHRLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELS----WGV-YTKESLCSFALKCLISLSTVILLGLVILYHAREIQLFLVDNGADDWRIAMTWERVSLISLELVVCAIHPVP-GHYRFTWTARLAFSLVP----------SAAEADLDVLLSIPMFLRLYLLARVMLLHSRIFTDASSRSIGALNRVTFNTRFVTKTLMTICPGTVLLVFSVSSWIVAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQGRVRKHQRKFLQAIHQLRSVKIEQGKVNDQANTLAELAKAQSIAYEVVSELQAQQEELEARLAALESRLDVL 487          
BLAST of Small conductance calcium-activated potassium channel protein vs. UniProt/SwissProt
Match: sp|P70604|KCNN2_RAT (Small conductance calcium-activated potassium channel protein 2 OS=Rattus norvegicus OX=10116 GN=Kcnn2 PE=1 SV=1)

HSP 1 Score: 353.599 bits (906), Expect = 1.752e-112
Identity = 167/420 (39.76%), Postives = 285/420 (67.86%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLL 1614
            +N+G KL +R++ F KR+ ++D +L+F   GI++MV +TE +        Y  +S+ S+ +K  ++L+T+ILLG ++ YH   I++FM+DN  DDW +AM+   +  + +E+++C+IHPIP +Y       T  +       P          + ++++  + MFLR+Y++ RV++LHS+++ DAS++S+GALN+I+FN RF+ K+LM + P  VL +  + L+I A+W +RACE YH   ++  NF   MW+++ITFLS+GYG++VP +YCG+ + +LTGI GAGCTALVVAV+ARKLEL++AEK+VHNF+MD +L K++K+AA NV++E WL++KN +   +       +HQR+ L++I ++R +K E+++L D A  L+++  +Q+ + + +S LN +    +  + ++++KLE L+
Sbjct:  116 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGA-----YDKASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNY-----TFTWTARLAFSYAP------STTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLI 519          
BLAST of Small conductance calcium-activated potassium channel protein vs. UniProt/SwissProt
Match: sp|Q9H2S1|KCNN2_HUMAN (Small conductance calcium-activated potassium channel protein 2 OS=Homo sapiens OX=9606 GN=KCNN2 PE=1 SV=2)

HSP 1 Score: 353.214 bits (905), Expect = 1.914e-112
Identity = 167/420 (39.76%), Postives = 285/420 (67.86%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLL 1614
            +N+G KL +R++ F KR+ ++D +L+F   GI++MV +TE +        Y  +S+ S+ +K  ++L+T+ILLG ++ YH   I++FM+DN  DDW +AM+   +  + +E+++C+IHPIP +Y       T  +       P          + ++++  + MFLR+Y++ RV++LHS+++ DAS++S+GALN+I+FN RF+ K+LM + P  VL +  + L+I A+W +RACE YH   ++  NF   MW+++ITFLS+GYG++VP +YCG+ + +LTGI GAGCTALVVAV+ARKLEL++AEK+VHNF+MD +L K++K+AA NV++E WL++KN +   +       +HQR+ L++I ++R +K E+++L D A  L+++  +Q+ + + +S LN +    +  + ++++KLE L+
Sbjct:  115 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGA-----YDKASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNY-----TFTWTARLAFSYAP------STTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLI 518          
BLAST of Small conductance calcium-activated potassium channel protein vs. UniProt/SwissProt
Match: sp|Q7KVW5|KCNN_DROME (Small conductance calcium-activated potassium channel protein OS=Drosophila melanogaster OX=7227 GN=SK PE=2 SV=2)

HSP 1 Score: 361.688 bits (927), Expect = 8.844e-112
Identity = 186/453 (41.06%), Postives = 286/453 (63.13%), Query Frame = 1
Query:  286 YQTYTNEVCNNEKPENPKPFHVNKREIFENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDY-FQ-----VNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYHLELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLLE 1617
            Y+ Y  E        + KP   N  +   NVG +L  RK+ F KR+ I+D +LV    GII+MV + E + +G Y      +S  S  +K  ++++TVILLG +V YH + +++FM+DN  DDW +AM+   +  + +EL IC+IHPIP +Y FQ      N   TI +  V                P +V   L MFLR+Y++CRV++LHS+++ DAS++S+GALNRI+FN RF+ K+LM + P  VL + ++ L+I ASW LR CE +H E   N  N MW+ AITFL VGYG+IVP +YCGR I +  G+ GAGCTAL+VAV++RKLEL+RAEK+VHNF+MD +L K++K+AA NV++E WL++K+ R   R        HQR+ L +I  +R +K ++++L DNA  + ++  +Q+ + E +S ++ +  A++  + +++ K++ + E
Sbjct:  439 YEMYMEERALTGGNTSRKP-STNSAKHKPNVGYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENELSSAGVYT----KASFYSTALKTLISVSTVILLGLIVAYHALEVQLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEYYFQWTTKLANKNKTIGTEMV----------------PYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDEEHANLLNSMWLTAITFLCVGYGDIVPNTYCGRGITLTCGMVGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIISDMSSRQDAIEERLTNLEDKMQSIQE 870          
BLAST of Small conductance calcium-activated potassium channel protein vs. UniProt/SwissProt
Match: sp|P58391|KCNN3_MOUSE (Small conductance calcium-activated potassium channel protein 3 OS=Mus musculus OX=10090 GN=Kcnn3 PE=1 SV=2)

HSP 1 Score: 353.984 bits (907), Expect = 7.918e-111
Identity = 170/426 (39.91%), Postives = 293/426 (68.78%), Query Frame = 1
Query:  349 VNKREIFENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNK---RSGTRNIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELL 1611
             NKR+  +N+G KL +R++ F KR+ ++D +L+F   GI++MV +TE +    +G+ Y   S+ S+ +K  ++L+TVILLG ++ YH   +++F++DN  DDW +AM+   +L +++E+++C+IHPIP +Y +      +  S+   +            + ++++  + MFLR+Y++ RV++LHS+++ DAS++S+GALN+I+FN RF+ K+LM + P  VL +  + L+I A+W +R CE YH   ++  NF   MW+++ITFLS+GYG++VP +YCG+ + +LTGI GAGCTALVVAV+ARKLEL++AEK+VHNF+MD +L K++K+AA NV++E WL++K+    +        +HQR+ L++I ++R +K E+++L+D A  L+++   Q+ + + ++ LN +   L+  + S++SKLE L
Sbjct:  259 ANKRK-NQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELS----WGL-YSKDSMFSLALKCLISLSTVILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIPGEY-KFFWTARLAFSYTPSRA----------EADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRGVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHL 667          
BLAST of Small conductance calcium-activated potassium channel protein vs. UniProt/SwissProt
Match: sp|Q9UGI6|KCNN3_HUMAN (Small conductance calcium-activated potassium channel protein 3 OS=Homo sapiens OX=9606 GN=KCNN3 PE=1 SV=2)

HSP 1 Score: 353.984 bits (907), Expect = 8.055e-111
Identity = 169/426 (39.67%), Postives = 293/426 (68.78%), Query Frame = 1
Query:  349 VNKREIFENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNK---RSGTRNIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELL 1611
             NKR+  +N+G KL +R++ F KR+ ++D +L+F   GI++MV +TE +    +G+ Y   S+ S+ +K  ++L+T+ILLG ++ YH   +++F++DN  DDW +AM+   +L +++E+++C+IHPIP +Y +      +  S+   +            + ++++  + MFLR+Y++ RV++LHS+++ DAS++S+GALN+I+FN RF+ K+LM + P  VL +  + L+I A+W +R CE YH   ++  NF   MW+++ITFLS+GYG++VP +YCG+ + +LTGI GAGCTALVVAV+ARKLEL++AEK+VHNF+MD +L K++K+AA NV++E WL++K+    +        +HQR+ L++I ++R +K E+++L+D A  L+++   Q+ + + ++ LN +   L+  + S++SKLE L
Sbjct:  258 ANKRK-NQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELS----WGL-YSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIPGEY-KFFWTARLAFSYTPSRA----------EADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHL 666          
BLAST of Small conductance calcium-activated potassium channel protein vs. TrEMBL
Match: A0A1I8FZC7 (CaMBD domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020603g1 PE=4 SV=1)

HSP 1 Score: 505.368 bits (1300), Expect = 6.152e-171
Identity = 252/461 (54.66%), Postives = 339/461 (73.54%), Query Frame = 1
Query:  241 EDSQIPLIENSVSKYYQTYTNEVCNNEKPENPKPFHVNKREIFENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYHLELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTRNIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLLERS 1623
            ED  IPL+    S    +Y + V      E PK +       +ENVG++LA RK  F +R+LIADLSL FA LGI++M+ +TE  ++  +  + G     S++VK  +++TT ILLGF+ WYH + I++FM+DNSIDDW LA+++S    LA+EL++C++HPIP  + +V  +   D+  V L        L V+  PI+V+F L MFLR Y+VCRV+MLHSR+YQDAS+QSLGALNRIHFNFRFIFKSLMN+YPEYVLT++ L LFIWASWA+RACE+YH +   NF N MW+ AITFL+VGYG+IVP SYCGR IAVLTG+FG G TALVVAVLARKLELSRAEKYVHNFV+DIELDKQ+KHAA N++KEGWL +K K++G     L+HQRRLL SI +IRDL+ ++KRLAD++V+L E+H +Q+ +  S++ +  +   +++ +  I+ KL+ LL++S
Sbjct:   12 EDPGIPLVGKGGSMNGSSYGSSVG-----EQPKTYK------YENVGARLARRKELFVRRKLIADLSLFFAMLGIVLMIVETELCMANVF--NKGQPG--SIIVKSLISITTAILLGFITWYHYLDIKVFMIDNSIDDWRLAITMSRGFHLALELLVCAVHPIPGQH-EVQMLVYDDTKRVRL--------LQVI--PIDVIFSLPMFLRFYLVCRVMMLHSRLYQDASSQSLGALNRIHFNFRFIFKSLMNLYPEYVLTVMALFLFIWASWAVRACEMYHGQEHRNFLNSMWMTAITFLTVGYGDIVPASYCGRGIAVLTGLFGTGVTALVVAVLARKLELSRAEKYVHNFVIDIELDKQVKHAAANILKEGWLSYKYKKAGNTGKTLKHQRRLLHSIHRIRDLRGDQKRLADSSVSLTEMHRNQAFMMTSLTTVQSRSREMESRLARIEDKLDRLLQQS 446          
BLAST of Small conductance calcium-activated potassium channel protein vs. TrEMBL
Match: A0A267GF91 (CaMBD domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023081g1 PE=4 SV=1)

HSP 1 Score: 492.656 bits (1267), Expect = 6.350e-166
Identity = 241/417 (57.79%), Postives = 318/417 (76.26%), Query Frame = 1
Query:  367 FENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYHLELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTRNIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLLE 1617
            +ENVG++LA RK  F +R+LIADLSL FA LGI++M+ +TE  I+G +    GA SI+   +K  ++++T ILLGF+ WYH + I++FM+DNS+DDW LA+++S    LA+EL++C+IHPIP  +  V  +   +++ V L   +          PI+V+F L MFLR Y+VCRV+MLHSR+YQDAS+QSLGALNRIHFNFRFIFKSLMN+YPEYVLT++ L LFIWASWA+RACE+YH     NF N MW+ AITFL+VGYG+IVP SYCGR IAVLTG+FG G TALVVAVLARKLELSRAEKYVHNFV+DIELDKQ+KHAA N++KEGWL +K KR+G     L+HQRRLL SI +IR+L+N++KRLAD++V+L E++ +Q  +   ++ +  K    D  +Q I+ KL+ LL+
Sbjct:   52 YENVGARLARRKELFVRRKLIADLSLFFAMLGIVMMIIETELCIAGIFN-KAGAGSIV---MKSLISVSTAILLGFISWYHYLDIKVFMIDNSMDDWRLAITLSRGFHLAMELLVCAIHPIPGQHM-VQMLAYDNTNSVRLMQAI----------PIDVIFSLPMFLRFYLVCRVMMLHSRLYQDASSQSLGALNRIHFNFRFIFKSLMNLYPEYVLTVMALFLFIWASWAVRACEMYHGPEHRNFLNSMWMTAITFLTVGYGDIVPASYCGRGIAVLTGLFGTGVTALVVAVLARKLELSRAEKYVHNFVIDIELDKQVKHAAANILKEGWLSYKYKRAGNATKTLKHQRRLLHSIHRIRELRNDQKRLADSSVSLTEMYRNQGFMLTGLASVQAKAKETDAHLQRIEEKLDRLLQ 453          
BLAST of Small conductance calcium-activated potassium channel protein vs. TrEMBL
Match: A0A1I8ITN7 (CaMBD domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 467.233 bits (1201), Expect = 2.151e-156
Identity = 232/401 (57.86%), Postives = 304/401 (75.81%), Query Frame = 1
Query:  418 RRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSR-VYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYHLELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTRNIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLLE 1617
            R LIADLSL FA LGI++M+ +TE  I+G +    GA SI+   +K  ++++T ILLGF+ WYH + I++FM+DNS+DDW LA+++S    LA+EL++C+IHPIP  +  V  +   +++ V L   +          PI+V+F L MFLR Y+VCRV+MLHSR +YQDAS+QSLGALNRIHFNFRFIFKSLMN+YPEYVLT++ L LFIWASWA+RACE+YH     NF N MW+ AITFL+VGYG+IVP SYCGR IAVLTG+FG G TALVVAVLARKLELSRAEKYVHNFV+DIELDKQ+KHAA N++KEGWL +K KR+G     L+HQRRLL SI +IR+L+N++KRLAD++V+L E++ +Q  +   ++ +  K    D  +Q I+ KL+ LL+
Sbjct:   39 RPLIADLSLFFAMLGIVMMIIETELCIAGIFN-KAGAGSIV---MKSLISVSTAILLGFISWYHYLDIKVFMIDNSMDDWRLAITLSRGFHLAMELLVCAIHPIPGQHM-VQMLAYDNTNSVRLMQAI----------PIDVIFSLPMFLRFYLVCRVMMLHSRRLYQDASSQSLGALNRIHFNFRFIFKSLMNLYPEYVLTVMALFLFIWASWAVRACEMYHGPEHRNFLNSMWMTAITFLTVGYGDIVPASYCGRGIAVLTGLFGTGVTALVVAVLARKLELSRAEKYVHNFVIDIELDKQVKHAAANILKEGWLSYKYKRAGNATKTLKHQRRLLHSIHRIRELRNDQKRLADSSVSLTEMYRNQGFMLTGLASVQAKAKETDAHLQRIEEKLDRLLQ 424          
BLAST of Small conductance calcium-activated potassium channel protein vs. TrEMBL
Match: A0A1I8IEB4 (CaMBD domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 455.292 bits (1170), Expect = 2.028e-152
Identity = 222/387 (57.36%), Postives = 294/387 (75.97%), Query Frame = 1
Query:  457 LGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYHLELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTRNIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLLE 1617
            LGI++M+ +TE  I+G +    GA SI+   +K  ++++T ILLGF+ WYH + I++FM+DNS+DDW LA+++S    LA+EL++C+IHPIP  +  V  +   +++ V L   +          PI+V+F L MFLR Y+VCRV+MLHSR+YQDAS+QSLGALNRIHFNFRFIFKSLMN+YPEYVLT++ L LFIWASWA+RACE+YH     NF N MW+ AITFL+VGYG+IVP SYCGR IAVLTG+FG G TALVVAVLARKLELSRAEKYVHNFV+DIELDKQ+KHAA N++KEGWL +K KR+G     L+HQRRLL SI +IR+L+N++KRLAD++V+L E++ +Q  +   ++ +  K    D  +Q I+ KL+ LL+
Sbjct:    2 LGIVMMIIETELCIAGIFN-KAGAGSIV---MKSLISVSTAILLGFISWYHYLDIKVFMIDNSMDDWRLAITLSRGFHLAMELLVCAIHPIPGQHM-VQMLAYDNTNSVRLMQAI----------PIDVIFSLPMFLRFYLVCRVMMLHSRLYQDASSQSLGALNRIHFNFRFIFKSLMNLYPEYVLTVMALFLFIWASWAVRACEMYHGPEHRNFLNSMWMTAITFLTVGYGDIVPASYCGRGIAVLTGLFGTGVTALVVAVLARKLELSRAEKYVHNFVIDIELDKQVKHAAANILKEGWLSYKYKRAGNATKTLKHQRRLLHSIHRIRELRNDQKRLADSSVSLTEMYRNQGFMLTGLASVQAKAKETDAHLQRIEEKLDRLLQ 373          
BLAST of Small conductance calcium-activated potassium channel protein vs. TrEMBL
Match: A0A1I8J573 (CaMBD domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 439.499 bits (1129), Expect = 3.581e-144
Identity = 210/400 (52.50%), Postives = 295/400 (73.75%), Query Frame = 1
Query:  424 LIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYHLELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTRNIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLLERS 1623
            ++ADLSL+FA LG+ +MVA+ E  ++G    D   S+I+    K  ++L+T ILLGF+V YH + +++FM+DNS++++ L +    V  LA+EL +C++HP P +  + +    +  +    +G L     H++  P +V+ GL MFLR Y++CRV+MLHSR++QDAS+QSLGALNR+ FNFRFIFKS+M++YPEYVLT   L+LFIWASWA RACE+Y  + + NF N MW+ AITFL+VGYG++VPE+YC R +AVLTGIFG G TALVVAVLAR+LELSRAEKYVHNFV+D ELDK+M+H+A N++KEGWL +K +RSG    +L HQR+LL SI +IR L+++++RLADN++ LLEVH +Q  +   V  L+ +I   +  M +ID KL+ LL R+
Sbjct:    1 MLADLSLLFALLGVALMVAEAELCMAGTLRKDQAGSAIL----KSFISLSTAILLGFIVLYHWLDLQVFMIDNSMENYRLVLDAGRVFRLALELAVCAVHPPPTN--RTDEAQLLQQTHQPREGQLDQ---HLV--PFDVILGLPMFLRFYLICRVLMLHSRLFQDASSQSLGALNRVPFNFRFIFKSMMSMYPEYVLTAAALVLFIWASWATRACEMYRGKKQRNFLNSMWLTAITFLTVGYGDVVPETYCSRGVAVLTGIFGTGVTALVVAVLARRLELSRAEKYVHNFVIDTELDKRMRHSAANILKEGWLAYKFRRSGDAAASLRHQRKLLHSIYQIRQLRSDQRRLADNSIGLLEVHKNQGFILTGVQQLHSRIREAEARMVNIDDKLDRLLSRA 389          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Cavefish
Match: kcnn3 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 3 [Source:ZFIN;Acc:ZDB-GENE-100921-56])

HSP 1 Score: 356.681 bits (914), Expect = 4.443e-113
Identity = 171/422 (40.52%), Postives = 291/422 (68.96%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDY---FQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELL 1611
            +N+G KL +R++ F KR+ ++D +L+F   GI++MV +TE +    +G+ Y  SS+ S+ +K  ++L+T+ILLG ++ YH   +++F++DN  DDW +AM++  VL +A+EL++ ++HP+P D+   ++     T   S  E              + +++V  + MFLR+Y++ RV++LHS+++ DAS++S+GALN++HFN RF+ K+LM + P  VL +  + L+I A+W +R CE YH   ++  NF   MW+++ITFLS+GYG++VP +YCG+ + +LTGI GAGCTALVVAV+ARKLEL++AEK+VHNF+MD +L K++K+AA NV++E WL++K+ +   +   +   +HQR+ L++I ++R +K E+++L+D A  L+++   QS + E +S LN +   L+  M S++ ++E L
Sbjct:  244 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELS----WGV-YSKSSMYSLALKCLISLSTIILLGLIIAYHAREVQLFVIDNGADDWRIAMTMERVLLIALELLVSAVHPVPGDFKFVWRARLAFTYIPSQAE--------------ADLDMVLSVPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKVHFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDAQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLMKKIDHSRVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQSVMYELMSELNDRSEDLERQMLSLEQRVEQL 646          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Cavefish
Match: kcnn2 (potassium calcium-activated channel subfamily N member 2 [Source:ZFIN;Acc:ZDB-GENE-091116-41])

HSP 1 Score: 340.502 bits (872), Expect = 5.984e-109
Identity = 167/420 (39.76%), Postives = 283/420 (67.38%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNK---RSGTRNIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLL 1614
            +N+G KL +R++ F KR+ ++D +L+F   GI++MV +TE +        YG  S+ S+ +K  ++L+T+ILLG ++ YH   I++FM+DN+ DDW +AM+   +  + +E+++C+IHPIP  Y           +F          T     + ++++  + MFLR+Y++ RV++LHS+++ DAS++S+GALN+I+FN RF+ K+LM + P  VL +  + L+I A+W +RACE YH   ++  NF   MW+++ITFL++GYG++VP +YCG+ + +LTGI GAGCTALVVAV+A+KLEL++AEK+VHNF+MD +L K++K+ A NV++E WL++KN    R        +HQR+ L++I ++R +K E+++L D A +L+++  +Q+ + + +S LN +    +  +  +++KLE LL
Sbjct:   84 QNIGQKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGA-----YGKESLYSLALKCLISLSTIILLGLIIIYHAREIQLFMVDNAADDWRIAMTYERIFFICLEILVCAIHPIPGKY-----------TFTWTARLAFYYTSSKTDADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFTISLWIIAAWTVRACERYHDNQDVTSNFLGAMWLISITFLTIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVAKKLELTKAEKHVHNFMMDTQLTKRVKNTAANVLRETWLIYKNTKLVRKMDHARVRKHQRKFLQAIHQLRSVKMEQRKLNDQANSLVDLAKTQNIMYDLISDLNERGEDTEKRIAVLETKLETLL 487          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Cavefish
Match: kcnn1b (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1b [Source:ZFIN;Acc:ZDB-GENE-060503-397])

HSP 1 Score: 268.855 bits (686), Expect = 6.490e-82
Identity = 157/426 (36.85%), Postives = 265/426 (62.21%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYHLELRDNFFN-CMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIF-GAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQ-------SCLSESVSVLNVKIGALDNAMQSIDSKLELL 1611
            +++G KL +R++ F KR+ ++D +L+F   GI++MV +TE +    +G+ Y   S  S  +K  ++L+T+ILLG ++ YH   I++FM+DN  DDW +AM+   +L + +EL++C+IHPIP  Y     V T  +       P       V  + ++++  + MFLR+Y++ RV++LHS+++ DAS++S+GALN+I+FN RF+ K+LM + P  VL +  +  +I A+W +R    ++ +   N     +W+V + F  +  G  VP     +++A L   F GAGCTALVVAV+ARKLEL++AEK+VHNF+MD +L K++K+ A NV++E WL++K+ +   +       +HQR+ L++I ++R +K E+++L D A  L+++  +Q       S L E    L+ +IG L+  + SI S L+ L
Sbjct:   76 KDIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELS----WGV-YTKESSYSFALKCLISLSTLILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERILFIVLELLVCAIHPIPGHY-----VFTWTARLAFTYAP------SVADADVDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVFLFWYPQ---NILPIALWLVYVIFSKLQTGSSVP---FWKAVAFLLQPFRGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLVSELQERSEELDKRIGQLEEKLDSITSSLQAL 479          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Cavefish
Match: kcnn4 (potassium calcium-activated channel subfamily N member 4 [Source:NCBI gene;Acc:103046778])

HSP 1 Score: 242.276 bits (617), Expect = 3.436e-72
Identity = 144/434 (33.18%), Postives = 250/434 (57.60%), Query Frame = 1
Query:  379 GSKLAYRKSRFY----KRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLR-----SPI-------------NVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYHLELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTRNIA-LEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELL 1611
            GS L   + R +    KRRL A  +L  A LGI++M+   E   +      Y   SI ++ +   ++ +T  LL  ++ +H   I +F++D++  DW +AM+ + VLG+++EL++C++HP+              +S++   GP  GV + VL+     +PI              ++   +MFLR+Y+V R I+LHS+V   AS +S+G+LN I+F FRF+ K LMN YP   L + I++ ++ A+W LR CE        +    +W++AITFL+VGYG++ P + CG+ + + TG+ G  CTA++VAV+ +KL L++ EK+VH F+MDI++ K++++AA NV++E WL+ +  ++   N     HQR LL +IR  R L+ ++++L D    ++++   Q  + +  +  N     L+  + S++ KL+ L
Sbjct:   51 GSNLYRLRDRKFLLEDKRRLCA-WALGAAMLGILLMIGHAELCPA-----VYQPGSIYAISINGLISFSTGCLLILIIAFHYKDIRLFIIDHNQVDWRIAMTTNRVLGISLELLVCAVHPV--------------ASYL---GPDVGVQVPVLKWNSSVTPICLCQSHRETWLEIELLLSGLMFLRLYLVHRAILLHSKVLLSASYRSIGSLNNINFTFRFVLKVLMNKYPARTLLVFIMLFWLSAAWMLRLCERQAEVETGDMGTALWLIAITFLTVGYGDVSPCTSCGKVVCLFTGVMGVACTAMLVAVVTKKLALNKGEKHVHFFMMDIQISKEIRNAAANVLRECWLLHRTTQAKNNNGEHRHHQRCLLEAIRVFRHLRLKQRKLRDYTSEMVDLSKMQMIMCDLSANWNNSYRELEQRIISMEQKLDEL 461          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010066.1 (pep scaffold:Pmarinus_7.0:GL480376:18291:27660:1 gene:ENSPMAG00000009109.1 transcript:ENSPMAT00000010066.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 178.333 bits (451), Expect = 1.395e-52
Identity = 82/198 (41.41%), Postives = 134/198 (67.68%), Query Frame = 1
Query:  622 EIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGI 1209
            ++F++DN  DDW +AM+   +  + +EL+IC+IHPIP +Y     + T   +F  +          V  + +++V  + MFLR+Y++ RV++LHS+++ DAS++S+GALN+I FN RF+ K+LM + P  VL +  + L+I A+W +RACE YH   ++  NF   MW+++ITFL++GYG++VP +YCGR + +LTGI
Sbjct:    1 QLFIVDNGADDWRIAMTYQRIFNIGLELLICAIHPIPGNY---TFMWTARLAFTYVSS--------VKEADVDIVLSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKITFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDPQDITSNFLAAMWLISITFLTIGYGDMVPHTYCGRGVCLLTGI 187          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004465.1 (pep scaffold:Pmarinus_7.0:GL499141:545:1291:-1 gene:ENSPMAG00000004066.1 transcript:ENSPMAT00000004465.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.8246 bits (107), Expect = 4.705e-6
Identity = 18/44 (40.91%), Postives = 32/44 (72.73%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAIS 501
            +N+G KL +R++ F KR+ ++D +L+F   GI++MV +TE + S
Sbjct:  104 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWS 147          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Medaka
Match: kcnn3 (small conductance calcium-activated potassium channel protein 2 [Source:NCBI gene;Acc:101156116])

HSP 1 Score: 358.992 bits (920), Expect = 1.081e-113
Identity = 172/420 (40.95%), Postives = 290/420 (69.05%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDY-FQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELL 1611
            +N+G KL +R++ F KR+ ++D +L+F   GI++MV +TE +    +G+ Y  SS+ S+ +K  ++L+TVILLG ++ YH   +++F++DN  DDW +AM++  VL +A+EL++ ++HP+P D+ FQ         +  + +  L            ++V  + MFLR+Y++ RV++LHS+++ DAS++S+GALN++HFN RF+ K+LM + P  VL +  + L+I A+W +R CE YH   ++  NF   MW+++ITFLS+GYG++VP +YCG+ + +LTGI GAGCTALVVAV+ARKLEL++AEK+VHNF+MD +L K++K+AA NV++E WL++K+ +   +   +   +HQR+ L++I ++R +K E+++L+D A  L+++   QS + E +S LN +   L+  M S++ ++E L
Sbjct:  229 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELS----WGV-YSKSSMYSLALKCLISLSTVILLGLIIAYHAREVQLFVIDNGADDWRIAMTMERVLLIALELLVSAVHPVPGDFKFQWRARLAFSYAPSQAEADL------------DMVLSVPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKVHFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDAQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLMKKIDHSRVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQSVMYELMSELNDRSEDLERQMLSLEQRVEQL 631          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Medaka
Match: kcnn3 (small conductance calcium-activated potassium channel protein 2 [Source:NCBI gene;Acc:101156116])

HSP 1 Score: 359.377 bits (921), Expect = 5.821e-113
Identity = 172/420 (40.95%), Postives = 290/420 (69.05%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDY-FQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELL 1611
            +N+G KL +R++ F KR+ ++D +L+F   GI++MV +TE +    +G+ Y  SS+ S+ +K  ++L+TVILLG ++ YH   +++F++DN  DDW +AM++  VL +A+EL++ ++HP+P D+ FQ         +  + +  L            ++V  + MFLR+Y++ RV++LHS+++ DAS++S+GALN++HFN RF+ K+LM + P  VL +  + L+I A+W +R CE YH   ++  NF   MW+++ITFLS+GYG++VP +YCG+ + +LTGI GAGCTALVVAV+ARKLEL++AEK+VHNF+MD +L K++K+AA NV++E WL++K+ +   +   +   +HQR+ L++I ++R +K E+++L+D A  L+++   QS + E +S LN +   L+  M S++ ++E L
Sbjct:  316 QNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELS----WGV-YSKSSMYSLALKCLISLSTVILLGLIIAYHAREVQLFVIDNGADDWRIAMTMERVLLIALELLVSAVHPVPGDFKFQWRARLAFSYAPSQAEADL------------DMVLSVPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKVHFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDAQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLMKKIDHSRVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQSVMYELMSELNDRSEDLERQMLSLEQRVEQL 718          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Medaka
Match: kcnn1a (small conductance calcium-activated potassium channel protein 2 [Source:NCBI gene;Acc:101164003])

HSP 1 Score: 343.199 bits (879), Expect = 5.090e-109
Identity = 171/425 (40.24%), Postives = 280/425 (65.88%), Query Frame = 1
Query:  373 NVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTR---NIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQ-------SCLSESVSVLNVKIGALDNAMQSIDSKLELL 1611
            ++G KL +R++ F KR+ ++D +L+F   GI++MV +TE +    +G+ Y   S  S  +K  ++L+TVILLG ++ YH   I++FM+DN  DDW +AM+   +  + +EL++C+IHPIP  Y     V T  +       P       V  + ++++  + MFLR+Y++ RV++LHS+++ DAS++S+GALN+I+FN RF+ K+LM + P  VL +  +  +I A+W +R CE YH   E+  NF   MW+++ITFLS+GYG++VP +YCG+ + +LTGI GAGCTALVVAV+ARKLEL++AEK+VHNF+MD +L K++K+ A NV++E WL++K+ +   +       +HQR+ L++I ++R +K E+++L D A  L+++  +Q       S L E    L+ +IG L++ + S+   L+ L
Sbjct:  147 DIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELS----WGV-YTKESSYSFALKCLISLSTVILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFIVLELLVCAIHPIPGQY-----VFTWTARLAFTYTP------SVADADVDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLVSELQERSEELDKRIGTLEDKLDSVTGSLQAL 555          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Medaka
Match: kcnn2 (small conductance calcium-activated potassium channel protein 2 [Source:NCBI gene;Acc:101174204])

HSP 1 Score: 339.347 bits (869), Expect = 1.032e-108
Identity = 170/440 (38.64%), Postives = 291/440 (66.14%), Query Frame = 1
Query:  247 SQIPLIENSVSKYYQTYTNEVCNNEKPENPKPFHVNKREIFENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNK---RSGTRNIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLN 1551
            S+ P I+      Y   ++   + E P + K    + ++  +N+G KL +R++ F KR+ ++D +L+F   GI++MV +TE +        YG  S+ S+ +K  ++L+T+ILLG ++ YH   I++FM+DN+ DDW +AM+   +  + +E+++C+IHPIP +Y        +  S+V  +            + ++++  + MFLR+Y++ RV++LHS+++ DAS++S+GALN+I+FN RF+ K+LM + P  VL +  + L+I A+W +RACE YH   ++  NF   MW+++ITFL++GYG++VP +YCG+ + +LTGI GAGCTALVVAV+A+KLEL++AEK+VHNF+MD +L K++K+ A NV++E WL++KN    R        +HQR+ L++I ++R +K E+++L D A +L+++  +Q+ + + VS LN
Sbjct:   28 SEAPFIQLEPKWIYSCSSSSSTDMETPLHGK----SGKKKNQNIGEKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGA-----YGKESLYSLALKCLISLSTIILLGLIIIYHAREIQLFMVDNAADDWRIAMTYERIFFICLEILVCAIHPIPGNY-TFTWTARLAYSYVPSRTD----------ADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFTISLWIIAAWTVRACERYHDNQDITSNFLGAMWLISITFLTIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVAKKLELTKAEKHVHNFMMDTQLTKRVKNTAANVLRETWLIYKNTKLVRKMDHARVRKHQRKFLQAIHQLRSVKMEQRKLNDQANSLVDLAKTQNIMYDMVSDLN 447          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Medaka
Match: kcnn2 (small conductance calcium-activated potassium channel protein 2 [Source:NCBI gene;Acc:101174204])

HSP 1 Score: 338.191 bits (866), Expect = 1.626e-106
Identity = 163/401 (40.65%), Postives = 276/401 (68.83%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYH--LELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNK---RSGTRNIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVK 1557
            +N+G KL +R++ F KR+ ++D +L+F   GI++MV +TE +        YG  S+ S+ +K  ++L+T+ILLG ++ YH   I++FM+DN+ DDW +AM+   +  + +E+++C+IHPIP +Y        +  S+V  +            + ++++  + MFLR+Y++ RV++LHS+++ DAS++S+GALN+I+FN RF+ K+LM + P  VL +  + L+I A+W +RACE YH   ++  NF   MW+++ITFL++GYG++VP +YCG+ + +LTGI GAGCTALVVAV+A+KLEL++AEK+VHNF+MD +L K++K+ A NV++E WL++KN    R        +HQR+ L++I ++R +K E+++L D A +L+++  +Q+ + + VS LN +
Sbjct:  211 QNIGEKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGA-----YGKESLYSLALKCLISLSTIILLGLIIIYHAREIQLFMVDNAADDWRIAMTYERIFFICLEILVCAIHPIPGNY-TFTWTARLAYSYVPSR----------TDADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFTISLWIIAAWTVRACERYHDNQDITSNFLGAMWLISITFLTIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVAKKLELTKAEKHVHNFMMDTQLTKRVKNTAANVLRETWLIYKNTKLVRKMDHARVRKHQRKFLQAIHQLRSVKMEQRKLNDQANSLVDLAKTQNIMYDMVSDLNER 595          
BLAST of Small conductance calcium-activated potassium channel protein vs. Planmine SMEST
Match: SMESG000036688.1 (SMESG000036688.1)

HSP 1 Score: 814.298 bits (2102), Expect = 0.000e+0
Identity = 411/472 (87.08%), Postives = 414/472 (87.71%), Query Frame = 1
Query:  223 MNNIKSEDSQIPLIENSVSKYYQTYTNEVCNNEKPENPKPFHVNKREIFENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYHLELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTRNIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLLERSVKAKV 1638
            MNNIKSEDSQIPLIENSVSKYYQTYTNEVCNNEKPENPKPFHVNKREIFENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGAS                    FLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSS   +                           +Y+ CRV       YQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYHLELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTRNIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLLERSVKAKV
Sbjct:    1 MNNIKSEDSQIPLIENSVSKYYQTYTNEVCNNEKPENPKPFHVNKREIFENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASR-------------------FLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSHQSM---------------------------LYLDCRV-------YQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYHLELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTRNIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLLERSVKAKV 419          
BLAST of Small conductance calcium-activated potassium channel protein vs. Planmine SMEST
Match: SMESG000060715.1 (SMESG000060715.1)

HSP 1 Score: 423.32 bits (1087), Expect = 8.903e-143
Identity = 210/417 (50.36%), Postives = 311/417 (74.58%), Query Frame = 1
Query:  304 EVCNNEKPENPKP--FHVN---KREIFENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYHLELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTRNIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESV 1539
            +   ++ P  P+   F ++   K  + +NVG++LA RK  F KR+ ++DL L+F+  GI++M+   E +I    G +  ++   +M++KL ++ TT +LL FL+WYH I I++FM+DN ++DW LAMS+S +L + +EL+IC IHP P  +    N+  ++     LK     +++ ++  PI+V+  L MFLR ++VCRV+MLHS++YQDASAQSLGALNRIHFNF FIFKSLM++Y EYVLT +I  LF+WASWA+RACE Y  +   +FF+ MW++AITFL+VGYG++VP+S CG++I+V+TGIFG GCTALVVAVLARKLELSRAE YVHNFV+ +EL KQ+KHAA NV+KEGWLV K K+ G +  AL+H+RRLL++IR+IR+LKN++ +++DN ++++E++ +Q  + +++
Sbjct:    2 QTSTHQSPTRPRRSVFKLDPGEKMSMLKNVGARLAKRKLLFKKRKNVSDLCLIFSMFGILLMITYIELSIFLMKG-NQKSNIFSAMILKLFISFTTFMLLLFLIWYHSIDIQLFMIDNGMEDWRLAMSLSRILVIGLELLICLIHPFPGSH----NLKIVNL----LKKGSNNISISIV--PIDVLLSLPMFLRFFMVCRVLMLHSQLYQDASAQSLGALNRIHFNFAFIFKSLMSLYAEYVLTAMITFLFLWASWAIRACESYQGDNHLDFFDSMWIIAITFLTVGYGDMVPQSTCGKAISVMTGIFGVGCTALVVAVLARKLELSRAEMYVHNFVISVELSKQLKHAAANVVKEGWLVHKYKKLGWKQRALKHERRLLQAIRRIRELKNDQSKVSDNTLSMVEIYRNQVYMQKTI 407          
BLAST of Small conductance calcium-activated potassium channel protein vs. Planmine SMEST
Match: SMESG000076156.1 (SMESG000076156.1)

HSP 1 Score: 322.398 bits (825), Expect = 3.397e-100
Identity = 184/492 (37.40%), Postives = 292/492 (59.35%), Query Frame = 1
Query:  181 NYFSSRFQENKNRKMNNIKSEDSQIPLI-ENSVSKYYQTYTNEVCNNEKPENPKPFHVNKREIFENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHV---LRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYHLELRD-NFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKR-------SGTRNIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLLER 1620
            NY  S  + N N K  + K +  Q  L   N  S  Y   + ++ +                  ++VG +L  RK  + KR  I+D SL FA  GI++MV DTE   +G Y      SSI S+++K  ++++T+ILLG ++ YH + I++F  D+ I+DW +A++  +V  L +EL+ICSIHPIP ++        I   FV  K   KGV L V   L S I  +  + M LR Y++ R ++LHSR+++DA ++S+GA+N++ F+ RFI K+LM + P  VL   IL L+I  SW +R CEI     +  N  NCMW++A+TFLS+GYG+IVP + CGR IA+  G+ G+ CTAL+VAV ARKLELS+AEK+V  F+++ ++ K++K+ A NV++E WL++K  +       S  R     HQR+ L++I  +R LK ++++  DN+  L+++  +Q+ + E+V+ + +    L+N +  I+  L  L ++
Sbjct:  228 NYLQSNMESNDNSKDPSSKDKTPQTYLPNPNQKSTCYTRGSRQIASRS---------------MKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYR----KSSIYSILLKSLISISTIILLGLILAYHALVIQLFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNF-------NISQYFVTPK--FKGV-LSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGTVLLTFILTLWILLSWTMRMCEINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRT----HQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVTLHDQ 686          
BLAST of Small conductance calcium-activated potassium channel protein vs. Planmine SMEST
Match: SMESG000076156.1 (SMESG000076156.1)

HSP 1 Score: 315.079 bits (806), Expect = 1.795e-97
Identity = 183/492 (37.20%), Postives = 290/492 (58.94%), Query Frame = 1
Query:  181 NYFSSRFQENKNRKMNNIKSEDSQIPLI-ENSVSKYYQTYTNEVCNNEKPENPKPFHVNKREIFENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVTTIDSSFVELKGPLKGVTLHV---LRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYHLELRD-NFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKR-------SGTRNIALEHQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLLER 1620
            NY  S  + N N K  + K +  Q  L   N  S  Y   + ++ +                  ++VG +L  RK  + KR  I+D SL FA  GI++MV DTE   +G Y      SSI S+++K  ++++T+ILLG ++ YH +   +F  D+ I+DW +A++  +V  L +EL+ICSIHPIP ++        I   FV  K   KGV L V   L S I  +  + M LR Y++ R ++LHSR+++DA ++S+GA+N++ F+ RFI K+LM + P  VL   IL L+I  SW +R CEI     +  N  NCMW++A+TFLS+GYG+IVP + CGR IA+  G+ G+ CTAL+VAV ARKLELS+AEK+V  F+++ ++ K++K+ A NV++E WL++K  +       S  R     HQR+ L++I  +R LK ++++  DN+  L+++  +Q+ + E+V+ + +    L+N +  I+  L  L ++
Sbjct:  227 NYLQSNMESNDNSKDPSSKDKTPQTYLPNPNQKSTCYTRGSRQIASRS---------------MKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYR----KSSIYSILLKSLISISTIILLGLILAYHAL---LFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIPGNF-------NISQYFVTPK--FKGV-LSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGTVLLTFILTLWILLSWTMRMCEINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRT----HQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAKTQNNIYETVTEMRLHHSYLENRISKIEDNLVTLHDQ 682          
BLAST of Small conductance calcium-activated potassium channel protein vs. Planmine SMEST
Match: SMESG000046614.1 (SMESG000046614.1)

HSP 1 Score: 298.516 bits (763), Expect = 1.426e-91
Identity = 167/424 (39.39%), Postives = 271/424 (63.92%), Query Frame = 1
Query:  370 ENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDY---FQVNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIMLHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWA--SWALRACEIYHLELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFKNKRSGTRNIALE---HQRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLLE 1617
            +NVG +L  RK  F KR+ + D SL+FA  G+ IM+ D E ++   Y + Y  +SI S+ +K  + ++TVIL+G ++ YH + I+IF  D+SI+DW +A++   +  +  E+ ICS+ PIP  Y   ++V NV              K V L       N+V  L M LR+Y++ RV++LHS+++ DA ++S+GA+N++ FN  F+ K++M   P  VL  L+ ILFIW   SW +R CE+ + +   N FN MW++++TFLS+GYG+IVP +YCGR IA+ TG+ G+ CTALVVAV AR+LELS+AEK+V +F+ + +L KQ+K+ A NV++E WL++K  +       ++   HQR+ LR+I  +R +K ++++L DN+  L+++  +QS + E+V+ + ++   L + ++ +D  L  L E
Sbjct:  248 KNVGYRLGKRKELFEKRKRVTDYSLMFAVFGVFIMILDLELSM---YNL-YHPTSIYSITMKGLILISTVILVGLIMAYHVLEIKIFSWDDSIEDWRIAITWQRIAQMIAEVFICSVQPIPGYYTFKWRVRNVE-------------KDVNL-------NIVLSLPMLLRLYLILRVLLLHSKLFSDAGSRSIGAMNKVSFNISFVLKTVMTTNPGTVL--LVFILFIWLVFSWTMRICEVVYDDQHGNLFNSMWLISVTFLSIGYGDIVPHTYCGRGIAIATGVTGSACTALVVAVFARRLELSKAEKHVIHFMFENQLTKQLKNYAANVLRETWLIYKYTKLVKHINPMKVRVHQRKFLRAIHGMRQVKIDQRKLQDNSNTLVDLAKTQSSIYETVTEMRIEQNYLHHTLEILDQNLLKLQE 645          
The following BLAST results are available for this feature:
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNN23.986e-11339.76potassium calcium-activated channel subfamily N me... [more]
KCNN22.389e-11239.95potassium calcium-activated channel subfamily N me... [more]
KCNN31.677e-11139.67potassium calcium-activated channel subfamily N me... [more]
KCNN21.066e-11039.76potassium calcium-activated channel subfamily N me... [more]
KCNN29.024e-11039.76potassium calcium-activated channel subfamily N me... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnl-21.911e-9238.37KCNN (Potassium K ChaNNel, calcium activated)-Like... [more]
kcnl-22.728e-9238.37KCNN (Potassium K ChaNNel, calcium activated)-Like... [more]
kcnl-22.804e-9238.37KCNN (Potassium K ChaNNel, calcium activated)-Like... [more]
kcnl-23.844e-9238.37KCNN (Potassium K ChaNNel, calcium activated)-Like... [more]
kcnl-23.862e-9238.37KCNN (Potassium K ChaNNel, calcium activated)-Like... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SK8.655e-11841.76gene:FBgn0029761 transcript:FBtr0300467[more]
SK1.552e-11641.06gene:FBgn0029761 transcript:FBtr0301949[more]
SK5.488e-11643.19gene:FBgn0029761 transcript:FBtr0344555[more]
SK8.115e-11641.06gene:FBgn0029761 transcript:FBtr0301952[more]
SK1.450e-11541.94gene:FBgn0029761 transcript:FBtr0301953[more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnn33.071e-11340.81potassium intermediate/small conductance calcium-a... [more]
kcnn33.071e-11340.81potassium intermediate/small conductance calcium-a... [more]
kcnn1a6.011e-11040.29potassium intermediate/small conductance calcium-a... [more]
kcnn1b3.827e-10940.38potassium intermediate/small conductance calcium-a... [more]
kcnn21.291e-10841.10potassium calcium-activated channel subfamily N me... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNN24.703e-11239.76potassium channel, calcium activated intermediate/... [more]
KCNN24.788e-11139.76potassium channel, calcium activated intermediate/... [more]
KCNN26.774e-11139.76potassium channel, calcium activated intermediate/... [more]
wdr178.746e-11137.68WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-10... [more]
wdr171.206e-11037.68WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-10... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnn21.894e-11339.76potassium intermediate/small conductance calcium-a... [more]
Kcnn21.894e-11339.76potassium intermediate/small conductance calcium-a... [more]
Kcnn31.132e-11139.91potassium intermediate/small conductance calcium-a... [more]
Kcnn21.748e-11039.76potassium intermediate/small conductance calcium-a... [more]
Kcnn13.875e-11040.43potassium intermediate/small conductance calcium-a... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P70604|KCNN2_RAT1.752e-11239.76Small conductance calcium-activated potassium chan... [more]
sp|Q9H2S1|KCNN2_HUMAN1.914e-11239.76Small conductance calcium-activated potassium chan... [more]
sp|Q7KVW5|KCNN_DROME8.844e-11241.06Small conductance calcium-activated potassium chan... [more]
sp|P58391|KCNN3_MOUSE7.918e-11139.91Small conductance calcium-activated potassium chan... [more]
sp|Q9UGI6|KCNN3_HUMAN8.055e-11139.67Small conductance calcium-activated potassium chan... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8FZC76.152e-17154.66CaMBD domain-containing protein OS=Macrostomum lig... [more]
A0A267GF916.350e-16657.79CaMBD domain-containing protein OS=Macrostomum lig... [more]
A0A1I8ITN72.151e-15657.86CaMBD domain-containing protein OS=Macrostomum lig... [more]
A0A1I8IEB42.028e-15257.36CaMBD domain-containing protein OS=Macrostomum lig... [more]
A0A1I8J5733.581e-14452.50CaMBD domain-containing protein OS=Macrostomum lig... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
kcnn34.443e-11340.52potassium intermediate/small conductance calcium-a... [more]
kcnn25.984e-10939.76potassium calcium-activated channel subfamily N me... [more]
kcnn1b6.490e-8236.85potassium intermediate/small conductance calcium-a... [more]
kcnn43.436e-7233.18potassium calcium-activated channel subfamily N me... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000010066.11.395e-5241.41pep scaffold:Pmarinus_7.0:GL480376:18291:27660:1 g... [more]
ENSPMAT00000004465.14.705e-640.91pep scaffold:Pmarinus_7.0:GL499141:545:1291:-1 gen... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnn31.081e-11340.95small conductance calcium-activated potassium chan... [more]
kcnn35.821e-11340.95small conductance calcium-activated potassium chan... [more]
kcnn1a5.090e-10940.24small conductance calcium-activated potassium chan... [more]
kcnn21.032e-10838.64small conductance calcium-activated potassium chan... [more]
kcnn21.626e-10640.65small conductance calcium-activated potassium chan... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036688.10.000e+087.08SMESG000036688.1[more]
SMESG000060715.18.903e-14350.36SMESG000060715.1[more]
SMESG000076156.13.397e-10037.40SMESG000076156.1[more]
SMESG000076156.11.795e-9737.20SMESG000076156.1[more]
SMESG000046614.11.426e-9139.39SMESG000046614.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020450 ID=SMED30020450|Name=Small conductance calcium-activated potassium channel protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2008bp
TAATTGACAAACTGACGACTGAAAGGGAAAGAAGAAATAAAGTTTACAAA
GATGTGTCAGCACGGTTAATGTCAGCTACAGTTAAGCGAAGAAGAGTAAT
TCAAAGGTTGTCATAGCTTACTCAGTTTTTACCAGGAATATCTCAGCATG
GACATCGTTGGAGAACTGCTACAGTTTCATAATTACTTCAGTTCAAGGTT
TCAGGAAAACAAAAATAGAAAGATGAACAATATAAAATCAGAAGACTCCC
AGATACCTCTCATTGAGAATTCTGTATCAAAGTACTACCAGACGTATACG
AATGAAGTATGTAATAACGAAAAACCTGAAAATCCCAAGCCATTTCATGT
CAACAAAAGAGAAATATTCGAAAATGTCGGATCGAAATTAGCTTACAGGA
AAAGTCGTTTTTATAAGAGGAGATTGATAGCAGATTTGTCTTTAGTTTTT
GCTGCACTTGGAATAATTATTATGGTGGCAGATACCGAATTTGCCATTTC
AGGCAAATATGGAATTGACTATGGCGCCAGTAGTATAATATCAATGATGG
TTAAATTGTCCGTAACATTAACGACTGTCATTCTTTTAGGATTCCTTGTT
TGGTATCATAAAATTTGCATCGAAATATTTATGTTGGACAACAGTATTGA
CGATTGGCATCTTGCAATGTCAGTGTCAACTGTGCTAGGTCTCGCCATTG
AATTGATTATTTGCTCCATTCATCCAATTCCTGTCGATTACTTCCAGGTT
AATAATGTCACTACAATCGATAGTAGTTTTGTTGAATTAAAAGGTCCATT
AAAGGGTGTGACTCTTCATGTCTTGAGGTCACCAATCAATGTTGTATTTG
GACTGGTAATGTTTTTGAGGGTGTATATTGTATGTCGAGTTATAATGCTT
CATAGCCGAGTTTATCAAGACGCATCTGCCCAATCTCTTGGCGCTCTAAA
TCGCATTCATTTCAATTTTAGATTTATTTTCAAATCTCTTATGAATGTGT
ACCCGGAATATGTTTTGACTTTGCTCATACTTATTCTTTTCATTTGGGCG
AGTTGGGCACTGAGAGCATGTGAAATTTATCATCTAGAATTACGAGATAA
CTTTTTTAACTGTATGTGGGTAGTTGCTATTACTTTTCTCAGTGTTGGTT
ATGGAGAGATCGTTCCCGAGTCATATTGTGGCAGGAGCATTGCAGTTCTT
ACCGGAATATTTGGAGCTGGGTGTACTGCTTTGGTGGTAGCAGTTCTGGC
CCGCAAATTGGAATTATCTCGAGCCGAAAAATATGTTCATAATTTTGTGA
TGGATATTGAGTTAGACAAGCAAATGAAACATGCTGCTATTAACGTCATC
AAAGAAGGATGGCTGGTGTTCAAAAACAAGCGATCAGGAACACGGAATAT
AGCATTAGAACATCAGCGACGTTTATTACGAAGTATCCGAAAAATAAGAG
ACTTAAAAAATGAAAGGAAACGTTTAGCAGATAATGCGGTAAATCTATTA
GAGGTCCATCATTCTCAGAGTTGCTTGTCAGAATCAGTGTCTGTCCTAAA
TGTAAAAATTGGTGCATTAGATAATGCCATGCAAAGCATCGATTCAAAGT
TAGAATTGCTCCTAGAACGCAGCGTAAAAGCAAAAGTCTAACAATCAAAA
TTTGTCAATAGTCTTCAATGATTTATTTTTTATATTGTCCGTTGACGTGT
CATGATTTGTCCATATCGCCCGTTGCGCAATCGCGTTAGCAGCTATTGTT
CCGTGATCGTATTCGCCATGTGTATTTATGATGATAAATTGTGTTCATTA
AACGTTTTGGTGATTCCCGTTTGTGTTTATAAAGTGCGTTTGTGCGTGAC
TTGTTTCTGTGATCATATTTTCACTTAATTCAGATCAGTTTTTAATTTAT
TTTATCACGGACATCGTGGTCAATTGTTTTCATTAAAATTGTTCATTATG
TTGTTAATTGTTGGCGATTATTATTATTATTTATAATATTATTAACACAT
TGTAATCG
back to top

protein sequence of SMED30020450-orf-1

>SMED30020450-orf-1 ID=SMED30020450-orf-1|Name=SMED30020450-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=498bp
MDIVGELLQFHNYFSSRFQENKNRKMNNIKSEDSQIPLIENSVSKYYQTY
TNEVCNNEKPENPKPFHVNKREIFENVGSKLAYRKSRFYKRRLIADLSLV
FAALGIIIMVADTEFAISGKYGIDYGASSIISMMVKLSVTLTTVILLGFL
VWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQ
VNNVTTIDSSFVELKGPLKGVTLHVLRSPINVVFGLVMFLRVYIVCRVIM
LHSRVYQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIW
ASWALRACEIYHLELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAV
LTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINV
IKEGWLVFKNKRSGTRNIALEHQRRLLRSIRKIRDLKNERKRLADNAVNL
LEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKLELLLERSVKAKV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036122CaM-bd_dom_sf
IPR004178CaM-bd_dom
IPR015449K_chnl_Ca-activ_SK
IPR013099K_chnl_dom
Vocabulary: molecular function
TermDefinition
GO:0015269calcium-activated potassium channel activity
GO:0005516calmodulin binding
GO:0016286small conductance calcium-activated potassium channel activity
GO:0005249voltage-gated potassium channel activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0008076voltage-gated potassium channel complex
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0071805potassium ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 419..453
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 274..371
e-value: 1.3E-13
score: 52.6
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 372..462
e-value: 1.9E-26
score: 94.0
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 240..408
NoneNo IPR availableTMHMMTMhelixcoord: 130..152
NoneNo IPR availableTMHMMTMhelixcoord: 283..305
NoneNo IPR availableTMHMMTMhelixcoord: 223..245
NoneNo IPR availableTMHMMTMhelixcoord: 346..368
NoneNo IPR availableTMHMMTMhelixcoord: 320..339
NoneNo IPR availableTMHMMTMhelixcoord: 172..194
NoneNo IPR availableTMHMMTMhelixcoord: 93..115
IPR004178Calmodulin-binding domainSMARTSM01053CaMBD_2coord: 386..459
e-value: 1.4E-11
score: 54.5
IPR004178Calmodulin-binding domainPFAMPF02888CaMBDcoord: 386..455
e-value: 3.6E-15
score: 55.9
IPR015449Potassium channel, calcium-activated, SKPFAMPF03530SK_channelcoord: 81..197
e-value: 1.7E-32
score: 111.8
IPR015449Potassium channel, calcium-activated, SKPANTHERPTHR10153SMALL CONDUCTANCE CALCIUM-ACTIVATED POTASSIUM CHANNELcoord: 74..490
IPR013099Potassium channel domainPFAMPF07885Ion_trans_2coord: 294..371
e-value: 2.2E-13
score: 50.0
IPR036122SK, calmodulin-binding domain superfamilySUPERFAMILYSSF81327Small-conductance potassium channelcoord: 369..454