low-density lipoprotein receptor-related protein 2

Overview
Namelow-density lipoprotein receptor-related protein 2
Smed IDSMED30020449
Length (bp)2153
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of low-density lipoprotein receptor-related protein 2 (SMED30020449) t-SNE clustered cells

Violin plots show distribution of expression levels for low-density lipoprotein receptor-related protein 2 (SMED30020449) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of low-density lipoprotein receptor-related protein 2 (SMED30020449) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for low-density lipoprotein receptor-related protein 2 (SMED30020449) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020449

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30020449SMESG000062507.1 dd_Smed_v4_1510_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020449SMESG000062507.1 dd_Smed_v4_1510_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020449SMESG000062507.1 dd_Smed_v6_1510_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020449SMESG000062507.1 dd_Smed_v4_1510_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Human
Match: VLDLR (very low density lipoprotein receptor [Source:HGNC Symbol;Acc:HGNC:12698])

HSP 1 Score: 196.823 bits (499), Expect = 2.174e-52
Identity = 142/492 (28.86%), Postives = 223/492 (45.33%), Query Frame = 1
Query:  100 HFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTE--HDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDL-----YLSSISNK--QNIEM--NLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLS-QLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            H KC   +  CG     +CI K W CD + DC D SDEVNCP   C  +QF+C D   CI   + C+G+ DC++  DE NC N+N C     + C   +  ECI I  +CN   +C    D  L+ C  + C  +   CSHIC +    + CDC    EL  D + C  I++C +NP +C Q C +    Y C C  GY        C    +E  +                          IF  + DI    + L R E +     +     L            DL     + +SI +K  ++++M  N+ N +A   A+D     +++TD    +I V  L    +  + + D   P +I +DP+ G ++W D G      KI+ A M+G  +  L+  +I+ P  + +D+ + RLYW D     +  +D+N    ++ +K+   LA    HP ++ IF +R+YW D +   +Y A+K TG ++  +
Sbjct:  236 HTKCPASEIQCGSG---ECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGS-CIHGSRQCNGIRDCVDGSDEVNCKNVNQCLGPGKFKC---RSGECIDISKVCNQEQDCRDWSDEPLKECHINECLVNNGGCSHICKDLVIGYECDCAAGFELI-DRKTCGDIDEC-QNPGICSQICINLKGGYKCECSRGYQMDLATGVCKAVGKEPSL--------------------------IFTNRRDIRK--IGLERKEYIQLVEQLRNTVALDADIAAQKLFWADLSQKAIFSASIDDKVGRHVKMIDNVYNPAAI--AVDWVYKTIYWTDAASKTISVATLDGTKRKFLFNSDLREPASIAVDPLSGFVYWSDWGEP---AKIEKAGMNGFDRRPLVTADIQWPNGITLDLIKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLA----HPLALTIFEDRVYWIDGENEAVYGANKFTGSELATL 681          

HSP 2 Score: 62.3882 bits (150), Expect = 2.759e-9
Identity = 50/154 (32.47%), Postives = 75/154 (48.70%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKT----HYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNC 597
            +CI+ LW CD ++DC D SDE NC    C ++ F C ++  C+P    CDG  DC +  DE    +   C+ +T      +CG     +CI +   C+   +C + +D  ENC    C   E TCS   CI++  +F C+   D     D  +C
Sbjct:   44 RCITLLWKCDGDEDCVDGSDEKNCVKKTCAESDFVC-NNGQCVPSRWKCDGDPDCEDGSDE----SPEQCHMRTCRIHEISCG-AHSTQCIPVSWRCDGENDCDSGEDE-ENCGNITCSPDEFTCSSGRCISR--NFVCNGQDDCSDGSDELDC 188          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Human
Match: VLDLR (very low density lipoprotein receptor [Source:HGNC Symbol;Acc:HGNC:12698])

HSP 1 Score: 196.052 bits (497), Expect = 3.026e-52
Identity = 142/492 (28.86%), Postives = 223/492 (45.33%), Query Frame = 1
Query:  100 HFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTE--HDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDL-----YLSSISNK--QNIEM--NLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLS-QLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            H KC   +  CG     +CI K W CD + DC D SDEVNCP   C  +QF+C D   CI   + C+G+ DC++  DE NC N+N C     + C   +  ECI I  +CN   +C    D  L+ C  + C  +   CSHIC +    + CDC    EL  D + C  I++C +NP +C Q C +    Y C C  GY        C    +E  +                          IF  + DI    + L R E +     +     L            DL     + +SI +K  ++++M  N+ N +A   A+D     +++TD    +I V  L    +  + + D   P +I +DP+ G ++W D G      KI+ A M+G  +  L+  +I+ P  + +D+ + RLYW D     +  +D+N    ++ +K+   LA    HP ++ IF +R+YW D +   +Y A+K TG ++  +
Sbjct:  236 HTKCPASEIQCGSG---ECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGS-CIHGSRQCNGIRDCVDGSDEVNCKNVNQCLGPGKFKC---RSGECIDISKVCNQEQDCRDWSDEPLKECHINECLVNNGGCSHICKDLVIGYECDCAAGFELI-DRKTCGDIDEC-QNPGICSQICINLKGGYKCECSRGYQMDLATGVCKAVGKEPSL--------------------------IFTNRRDIRK--IGLERKEYIQLVEQLRNTVALDADIAAQKLFWADLSQKAIFSASIDDKVGRHVKMIDNVYNPAAI--AVDWVYKTIYWTDAASKTISVATLDGTKRKFLFNSDLREPASIAVDPLSGFVYWSDWGEP---AKIEKAGMNGFDRRPLVTADIQWPNGITLDLIKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLA----HPLALTIFEDRVYWIDGENEAVYGANKFTGSELATL 681          

HSP 2 Score: 62.003 bits (149), Expect = 3.373e-9
Identity = 50/154 (32.47%), Postives = 75/154 (48.70%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKT----HYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNC 597
            +CI+ LW CD ++DC D SDE NC    C ++ F C ++  C+P    CDG  DC +  DE    +   C+ +T      +CG     +CI +   C+   +C + +D  ENC    C   E TCS   CI++  +F C+   D     D  +C
Sbjct:   44 RCITLLWKCDGDEDCVDGSDEKNCVKKTCAESDFVC-NNGQCVPSRWKCDGDPDCEDGSDE----SPEQCHMRTCRIHEISCG-AHSTQCIPVSWRCDGENDCDSGEDE-ENCGNITCSPDEFTCSSGRCISR--NFVCNGQDDCSDGSDELDC 188          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Human
Match: LDLR (low density lipoprotein receptor [Source:HGNC Symbol;Acc:HGNC:6547])

HSP 1 Score: 189.504 bits (480), Expect = 1.233e-50
Identity = 153/613 (24.96%), Postives = 264/613 (43.07%), Query Frame = 1
Query:  109 CLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLD------VNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFST---------------ALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI-DKRVKPINLRII-----SKESNRQLIKKINEHKIGKYCSGVINTCRGSCLPNHDMPEMPKCF-GIPRIE-----------------EKIRSKNQSLWLILIPVVILGFVCIVLF 1809
            C   D  CG     +CI + W CD   DCD+ SDE  CP   C  ++F+C D + CI   + CD   DC +  DE  C N+  C     + C +    ECI ++ +CN   +C    D  ++ C  + C  +   CSH+C +    + C CP   +L    R C+ I++C ++P+ C Q C +    Y C C +G+                                 L+PH KA +       +F  +      + L+R+E   Y+SL+   N+  V  L     +  +Y S +S +      L      S+               A+D   + +++TD    ++ V +     +  +  ++   P  IV+DPV G ++W D G      KIK   ++G   Y+L+ + I+ P  + +D+   RLYW D    +I  ID+N     N KT         HPFS+ +F ++++W+D+    I+SA+++TG DV ++ +  + P ++ +       +E+   +  +       K  S  + T   +  P  D   +P    G+  +E                 EK  S  ++L ++L P+V+L F+C+ +F
Sbjct:   68 CKSGDFSCG-GRVNRCIPQFWRCDGQVDCDNGSDEQGCPVATCRPDEFQCSDGN-CIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSG---ECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVA-QRRCEDIDEC-QDPDTCSQLCVNLEGGYKCQCEEGF--------------------------------QLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSE---YTSLI--PNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTP---AKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGG---NRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPREAEAAVATQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAGRGNEKKPSSVRALSIVL-PIVLLVFLCLGVF 629          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Human
Match: LRP4 (LDL receptor related protein 4 [Source:HGNC Symbol;Acc:HGNC:6696])

HSP 1 Score: 180.259 bits (456), Expect = 2.241e-46
Identity = 130/484 (26.86%), Postives = 221/484 (45.66%), Query Frame = 1
Query:  154 CISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCN-EKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS--LENCKA----DFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQ-DDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIE--MNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVK-PINLRII 1572
            CI+  W CD + DCDD SDE NC   +C   QF+C  S  C+     CDG +DC +N DE NC N  S       + C N +   CI    +CN   +C  N D    +NC+     + C  +   C+  C     +  C C     L+ED   C+ +N+C +    C QGC ++  ++ C+C  GY     +  P     +             + I  + PH     +     ++  +LD + +R E+VF+S +                  +D  L +  N  N+E  ++    S    A+D   + L++TD   S I V NL    +  ++ ++   P  I + P+ G ++W D GN    P+I+ ++MDGS +  + +  +  P  L ID   +R+YW D     I+  +++   +      +V++    HPF+I +F + +YW+D     I SA+K TGK+ ++I  ++  P+++  +
Sbjct:  243 CINAGWRCDGDADCDDQSDERNCTTSMCTAEQFRC-HSGRCVRLSWRCDGEDDCADNSDEENCENTGSPQCALDQFLCWNGR---CIGQRKLCNGVNDCGDNSDESPQQNCRPRTGEENCNVNNGGCAQKCQMVRGAVQCTCHTGYRLTEDGHTCQDVNECAEE-GYCSQGCTNSEGAFQCWCETGY-----ELRPDRRSCKALGPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFH-HRRELVFWSDVT-----------------LDRILRANLNGSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANLDGAHRKVLLWQNLEKPRAIALHPMEGTIYWTDWGNT---PRIEASSMDGSGRRIIADTHLFWPNGLTIDYAGRRMYWVDAKHHVIERANLDGSHRK-----AVISQGLPHPFAITVFEDSLYWTDWHTKSINSANKFTGKNQEIIRNKLHFPMDIHTL 690          

HSP 2 Score: 106.686 bits (265), Expect = 7.517e-23
Identity = 56/192 (29.17%), Postives = 95/192 (49.48%), Query Frame = 1
Query:  976 SNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVK 1551
               Q + ++    S    A+D   N L++TD     I V N     +  ++ ++   P +IV++P+ G ++W D G     PKI+ A MD S +  ++   +  P  LAID   QRLYW D   + +K I+   L     K    +  +  HPF + ++G RIYW+D +   I SA ++TG D + + + ++
Sbjct:  804 GTGQEVVVDTSLESPAGLAIDWVTNKLYWTDAGTDRIEVANTDGSMRTVLIWENLDRPRDIVVEPMGGYMYWTDWGAS---PKIERAGMDASGRQVIISSNLTWPNGLAIDYGSQRLYWAD---AGMKTIEFAGLDGSKRKVL--IGSQLPHPFGLTLYGERIYWTDWQTKSIQSADRLTGLDRETLQENLE 987          

HSP 3 Score: 88.1965 bits (217), Expect = 3.256e-17
Identity = 87/368 (23.64%), Postives = 150/368 (40.76%), Query Frame = 1
Query:  490 CKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVKPINLRIISKESNRQ 1593
            C +    CSH+C+ + S F+C CP  ++L  D +       C  +PE           +Y  F   G     +  + T++  ++                    H    E+    +++ SLD + + +  V+Y+     D  L V +        DL  S++     I   LK       A+D     L++TD   ++I    L    +  +++     P  I + P  G LFW D G+     KI+ AN+DGS +  L+  ++  P  L +D + +R+YW D     I+  D+N       K   VL     HPF++      IYW+D +   I    K +G++ + +   V+ + + II     RQ
Sbjct: 1313 CGSRNGGCSHLCLPRPSGFSCACPTGIQLKGDGKT------CDPSPE-----------TYLLFSSRGSIR--RISLDTSDHTDV--------------------HVPVPEL----NNVISLDYD-SVDGKVYYT-----DVFLDVIR------RADLNGSNMETV--IGRGLKTTDGL--AVDWVARNLYWTDTGRNTIEASRLDGSCRKVLINNSLDEPRAIAVFPRKGYLFWTDWGHI---AKIERANLDGSERKVLINTDLGWPNGLTLDYDTRRIYWVDAHLDRIESADLNG------KLRQVLVSHVSHPFALTQQDRWIYWTDWQTKSIQRVDKYSGRNKETVLANVEGL-MDIIVVSPQRQ 1611          

HSP 4 Score: 78.1814 bits (191), Expect = 4.084e-14
Identity = 47/169 (27.81%), Postives = 81/169 (47.93%), Query Frame = 1
Query: 1030 ALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            A+D     +++TD   + I V NL    +  +V ++   P  IV+   MG ++W D G EN   K++ + MDGS +  L+   +  P  L +D    +L W D     I+  D+N  ++        L     HP+ + +  + IYW+D +   I+ A K TG +V ++
Sbjct: 1130 AVDAIGRKVYWTDTGTNRIEVGNLDGSMRKVLVWQNLDSPRAIVLYHEMGFMYWTDWG-EN--AKLERSGMDGSDRAVLINNNLGWPNGLTVDKASSQLLWADAHTERIEAADLNGANR------HTLVSPVQHPYGLTLLDSYIYWTDWQTRSIHRADKGTGSNVILV 1289          

HSP 5 Score: 68.5514 bits (166), Expect = 4.002e-11
Identity = 64/234 (27.35%), Postives = 93/234 (39.74%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADF--------------------------------------------CKTSENTC-SHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQG--------------CQDNGKSYNC 675
            +CI + WVCD + DC+D+SDE +CPP  C++++F C +   CI     CDG NDC +N DE  C ++  C++K  + C +     CI     C+ + +C    D  ENC +                                              C++ E  C S +CIN  + + CD   D +   D RNC   + C      CH G              C DN    NC
Sbjct:   82 KCIRRSWVCDGDNDCEDDSDEQDCPPRECEEDEFPCQNG-YCIRSLWHCDGDNDCGDNSDE-QC-DMRKCSDK-EFRCSDGS---CIAEHWYCDGDTDCKDGSDE-ENCPSAVPAPPCNLEEFQCAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMCDSGLCIN--AGWRCDGDADCDDQSDERNCT-TSMCTAEQFRCHSGRCVRLSWRCDGEDDCADNSDEENC 304          

HSP 6 Score: 62.3882 bits (150), Expect = 3.232e-9
Identity = 55/166 (33.13%), Postives = 74/166 (44.58%), Query Frame = 1
Query:  130 CGKNSFF---------QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCS-HICINKYSSFTCDCPPDMELSEDNRNC 597
            CG++ F           CI   W CD + DC D+SDE  C    C    F C D+  CI R  +CDG NDC ++ DE +C     C E+  + C N     CI+    C+ + +C  N D  E C    C   E  CS   CI ++  + CD   D +   D  NC
Sbjct:   27 CGRSHFTCAVSALGECTCIPAQWQCDGDNDCGDHSDEDGCILPTCSPLDFHC-DNGKCIRRSWVCDGDNDCEDDSDEQDCPP-REC-EEDEFPCQNGY---CIRSLWHCDGDNDCGDNSD--EQCDMRKCSDKEFRCSDGSCIAEH--WYCDGDTDCKDGSDEENC 182          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Human
Match: LDLR (low density lipoprotein receptor [Source:HGNC Symbol;Acc:HGNC:6547])

HSP 1 Score: 176.407 bits (446), Expect = 1.253e-45
Identity = 128/484 (26.45%), Postives = 214/484 (44.21%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLD------VNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFST---------------ALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            +CI   W CD   DC D SDE NC    C  ++F+C D + CI   + CD   DC +  DE  C N+  C     + C +    ECI ++ +CN   +C    D  ++ C  + C  +   CSH+C +    + C CP   +L    R C+ I++C ++P+ C Q C +    Y C C +G+                                 L+PH KA +       +F  +      + L+R+E   Y+SL+   N+  V  L     +  +Y S +S +      L      S+               A+D   + +++TD    ++ V +     +  +  ++   P  IV+DPV G ++W D G      KIK   ++G   Y+L+ + I+ P  + +D+   RLYW D    +I  ID+N     N KT         HPFS+ +F ++++W+D+    I+SA+++TG DV ++
Sbjct:  167 ECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGN-CIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSG---ECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVA-QRRCEDIDEC-QDPDTCSQLCVNLEGGYKCQCEEGF--------------------------------QLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSE---YTSLI--PNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTP---AKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGG---NRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLL 601          

HSP 2 Score: 65.0846 bits (157), Expect = 3.406e-10
Identity = 57/188 (30.32%), Postives = 87/188 (46.28%), Query Frame = 1
Query:  130 CGKNSF----FQCISKLWVCDYNQDCDDNSDEV--NCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSL-ENCKADF--------CKTSENTC-SHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQG 645
            C +N F     +CIS  WVCD + +C D SDE    C P  C +++F+C D   CI R+ +CD   DC++  DE +C  + +C   + + C ++    CI     C+ + +C    D   + C+  +        C   E  C S  CI  +SS+ CD  PD +   D  NC  +  C  +   C  G
Sbjct:   27 CERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCSPKTCSQDEFRCHDGK-CISRQFVCDSDRDCLDGSDEASCP-VLTCGPAS-FQCNSST---CIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECI--HSSWRCDGGPDCKDKSDEENCA-VATCRPDEFQCSDG 205          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Celegans
Match: lrp-1 (Low-density lipoprotein receptor-related protein [Source:UniProtKB/Swiss-Prot;Acc:Q04833])

HSP 1 Score: 150.214 bits (378), Expect = 5.299e-37
Identity = 139/517 (26.89%), Postives = 220/517 (42.55%), Query Frame = 1
Query:  109 CLQDDHYCGKNSFF----QCISKLWVCDYNQDCDDNSDE-VNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTK----KLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENT-CSHICINKYSSFTCDCPPDMELS-EDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGY--TEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHY---------KAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTS-FDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQ-----YTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVK-PINLRII 1572
            C  +   C K  F      CI   W CD + DC D SDE  NC    C  + F+C +   C+P    CDG +DC +  DE +C   NS + +    C N +      ECI    +C+ N +C+   D    C  D C  +E   C   C++    + CDC     +   D ++C ++N+C++    C Q C D   SY C C DGY  +  D  C  T  E E                   N HY         K +   +G D++ SLD++L             K  ++   KL+   +++D   S +S+ + + +          A+D     L+  +  + SI V  L   F K  I D+    P  IV+ P  G LF+ +   +   P I    +DGS +     + L E ++  P  +AID    RL+W D   + I ++D +   + +I      A    H  S+ +F + +YW+D    ++    K TGK+  ++ K V+ P +LRI+
Sbjct: 3093 CKTEKKECNKGEFRCSNQHCIHSTWECDGDNDCLDGSDEHANCTYSSCQPDFFQCANHK-CVPNSWKCDGNDDCEDGSDEKDCPK-NSASAQKASKCSNGQFQCTSGECIDDAKVCDRNFDCTDRSDESSLCFIDECSLAEKPLCEQKCMDMKIGYKCDCFEGFAIDISDQKSCHNVNECYEGISGCSQKCDDKIGSYKCGCVDGYQLSSDDHSCKRTEMEPE-------------PFFLLANKHYIRKISIDGNKYELAAQGFDNVVSLDIDLTEK----------KAYLIDQGKLRLLRVDLDEMDSPLSSYETV-LRHNVYGTEGIAVDWVGRKLYMLNRQERSIRVCELDGRFCKTLIRDR-IQQPKAIVVHPGKGYLFFTEWSLQ---PYIGRIALDGSPELQDPIFKLAEHDLGWPNAIAIDYFSDRLFWGDAHLNEIGFMDFDGNGRRHIP-----AQRTSHVSSMVVFDDYLYWADWNLREVLRCDKWTGKNETILKKTVQLPNDLRIV 3574          

HSP 2 Score: 126.716 bits (317), Expect = 1.677e-29
Identity = 124/478 (25.94%), Postives = 198/478 (41.42%), Query Frame = 1
Query:  154 CISKLWVCDYNQDCDDNSDE--VNCPP-MICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWN------CTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHK-DN------VLQVSKLQNW-PLNVDLYLSSISNKQNIEMNLKNLSAF-----------STALDPARNLLFFTDYNDSSIYVMNLTS-FDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYF--HPFSIFIFGNRIYWSDLKEHKI 1494
            CI   W CD  QDCDD SDE    C     C  +QFKC +   CI    LCDG NDC +  DE +        N   C  + H  C N ++  CI +  +C+   +C    D    C  D C      CS  C N  +   C CP   +L    + C+  N+C  +   C Q C+D    + C C +GY            E +++                       K   +  D++    + ++    ++YS   HK DN      +++ +    W  L   +Y S I  K+ +  N    +A              ALD     L++ D + ++I V NL     +  +V ++   P  I +DP  G +FW D G     P I+ A+MDG+ +  +++ +I  P  +A+D    R+Y+ D     I +++ +   +       VLA   F  HP ++ IF + +Y+SD +  K+
Sbjct: 1283 CIPASWKCDGQQDCDDGSDEPKFGCTSGRQCSSDQFKCGNG-RCILNNWLCDGENDCGDGSDESSERGCKTSMNARKCPFE-HVACENDQET-CIPLHQLCDGKTHCPGGTDEGGRCARDLCSADRAGCSFKCHNSPNGPICSCPFGEQLVNKTK-CEPENECL-DSSSCSQRCKDEKHGFTCSCDEGY------------ELDVD-----------------------KRTCKVADNVKDTRIYVSNRNRIYYSD--HKLDNWHTFGAIVENAIALAWDSLTDRIYWSDIREKKILSANRNGTNATVFIADGLDITEGIALDWVGRNLYWVDSSLNTIEVANLEDPKQRTLLVHQNVSQPRGIAVDPRKGVMFWTDWGQN---PCIERASMDGTDRQIIVKTKIYWPNTIALDYTTDRVYFADSKLDFIDFVNYDGSGRTQ-----VLASSKFVQHPHALAIFEDMMYYSDRRLQKL 1710          

HSP 3 Score: 99.3673 bits (246), Expect = 5.952e-21
Identity = 112/500 (22.40%), Postives = 187/500 (37.40%), Query Frame = 1
Query:   97 CHFK-CLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTN--------INSCNEKTHYN---CGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSE-NTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHK------DNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYF-HPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            C FK C  ++  C KN   +C  + + CDY  DC DNSDE  C    C   ++ CP +  CI + KLCDG  DC +  DE  C+            C+   H     C +  KL+                  D      +D  + +E   C  +C N    FTC C               +  CF   ++ H   +DN          GY      CV     N   +            +   NP  + K++  G+  I+ +D +    ++ +   L H       D+  ++S+++   L   +Y   +                  A+D   N L+  +     I V +     +  ++      P +I +DP+ G +F+       N  K++ A MDG+ + TL+     +   + +DI  +R+YW D     ++ ID     Q N +      +    HPF + +F   +YW+D     +    K  G D K++
Sbjct:  218 CEFKKCTANEFQC-KNK--RCQPRKFRCDYYDDCGDNSDEDECGEYRCPPGKWNCPGTGHCIDQLKLCDGSKDCADGADEQQCSQNLCPSLGCQAGCHPSPHGGECTCPSGYKLD------------------DRFHRTCSDINECAEFGYCDQLCANHRPGFTCSC---------------LGDCF-TLQMEHGPGKDN------LTMRGY------CV---SNNADKMKLFVARREGLYRLNPKNPDEEVKKLASGE-FIYGIDFDYGDRKIFWTDRLAHSAFSADVDDEGEISQIKKLSLKSLVYPRCL------------------AVDWITNTLYIIESGSRRIDVSSYDGERRTVLLADGLTLPLDIALDPLRGEMFFT------NQLKLEAAAMDGTNRRTLVNTHTHQVSGIVVDITAKRVYWVDPKVDRLESIDY----QGNDRRIVAQGMNVVPHPFGLALFDQYLYWTDWTRLGVIQVEKF-GSDTKLL 635          

HSP 4 Score: 95.5153 bits (236), Expect = 7.700e-20
Identity = 136/584 (23.29%), Postives = 226/584 (38.70%), Query Frame = 1
Query:  154 CISKLWVCDYNQDCDDNSDEVN--CPPMICDKN-QFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYN--------CGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTS------ENTCSHICINKYSSFTCDCP----PDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEH-------DQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVN--------LNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDL-YLSSISNKQNIEMNLKNL--SAFS----TALDPARNLLF---FTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAID-IEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKIT-------------GKDVKVIDKRVKPINLRIISKESNRQLIKKINEHKIGKYC---SGVINTCRGSCLPNH----DMPEMPKC 1704
            CI + ++CD + DC DNSDE +  C    CD   +F+C  S LC+   +LC+G NDC  N+  ++  +++ C+  + Y         C N K   C+     C+   +C    D +  C     KTS         C HIC +    F C C     PD    +  + C  I++C  N   C Q C +   SY C C++ Y  +        + C    +   + +         S+     N H  AK      +DI  +  +        ++ +E   Y S +   N       +   L+VD   +  +     ++    NL  +A S      L  AR         + N   I+V         KIV      P  ++  P  GR+ + D G      KI+ A+MDG+ +  +++  +  P  +AID  +  R+YW D      KY  +++++    +  +V+   +  P+++ +F N IYW   +   +Y   K               G  V+V  K  K     +   E  +     ++    G  C    G++    GSC   H     MP+  KC
Sbjct: 3971 CIPRKFMCDGDNDCGDNSDETSSECRSAQCDPPLRFRCAHSRLCLNILQLCNGFNDCGPND--FSDEHLSMCSSFSEYGDCSSDQFKCANGK---CVNGTVACDRKDDCGDASDEI-GCSKHGGKTSCEAFGNNGGCKHICTDVRDGFYCHCRDGFRPD---PQSPKECIDIDECAGN-NTCTQLCLNTKGSYLCRCHEDYENNVVVGSMTGKDCRAKGDAANVMIGADDSLVQLSLHGSGTNRHAAAK-ANDDDNDIIGIAFDPRKELMYWIDGSERTIYRSAIANGN----QSHEGQKLDVDFAAMGVVPTAIAVDYTTGNLFIAAVSENIENGLVTARKKRMSEPIDNQNTGFIFVCLPDGRYLKKIVAGHLQQPTALITAPSAGRICYSDAGLH---AKIECADMDGTHRQIIVKDLVFSPTSMAIDEGKGNRIYWVDP-----KYRRVDAVNIDGSERTTVVHDRHI-PYAVDVFENHIYWLSRESKTLYVQDKFGRGRVSVLASDLEDGHTVRVSQKYAKDTQRTVSGCERAQCSHLCVSLPSTGFACLCPDGIVPQLDGSCATQHVEALTMPKQCKC 4530          

HSP 5 Score: 80.1073 bits (196), Expect = 4.274e-15
Identity = 116/536 (21.64%), Postives = 208/536 (38.81%), Query Frame = 1
Query:  106 KCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPM---ICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCT-NINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTN---KDSLENCKA----DFCKTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNC-KHINK----CFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIY---VMNLTSFDKIKIVDKD----CYFPFNIVIDPVMGRLFWIDLGN--ENNGPKIKMANM-----------------DGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTD-HFPSAIKYIDINSL-SQLNIKTFSVLAIEYFHPFSIFI---FGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVKPINLRI 1569
            +CL     C   +   CI++   CD  +DC + +DE++C  +    C   +F+C +S +CIPR+ +CDG NDC +N DE +       C+    + C +++   C+ I  +CN   +C  N    + L  C +      C + +  C++  C+N   +  CD   D   + D   C KH  K     F N   C   C D    + C C DG+    Q      + +E            + +   L  + K   + R  +D    + N+    M         D    +    +  + + L+ S  +     + N  +      A DP + L+++ D ++ +IY   + N     + + +D D       P  I +D   G LF   +    EN     +   M                 DG +   ++   +++P  L       R+ ++D    + I+  D++    Q+ +K         F P S+ I    GNRIYW D K  ++ + +    +   V+  R  P  + +
Sbjct: 3916 RCLPGHRQCDDGT---CIAEHKWCDRKKDCPNAADELHCEDVSRRTCSPFEFECANS-VCIPRKFMCDGDNDCGDNSDETSSECRSAQCDPPLRFRCAHSRL--CLNILQLCNGFNDCGPNDFSDEHLSMCSSFSEYGDCSSDQFKCANGKCVN--GTVACDRKDDCGDASDEIGCSKHGGKTSCEAFGNNGGCKHICTDVRDGFYCHCRDGFRPDPQSPKECIDIDEC---------AGNNTCTQLCLNTKGSYLCRCHED---YENNVVVGSMTGKDCRAKGDAANVMIGADDSLVQLSLHGSGTNRHAAAKANDDDNDIIGIAFDPRKELMYWIDGSERTIYRSAIANGNQSHEGQKLDVDFAAMGVVPTAIAVDYTTGNLFIAAVSENIENGLVTARKKRMSEPIDNQNTGFIFVCLPDGRYLKKIVAGHLQQPTALITAPSAGRICYSDAGLHAKIECADMDGTHRQIIVKDL------VFSPTSMAIDEGKGNRIYWVDPKYRRVDAVNIDGSERTTVVHDRHIPYAVDV 4425          

HSP 6 Score: 74.3294 bits (181), Expect = 2.813e-13
Identity = 60/254 (23.62%), Postives = 112/254 (44.09%), Query Frame = 1
Query:  841 IFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNG----PKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVK-VIDKRVKPINLRIISKESN 1587
             F +DVNL R   V  S +    +   ++  +N  L         ++KQ     ++++S     LD     ++FT      +  ++        I   D  + + + IDP  G LFW D G + +G    P+I+ +N+ G  +  ++ + I  P  +A+D   Q++YW D     I+  D +  ++       V+A  Y    S+ I+   +Y SD   + ++   K +G  ++ V+  R  P  LR+ + ES+
Sbjct: 2480 TFDVDVNLRRVYFVVESPVGVNISWFSMNNAENPRLVFG------ASKQPHAKEIRHISDMK--LDWLTQKIYFTTGRGGKVMAIDTAGEHLSTIASGD--WTYALAIDPCSGLLFWSDSGYKTSGGLYEPRIERSNLAGGSRKVIVSESISLPAAIAVDFRNQKIYWADVNRLNIEVADYDGQNR------KVIASGY-RAKSLDIWDRWLYMSDPLSNGVFRIDKESGSGLENVVSDRRIPGALRVFASESD 2716          

HSP 7 Score: 62.7734 bits (151), Expect = 9.069e-10
Identity = 40/182 (21.98%), Postives = 82/182 (45.05%), Query Frame = 1
Query:  964 LSSISNKQNIEMNLKNLSAFSTALDPARNLLFFT--DYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSA 1503
            +   S +  I  ++ +L+  S A+D     ++F   D   ++I V  L    +  ++      P +I +DPV   L+W D G +   P I+ + +DGS +  ++   I +P  L +D+  + +YW+D     I  +      +    T  ++  +      + + G  +YW+D +  K++ A
Sbjct: 2187 IGESSPRAVIRDSIGSLTIKSLAIDWINYNMYFINHDAERTNIEVSKLDGTYRKILLTTKTETPSSIAVDPVSRYLYWADQGQK---PTIQRSFLDGSRREVIVSSGIAEPTDLVVDVASKMIYWSDAKMDGIYRV------RSTGGTPELVRSDIASAAGVALHGQNMYWTDNRLEKLFRA 2359          

HSP 8 Score: 61.6178 bits (148), Expect = 2.014e-9
Identity = 49/150 (32.67%), Postives = 69/150 (46.00%), Query Frame = 1
Query:  139 NSFFQCISKLWVCDYNQDCDDNSDE--VNCPPMICDK-NQFKCPDSDLCIPREKLCDGVNDCIENEDEWN--CTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKD----SLENCKADFCKTSENTCSHICINKYSSFTCDCP 561
            +S ++CI     C+   DC DNSDE    CP   CD   +F+C  S  CIPR  +CD  NDC +N DE +  C        ++ + C + K   CI    +C+  I CS   D    +L  C     +  + TC  I  +K+     DCP
Sbjct: 3801 SSSYRCIPNWAFCNGQDDCRDNSDEDKQRCP--TCDDVGEFRCATSGKCIPRRWMCDTENDCGDNSDELDASCGGTTRPCSESEFRCNDGK---CIPGSKVCDGTIQCSDGLDESQCTLRRCLPGHRQCDDGTC--IAEHKWCDRKKDCP 3943          

HSP 9 Score: 56.6102 bits (135), Expect = 8.478e-8
Identity = 54/200 (27.00%), Postives = 86/200 (43.00%), Query Frame = 1
Query:  130 CGKNSF----FQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPD----SDLCIPREKLCDGVNDCIENEDEWNC-TNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADF--CKTSENTCSH--ICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVC-HQGCQDNGKSYNCFCYD 687
            C +N F     +CI   W CD + DC D  DE +CP   C  +Q++C      S  CI   + CD + DC +  DE +C  +   C+ +  + C + +  +C  +   C+   +C    D  ++C  +   C   +  C+    CI K  S+ CD   D     D  +     KC  N   C ++ CQ   + + C  YD
Sbjct:   53 CNENDFRCNDGKCIRTEWKCDGSGDCSDGEDEKDCPHPGCKSDQWQCDTYTWHSVSCIAEYQRCDNITDCADGSDEKDCPASTVDCSSQNVFMCADGR--QCFDVSKKCDGKYDCRDLSDEKDSCSRNHTACFQYQFRCADKTQCIQK--SWVCDGSKDCADGSDEPDTCEFKKCTANEFQCKNKRCQP--RKFRCDYYD 246          

HSP 10 Score: 56.225 bits (134), Expect = 8.770e-8
Identity = 54/180 (30.00%), Postives = 73/180 (40.56%), Query Frame = 1
Query:  148 FQCISKLWVCDYNQDCDDNSDE---VNCPPMICDKNQFKCPDSDL-------CIPREKLCDGVNDCIENEDEWN--C-TNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCS-HICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQG 645
             +CIS+ ++CD   DC D SDE     C    C   +F C  +         CIPR  LCDG   C   EDE    C T    CN K  + C N     CI     C+ + +C    D   NC    C+     C+ H C+   +S+ CD   D E   D ++C   +   +    C  G
Sbjct: 3017 LKCISRAFICDGEDDCGDGSDEHSRHGCGNRTCTDQEFHCTSNAKLAQPKYECIPRAWLCDGDVTCAGGEDESTELCKTEKKECN-KGEFRCSNQ---HCIHSTWECDGDNDCLDGSDEHANCTYSSCQPDFFQCANHKCVP--NSWKCDGNDDCEDGSDEKDCPKNSASAQKASKCSNG 3190          

HSP 11 Score: 55.4546 bits (132), Expect = 1.772e-7
Identity = 33/94 (35.11%), Postives = 48/94 (51.06%), Query Frame = 1
Query:   70 FIICLNFYACHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVN---CPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNC 342
            F++  +   C   C +    CG +   +CI KLW CD   DC D SDE     C   IC   +F+C + +   P + +CDG +DC ++ DE NC
Sbjct: 3614 FVLLSDQKTCEPNCTERQFACGGDDA-KCIPKLWYCDGEPDCRDGSDEPGESICGQRICPVGEFQCTNHNCTRPFQ-ICDGNDDCGDSSDEQNC 3705          

HSP 12 Score: 51.9878 bits (123), Expect = 1.792e-6
Identity = 50/184 (27.17%), Postives = 72/184 (39.13%), Query Frame = 1
Query:  130 CGKNSF----FQCISKLWVCDYNQDCDDN--SDE--VNCP--PMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDE--------------------------WNCTNINSCN---EKTHYNCGNTKK--------------LECIKIEDICNTNINCSTNKD--SLENCKADFCKTSENTCS 516
            C + +F      CI++  VCD + DC D   SDE    CP  P+ C   + +CP++++CI    LCDG +DC +  DE                          W C   N C+   ++TH NC +T                L+CI    IC+   +C    D  S   C    C   E  C+
Sbjct: 2874 CAEGTFPCSNGHCINQTKVCDGHNDCHDEQVSDESLATCPGLPIDCRGVKVRCPNTNICIQPADLCDGYDDCGDKADENQLFCMNQQCAQHYVRCPSGRCIPETWQCDGDNDCSDGWDETHTNCTDTAGKKICVGDYLFQCDNLKCISRAFICDGEDDCGDGSDEHSRHGCGNRTCTDQEFHCT 3057          

HSP 13 Score: 51.2174 bits (121), Expect = 3.298e-6
Identity = 40/134 (29.85%), Postives = 61/134 (45.52%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPP------MICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTK----KLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSH 519
            +CI K W CD   DC D SDE++           C +N  KC ++  CIP +  CDG NDC +  DE    ++  C +     C   K       CI  +  C+++ +C    D  LE C    C  ++ +C++
Sbjct: 1067 RCIPKEWKCDGENDCLDESDEIDEKGDKCFHETECAENTIKCRNTKKCIPAQYGCDGDNDCGDYSDE----DVKYCKDGQKPVCAAKKFQCDNHRCIPEQWKCDSDNDCGDGSDEKLEMCGNATCAANQFSCAN 1196          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Celegans
Match: lrp-2 (Low-density lipoprotein RecePtor related [Source:UniProtKB/TrEMBL;Acc:O01768])

HSP 1 Score: 147.132 bits (370), Expect = 5.218e-36
Identity = 128/486 (26.34%), Postives = 214/486 (44.03%), Query Frame = 1
Query:  172 VCDYNQDCDDNSDEVNCPPM--ICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNT-------KKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI--CINKYSSFTCDCPPDMELSE-DNRNCKHINKCFKNPEVCHQGCQDNGK-SYNCFCYDGY--TEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTS-FDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLE-KEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI--DKRVKPINLRII 1572
            +CD  QDC D  DE NC  +   C  N++ C DS  CI   +LCD   DC++  DEW    I S +E     C +          + C++ + +C+   +C +  D   +     C ++ N+C     C       +C C     LS  D + C     C K    C   C D     + CFC  GY  +E+ + C      N+           + + +F ++ H KA  +     +  +LD ++ ++++V+++ + H  N   ++ + N P           N   +  +L        A+D     +++TD N  +I V ++   F++I +       P  IV+DP+   +FW D G   +   I   NMDGS +  +L+ + I+ P  LA+D   QRLY+ D     I   + +       K   VL     H F++ +F + +YWSD   H I   HKITG + KV+  DK+ +P+  +I+
Sbjct: 2966 LCDGIQDCSDGFDEKNCASLDRQCKPNEWMC-DSGQCIDSGRLCDASVDCVDGSDEW--VEICSLSEPPRRGCPSGWSCLLTNGTIGCLQEQQLCDGRRDCMSGIDEQCDNPQGNCSSTRNSCDQTWNCQRHAGFESCSCDDGYHLSPYDKKTCLRSPSCPK--ANCSHFCIDRRDVGHQCFCAPGYILSENQKDC----RRNDTIEAEILMVYGHRLKLFTIDGHAKAT-LLSNLTNGVALDYDV-KSDLVYWTDVAHDGNKAGITSMSNQP-----------NTYRVINSLPTKGIDGIAVDWLGRNIYYTDRNHDAIAVCDMRGRFNRILLKGTPLNDPRAIVLDPLQALVFWTDWGASAH---IGRMNMDGSNEQVILQDRTIRWPNALAVDAPAQRLYFGDAHRDYIASCNYDGS-----KRRMVLRGSVRHIFALAVFEDYVYWSDWHNHTIERVHKITGTNRKVLIQDKQYRPMGFKIV 3421          

HSP 2 Score: 116.316 bits (290), Expect = 3.242e-26
Identity = 127/584 (21.75%), Postives = 232/584 (39.73%), Query Frame = 1
Query:  130 CGKNSFF-----QCISKLWVCDYNQDCDDNSDEVNCPPMICDKN-QFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNIN------SCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGY--TEHDQKCVPT---------TEENEIXXXXXXXXXXXXXXXXXLNP-HYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLE----KEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNI-KTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDK-RVKPINLRIISKESNRQLIKKINEHKIGKYCSGVINTCRGSCLPNHDMPEMPKCFGIPRIEEKIRSKNQSLWLILIPVVILGF 1791
            CGK + F     +C+    +CD   DC    DE  CPP +CD      C +   CI ++  CDGV+DC +N DE +CT I        C +   Y C +    +CI  + +C+   +C    D    C  +     +  CSH C        C CP D  L ++   C   + C      C Q C  +G S+ C+C D +        C+           +  +EI ++ S +     +    +N      K    G   I+  D++ ++     Y+ LV +  +L    + ++ +                      +A   A+D     +++ D    +I V++     +  +++++     ++ ID   G +FW D   E + P+I+ A++ G+ +  + +     +   P  +A+D   +R+YW D    +I  I  +    + + +    L     H F I ++   +Y+SD + + I    K  G +V +I++   +P +L+I+ +   +  IK          C G    C G CL N       +C  +    +      Q + L+     + GF
Sbjct: 1140 CGKMNQFMCADGKCLRSFQLCDGFPDCLTGEDETECPPSMCDSTTHLSCLNGQKCISKQLECDGVDDCGDNSDEKHCTEIRLDEAALRC-QSPMYQC-DGPNFKCISDKHLCDGTNDCEEGDDEGLWCTFNCTDADDLGCSHTCRPTPVGPICSCPDDHYLDKNGVTCSKKDPCRFGQ--CSQYCSPHGSSHFCYCEDSFKLGADRSSCISDDPRKPFLIYSNRHEIRMIQSKYPGSLPMITNLVNAIALDFKYHQNGSVSIYWTDLSADK----IYTGLVDQRTILYQRTIVSYGV---------------------FNAEGIAVDWISGNIYWIDSFLDTIQVVSEDGTKRATVINQNMGNARSLAIDVEEGFMFWTDW--EESNPRIERASLAGNNRAIIWKISNIAQAGWPNGIALDTIAKRVYWADAKSDSIHTITYDGRDHVIVFRDPERLG----HCFGIDVYEGHVYFSDWRTNTISKVDKWFGSNVSIIERVATQPFSLKIVHRSKQKMQIK--------NSCDGF--KCNGICLNNGKNKATCQCTNLQSTTDDGCVDIQQVLLVATKNGVRGF 1678          

HSP 3 Score: 75.485 bits (184), Expect = 1.391e-13
Identity = 124/576 (21.53%), Postives = 218/576 (37.85%), Query Frame = 1
Query:  124 HYCGKNSFFQC----ISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREK-------LCDGVNDCIENEDEWNCTNINSCNE--KTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGC-QDNGKSYNCFCYDGY--TEHDQ-KCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYND----------SSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDG-----------SFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVKPINLRIISKESN--RQLIKKINEHK---IGKYCSGVINTCRGSCLPNHDMPE--MPKCFGIP 1716
            H  G+++FFQC    I +  VCD   DC D  DE    P +C   + +C     C  +++       LCDG+ DC +  DE    N   C +  K  Y C N +   CI +   C+   +C    D             E+TC                           C H         VC Q C      +  C C  GY  T++D+ +C P ++  E+ +   +   + S+    ++       + R    +F++ +NL    + F    V +  ++    + N    VD+     S+        +  +A     D   N ++FT+ ++          ++IYV          ++        ++ +DP+   +FW         P+I  AN+DG                L+E+ I +P  + +D   +RLYW D     I+ +  +   +  ++ F +       P ++ + G  IY    ++  I+  HK TGK  K + K ++ ++ RI  + ++  +  +  I   K      YC    NT    C+P+ D     +PKC   P
Sbjct: 3793 HNNGESNFFQCSMQTIKEWQVCDGRWDCADGLDE---SPEMCASRKARCFRIGYCDDKKQCLDVSTALCDGIRDCFDGSDE----NPIHCKDMCKGKYRCTNGR---CIDVSARCDGRDDCGDGSD-------------EDTC------------------------GAECHHFG-------VCAQKCWMAFNHTARCHCAPGYARTKNDENECEPLSKSAEMFITNGNRLHLMSLENSQVS-------VLR---PVFNIKMNLIPGGIDFGYD-VFRTTLMYTVGIGN--SRVDIRSKKWSDGLIGSWGEEESTAGLITYDFMHNNVYFTESSEQNRGVLFDRQANIYVAKAKDTSTRTLIVNSTGTINSLAVDPIKRLIFWT---TSAPVPRILSANLDGKPIAQPFKTGSQPHKALVERNIFEPTSMVLDFSNERLYWIDVLKRTIETVSFDGRDRRTVRKFELGDT----PVTMDVLGGYIYLI-TRQGSIHRMHKFTGKTNKYVQK-IREVSPRIQIRVAHPAKHTVSHITHQKNPCQSDYCPS--NT---VCVPDQDKNGILIPKCLCGP 4287          

HSP 4 Score: 74.3294 bits (181), Expect = 2.458e-13
Identity = 63/202 (31.19%), Postives = 90/202 (44.55%), Query Frame = 1
Query:  154 CISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNC-TNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFC----------KTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINK-CFKNPEVCHQG-CQDNGK--SYNCFCYDGYTEHDQKC 714
            C+ K W CD   DC D SDE NC    C   +F C  S  CIP E+ CDG  DC + EDE  C T  +S      + C N +   CI +   C+   +C  N  SL + + D            + ++ TC   C  + ++  CD   D     D +NC  +++ C  N  +C  G C D+G+    +  C DG  E  + C
Sbjct: 2829 CMPKHWQCDGQPDCADGSDEKNCDAKKCTSFEFSCESSKKCIPLEQKCDGRRDCPDGEDEHQCETECDSKGGNATFRCTNHR---CIPMAWRCDGTDDCMDNAKSLGSDEVDCAAGRTSFHVPSRCADETCVVAC--ELTAVLCDGIQDCSDGFDEKNCASLDRQCKPNEWMCDSGQCIDSGRLCDASVDCVDGSDEWVEIC 3025          

HSP 5 Score: 72.0182 bits (175), Expect = 1.312e-12
Identity = 66/201 (32.84%), Postives = 84/201 (41.79%), Query Frame = 1
Query:   94 ACHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVN-----CPPMICDKNQFKCP-----DSDLCIPREKLCDGVNDCIENEDEWN--CTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSL----ENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRN-CKHINKCFKNPEVCHQG 645
            +C  +C  +D  C K   ++CIS  W CD   DC D  DE       CPP  C   QF C       +  C+   KLCDGV DC   +DE    C N   C E   + CG+ KK  CI +  +C+   +C    D L     +CK DF      T    CI K   F CD   D    +D  + C  I +C      C  G
Sbjct: 3477 SCVSECKPNDFVCTKT--YKCISSWWRCDGQDDCGDGEDEGYFVEGVCPPFPCIAGQFVCGRTAQNATAQCLYASKLCDGVKDCSGGDDEEPAFCENFE-CTE-AQFKCGDKKK--CIPLTSVCDKEKDCDDGSDELNCEITSCKPDFFACFNGTAISKCIPK--EFYCDGEDDCPEGQDEPDSCFGIGECTHEQFQCTSG 3669          

HSP 6 Score: 67.781 bits (164), Expect = 3.122e-11
Identity = 57/192 (29.69%), Postives = 89/192 (46.35%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDC--IENED-EWNCTNINSCNEKTH-----YNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKN----PEVCHQGCQDN-GKSYNCFCYD 687
            +C  + W CD   DC D+SDE +     C +N+F C  +  C+PR  LCD   DC  + N D + +      CN+  H     Y C  +K  +C+ +   C+   +CS   D    C  +  KT++ +C +          C CP +  L+E  + C+ +N C +     P VC Q C DN   ++ C C+D
Sbjct:   53 KCYPEQWYCDGFPDCQDSSDEPSTCKRTCLENEFVC-KTGKCLPRGYLCDSQYDCGRLPNGDRDLSDEAPELCNQPLHCDYNEYAC--SKSAQCVPLFKFCDGKRDCSDGSDEHSMCHVEDPKTAD-SCEYGAAMTIDGIKCYCPKNKFLNEQGK-CEFVNHCERTKNGLPPVCSQDCTDNKNGTFTCSCFD 239          

HSP 7 Score: 63.1586 bits (152), Expect = 6.522e-10
Identity = 65/218 (29.82%), Postives = 87/218 (39.91%), Query Frame = 1
Query:  103 FKCLQDDHYCGK---NSFFQCISKLWVCDYNQDCDDNSDE--VNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENC-KADFCKTSENTC-SHICINKYSSFTCDCPPDMELSEDNRNCKHI------NKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCV 717
            F C+     CG+   N+  QC+    +CD  +DC    DE    C    C + QFKC D   CIP   +CD   DC +  DE NC  I SC          T   +CI  E  C+   +C   +D  ++C     C   +  C S  CI K     CD   D     D + CK        N C    ++C      +GK     C DG  E ++ CV
Sbjct: 3525 FPCIAGQFVCGRTAQNATAQCLYASKLCDGVKDCSGGDDEEPAFCENFECTEAQFKCGDKKKCIPLTSVCDKEKDCDDGSDELNC-EITSCKPDFFACFNGTAISKCIPKEFYCDGEDDCPEGQDEPDSCFGIGECTHEQFQCTSGKCIPKRRQ--CDGTLDCRDGSDEKGCKKECAIVCDNSCVHADDLC------DGKKK---CNDGSDEDEEACV 3730          

HSP 8 Score: 62.7734 bits (151), Expect = 9.314e-10
Identity = 52/169 (30.77%), Postives = 79/169 (46.75%), Query Frame = 1
Query:  106 KCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCP-PMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKD-SLENCKADFCKTSENTCSHICINK--YSSFT-CDCPPDMELSEDNRNC 597
            KC      C K    +CI K   C+  Q+CD+ +DE +CP   +CD ++F+C  + LCI + ++CDG   C++  DE +C     C +   + C N K   C+ +   C+   +C  + D S E CK +   T       +C +     SF  CD  PD    ED   C
Sbjct: 1012 KCSVSQFQCSKT---KCIIKSKRCNGVQECDNGADEEDCPRSKLCDPDEFRC-GTGLCIKQSQVCDGKMQCLDGLDEEHCNEEEKCLQGRQFRCANGKST-CLDLIFRCDGVADCEDSSDESDEFCKGNSSSTCGKMNQFMCADGKCLRSFQLCDGFPDCLTGEDETEC 1175          

HSP 9 Score: 60.077 bits (144), Expect = 5.723e-9
Identity = 70/317 (22.08%), Postives = 133/317 (41.96%), Query Frame = 1
Query:  661 KSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIE--MNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIV-DKDCYFPFNIVIDPVMGRLFWIDLGNENNGPK-----IKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVKPINLRIISKESN 1587
            ++ +CFC DGY +++ KC  + +  +  L   +      + I   + +Y+ + I  G  D+    +N+ R   + +     K   L +  L+   L V    S+      +   MN + +     A D   + L+ TD     I V  L++    K+V   +   P  I I      LFW     +NN  +     I+ + +DGS + TL+ K       L +D++   LYW D + + I+ I  N   +   +     A +  HP+ +  F N I++++ K+  +   +     DV+ + +    +   ++ K SN
Sbjct:  566 QTSSCFCRDGYIQNNTKCSASKDLKDEELFVLAQLRPSRIKILGFDKNYRTEII--GVSDL----LNVKRPSAMTFDP---KGEQLLMYDLRRHSLVVQKIGSTNYTVHGLTGIMNCEGM-----AYDFTSDNLYMTDQRRKIITVQRLSNLSIQKVVVSGNMSNPRAIAIHIAKSYLFWGSWNEDNNDDEKIPAMIERSKLDGSERKTLVSKNAMWINGLTLDLKNDYLYWCDAYRNVIERIRWNGADR---EVVVHGADKISHPYGLAFFDNHIFYTEFKKGAVKRVNVDFPDDVQEVFQYSATVFELLVFKNSN 865          

HSP 10 Score: 60.077 bits (144), Expect = 7.319e-9
Identity = 54/183 (29.51%), Postives = 75/183 (40.98%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNC------------PPMICD-KNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHICINKYS---SFTCDCPPD-----MELSEDNRNCKHINKCFKNPEVC 636
            QCI   W CD   DC D SDE +C             P  CD K QF C  +  C+P+   CDG  DC +  DE NC +   C     ++C ++KK  CI +E  C+   +C   +D    C+ + C +     +  C N      ++ CD   D       L  D  +C      F  P  C
Sbjct: 2775 QCIHPSWKCDGTNDCYDGSDEKDCFVEFDATGGSVSAPRSCDAKTQFACLATRTCMPKHWQCDGQPDCADGSDEKNC-DAKKCT-SFEFSCESSKK--CIPLEQKCDGRRDCPDGEDE-HQCETE-CDSKGGNATFRCTNHRCIPMAWRCDGTDDCMDNAKSLGSDEVDCAAGRTSFHVPSRC 2951          

HSP 11 Score: 56.6102 bits (135), Expect = 7.666e-8
Identity = 56/232 (24.14%), Postives = 103/232 (44.40%), Query Frame = 1
Query: 1024 STALDPARNLLFFTDYNDSSIYVMNLT--------SFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDIN-SLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVK-PINLRII--SKESNRQLIKKINEHKIGKYCSGVINTCRGSCLPNHD 1683
            S A D     L+F   N +SI+ +N+         +  KI +       P +I I P    LF+ +  N   G  I+     G  +  ++++++   + L ID++ ++LY++D     I   D + S  +L +    + +I   HPF + I+ + I ++D     +   +KITG D + I++    P+ L ++   +E         NE K   YC  + N  + SC  N +
Sbjct: 2395 SMAYDEVHTELYFVRANPASIWRINVADNNLESYPTEPKIVLTLTVRDRPRHIAIHPCRMLLFFTN--NAITGSVIERVYFSGFKRDQIVQEDLHDLRGLTIDLDSEKLYFSDSKDFKISRCDFDGSHRELVVSNTDIPSI---HPFELSIYDDEIIFTDWVRRSVVGVNKITGSDNRNINRATDVPVGLVVVDTKREYCTSDACADNELKCEDYCRLMANG-QASCACNGE 2620          

HSP 12 Score: 55.4546 bits (132), Expect = 1.536e-7
Identity = 55/181 (30.39%), Postives = 76/181 (41.99%), Query Frame = 1
Query:  130 CGKNSF----FQCISKLWVCDYNQDCDDNSDEVNCPPMICDK-NQFK------CPDSDLCIPREKLCDGVNDCIENEDEWNC-----------TNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTC--SHICINKYSSFTCDCPPDMELSEDNRNCK 600
            C +N F      CI     C++ QDC+D SDE+ CP   C   N+F       C  +  CI     CDG NDC +  DE +C           +   SC+ KT + C  T+   C+     C+   +C+   D  +NC A  C + E +C  S  CI       CD   D    ED   C+
Sbjct: 2717 CNENEFRCQSGACIPSKARCNHMQDCNDASDEIGCPFRNCSALNEFGMTGLINCATTSQCIHPSWKCDGTNDCYDGSDEKDCFVEFDATGGSVSAPRSCDAKTQFACLATRT--CMPKHWQCDGQPDCADGSDE-KNCDAKKCTSFEFSCESSKKCIPLEQK--CDGRRDCPDGEDEHQCE 2892          

HSP 13 Score: 51.9878 bits (123), Expect = 1.919e-6
Identity = 50/175 (28.57%), Postives = 74/175 (42.29%), Query Frame = 1
Query:   94 ACHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCD----------DNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNC--GNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENT-------CSHICI-NKYSSFTCDC 558
             C   CL+++  C      +C+ + ++CD   DC           D + E+   P+ CD N++ C  S  C+P  K CDG  DC +  DE +  ++   + KT  +C  G    ++ IK          C  NK   E  K +F    E T       CS  C  NK  +FTC C
Sbjct:   76 TCKRTCLENEFVCKTG---KCLPRGYLCDSQYDCGRLPNGDRDLSDEAPELCNQPLHCDYNEYACSKSAQCVPLFKFCDGKRDCSDGSDEHSMCHVE--DPKTADSCEYGAAMTIDGIKCY--------CPKNKFLNEQGKCEFVNHCERTKNGLPPVCSQDCTDNKNGTFTCSC 237          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Celegans
Match: T13C2.6 (pep chromosome:WBcel235:II:6783427:6788255:1 gene:WBGene00020481.1 transcript:T13C2.6b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T13C2.6)

HSP 1 Score: 139.813 bits (351), Expect = 6.129e-34
Identity = 132/525 (25.14%), Postives = 228/525 (43.43%), Query Frame = 1
Query:  154 CISKLWVCDYNQDCDDNSDEVNCPPMI--CDKNQFKCPDS----------DLCIPREKLCDGVNDCIENEDEWNC--TNINSCNEKTHYNCGNTKKLECIKIEDIC-NTNINCSTNKDSLENCKA--DFCKTSENTCSHICINKY--SSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAK---------EIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNL-SAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKE-IKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVK-PINLRIISKESNRQLIKKINEHKIGKYC 1635
            CI+K +VCD   DC D SDE +C  +   C   +  CP S           +CIP    C+G  DC +  DE  C  T   +C + T Y C +T  L+CI++  +C +   +C     S+ + K   + CK S   C  +C   +   +  C C    +L  +N  C  IN+C +   VC Q C +   SY C C+ GY    Q     T+     +     +      +   N H   +          +        ++D ++    +++   L  +     +  + N  L  D+       K  I +    + +    A+D   +LLF+TD     I V+++ +  +  +   D   P  I +DP +G +FW D G +    +I+ + MDG  +  ++E + +  P  LA+D  ++R+YW D   + IK I        NIKT         HPFS+ +F +R++++D +   + + +K TG D++ +  +VK P+ +RI  K++   +  K    +    C
Sbjct:  270 CINKAFVCDGELDCSDGSDEDDCADVRTECKSGERTCPASYGAYGAESGHVVCIPASSWCNGEEDCPDGGDEKECNMTAPVTCQKGTEYECPSTP-LQCIEMSKLCASAQFDCGDGNMSVCSQKKIIEMCKPSSEGC--VCRPSFVRGNNVCHCKDGYKL--ENGQCIDINEC-EIAGVCDQICLNIPGSYRCACHAGY----QISFGDTKIGSGRIANKCRAMGGDPLVLLTNRHTIRQFDLVNKMHFPVSSSPGSAVAMDFHILNGTLIWSDVLSKQILKCSIGNVSNAFLGTDM----CDKKHEIVLTGDKIHTPDGLAVDWVHDLLFWTDGGLDQINVLDMKNGKQRVLYSSDLEEPRAIAVDPEVGLIFWTDWGKK---ARIERSGMDGQHRTVIVEGDRVVWPNGLALDYVDKRVYWAD---AKIKSIFSCDYWGKNIKTVLHSHQYLRHPFSMAVFEDRLFYTDWEHDGVITVNKFTGADIRTVMDQVKSPMTVRIYHKQAQPLMQNKCENSECDHLC 774          

HSP 2 Score: 77.411 bits (189), Expect = 2.397e-14
Identity = 64/194 (32.99%), Postives = 87/194 (44.85%), Query Frame = 1
Query:  109 CLQDDHYCG-----KNSF--FQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKC----PDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTC---------SHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPE 630
            C  ++H CG     ++S   F+CI   WVCD   DC+D SDE  C  + C + QF+C     D  LCIP   +CDG  DC   +DE NCT+  S     ++ C N     CI    +C+   +CS   D L    ++ C  + N C         S  CI   S + CD   D +   D +NC  I    K  E
Sbjct:   73 CGAEEHKCGEVKSARSSLERFKCIPNKWVCDGEFDCEDKSDEFQCKNVSCQEKQFQCEELSGDYSLCIPETWVCDGQRDCTNGKDEQNCTSKTSKCPDNNFQCSNGN---CIFKNWVCDGEEDCSDGSDELLTAPSN-CNRTVNQCPPGEMWKCGSGECIP--SRWRCDAEVDCKDHSDEKNCTAIQHTCKLAE 260          

HSP 3 Score: 55.0694 bits (131), Expect = 1.915e-7
Identity = 44/131 (33.59%), Postives = 63/131 (48.09%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCP-PMICDKNQFKCPD-----SDL----CIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKK--LECIKIEDICNTNINCSTNKDSLENCKADFCKTSEN 507
            +CI   W CD + DC +  DE NCP   +C   + KC +     S L    CIP + +CDG  DC +  DE+ C N+ SC EK  + C         CI    +C+   +C+  KD  +NC +   K  +N
Sbjct:   44 RCIPMSWRCDGDIDCQNEEDEKNCPISEVCGAEEHKCGEVKSARSSLERFKCIPNKWVCDGEFDCEDKSDEFQCKNV-SCQEK-QFQCEELSGDYSLCIPETWVCDGQRDCTNGKDE-QNCTSKTSKCPDN 171          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Celegans
Match: T13C2.6 (pep chromosome:WBcel235:II:6783427:6788255:1 gene:WBGene00020481.1 transcript:T13C2.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T13C2.6)

HSP 1 Score: 139.813 bits (351), Expect = 6.164e-34
Identity = 130/508 (25.59%), Postives = 224/508 (44.09%), Query Frame = 1
Query:  154 CISKLWVCDYNQDCDDNSDEVNCPPMI--CDKNQFKCPDS----------DLCIPREKLCDGVNDCIENEDEWNC--TNINSCNEKTHYNCGNTKKLECIKIEDIC-NTNINCSTNKDSLENCKA--DFCKTSENTCSHICINKY--SSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAK---------EIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNL-SAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKE-IKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVK-PINLRIISKES 1584
            CI+K +VCD   DC D SDE +C  +   C   +  CP S           +CIP    C+G  DC +  DE  C  T   +C + T Y C +T  L+CI++  +C +   +C     S+ + K   + CK S   C  +C   +   +  C C    +L  +N  C  IN+C +   VC Q C +   SY C C+ GY    Q     T+     +     +      +   N H   +          +        ++D ++    +++   L  +     +  + N  L  D+       K  I +    + +    A+D   +LLF+TD     I V+++ +  +  +   D   P  I +DP +G +FW D G +    +I+ + MDG  +  ++E + +  P  LA+D  ++R+YW D   + IK I        NIKT         HPFS+ +F +R++++D +   + + +K TG D++ +  +VK P+ +RI  K++
Sbjct:  268 CINKAFVCDGELDCSDGSDEDDCADVRTECKSGERTCPASYGAYGAESGHVVCIPASSWCNGEEDCPDGGDEKECNMTAPVTCQKGTEYECPSTP-LQCIEMSKLCASAQFDCGDGNMSVCSQKKIIEMCKPSSEGC--VCRPSFVRGNNVCHCKDGYKL--ENGQCIDINEC-EIAGVCDQICLNIPGSYRCACHAGY----QISFGDTKIGSGRIANKCRAMGGDPLVLLTNRHTIRQFDLVNKMHFPVSSSPGSAVAMDFHILNGTLIWSDVLSKQILKCSIGNVSNAFLGTDM----CDKKHEIVLTGDKIHTPDGLAVDWVHDLLFWTDGGLDQINVLDMKNGKQRVLYSSDLEEPRAIAVDPEVGLIFWTDWGKK---ARIERSGMDGQHRTVIVEGDRVVWPNGLALDYVDKRVYWAD---AKIKSIFSCDYWGKNIKTVLHSHQYLRHPFSMAVFEDRLFYTDWEHDGVITVNKFTGADIRTVMDQVKSPMTVRIYHKQA 755          

HSP 2 Score: 77.411 bits (189), Expect = 2.521e-14
Identity = 65/198 (32.83%), Postives = 88/198 (44.44%), Query Frame = 1
Query:   97 CHFKCLQDDHYCG-----KNSF--FQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKC----PDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTC---------SHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPE 630
            C   C  ++H CG     ++S   F+CI   WVCD   DC+D SDE  C  + C + QF+C     D  LCIP   +CDG  DC   +DE NCT+  S     ++ C N     CI    +C+   +CS   D L    ++ C  + N C         S  CI   S + CD   D +   D +NC  I    K  E
Sbjct:   67 CPKVCGAEEHKCGEVKSARSSLERFKCIPNKWVCDGEFDCEDKSDEFQCKNVSCQEKQFQCEELSGDYSLCIPETWVCDGQRDCTNGKDEQNCTSKTSKCPDNNFQCSNGN---CIFKNWVCDGEEDCSDGSDELLTAPSN-CNRTVNQCPPGEMWKCGSGECIP--SRWRCDAEVDCKDHSDEKNCTAIQHTCKLAE 258          

HSP 3 Score: 55.4546 bits (132), Expect = 1.431e-7
Identity = 44/130 (33.85%), Postives = 63/130 (48.46%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPD-----SDL----CIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKK--LECIKIEDICNTNINCSTNKDSLENCKADFCKTSEN 507
            +CI   W CD + DC +  DE NC P +C   + KC +     S L    CIP + +CDG  DC +  DE+ C N+ SC EK  + C         CI    +C+   +C+  KD  +NC +   K  +N
Sbjct:   44 RCIPMSWRCDGDIDCQNEEDEKNC-PKVCGAEEHKCGEVKSARSSLERFKCIPNKWVCDGEFDCEDKSDEFQCKNV-SCQEK-QFQCEELSGDYSLCIPETWVCDGQRDCTNGKDE-QNCTSKTSKCPDN 169          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Celegans
Match: rme-2 (Receptor Mediated Endocytosis [Source:UniProtKB/TrEMBL;Acc:O44191])

HSP 1 Score: 110.538 bits (275), Expect = 1.108e-24
Identity = 122/493 (24.75%), Postives = 195/493 (39.55%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNC----------------------PPMI------CDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCT---------------NINSCNEKTHYNCGNTKKLE---CIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYT-EHDQKC----VPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSD 1476
            QCI    VCD + DC    DEVNC                      P         C      C   D+CIP   LCDG  DC +  DE NC                +++SC+    Y+CG TK  E   CI +   CN    C    D  ++C     + +   C H C+N      C C    +L++D   C+  ++C  +  +C   C+D   S+ C C +GY  E D         TT E  + +          ++ F    +Y   + F G   I S+D     N+M    S  H D   ++S   N  + V     ++    N+ ++    + F T   P+ +          SI  M+     ++    +       +V+ P+ G + WID   + +  +I MANMDGS    LL+ +++ P  LAID     +Y+ D     I+ ++I++  +  + +  V      HP+ +  F   +YW+D
Sbjct:   69 QCIQPDLVCDGHTDCSGGDDEVNCTRRGHENMQSSTDFHDDVHLVDPTFFANEDNKCRSGYTMCHSGDVCIPDSFLCDGDLDCDDASDEKNCQTNAPSEEEYLSGQADHMHSCSAAGMYSCG-TKGSEIGVCIPMNATCNGIKECPLGDDESKHCS----ECARKRCDHTCMNTPHGARCICQEGYKLADDGLTCEDEDECATHGHLCQHFCEDRLGSFACKCANGYELETDGHSCKYETTTTPEGYLFISLGGEVRQMPLADFTDGSNYSPIQKFAGHGTIRSIDFMHRNNKMFMSISDEHGDPTGELSVSDNGLMRV--LRENVIGVSNVAVDWIGGNVFFTQKSPSPSAGI-------SICTMSGMFCRRVIEGKEQGQSYRGLVVHPMRGLIIWIDSYQKYH--RIMMANMDGSQVRILLDNKLEVPSALAIDYIRHDVYFGDVERQLIERVNIDTKERRVVISNGV-----HHPYDMAYFNGFLYWAD 540          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Fly
Match: LpR1 (gene:FBgn0066101 transcript:FBtr0301466)

HSP 1 Score: 191.815 bits (486), Expect = 5.317e-51
Identity = 165/705 (23.40%), Postives = 294/705 (41.70%), Query Frame = 1
Query:   79 CLNFYACHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDE--VNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCT-------NINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLEN-CKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYT---EHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSI--SNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYF-HPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVKPINLRIISKESNRQLIKKINEHKIGKYCSGVINTCRGSCLPNHDMPEMPKCFGIPRIEEKIRSKNQSLWLILIPVVILGFVCIVLFKY-----RFSRTRITK-QPESNRVFVYDSVQFYED--QNSLHDD-----------NTIISDTVPIINNSE*VFPVTVLLLQRFSTLVNFV-----SMFHYWKLVFLSIQYKF 2073
            C N       CL  ++ C       C+   W+CD ++DC D  DE   NC  + C  +QF+C D   CIP    C+G  DC +  DE +C        N   CN  + ++CG     +C+ +  +C+   +C   +D     C  + C +    C H CI+      C+C    +LS D RNC+ IN+C + P  C Q C +    + C C  GY    ++  +C  +     + L         ++    +     + +     D +F       R  M+F+S +  +                 +Y + I   N++ + +   ++++   A+D   N ++FTD +  +I + N        +V      P +I +DP+ G ++W D G     P+I+ A MDGS + T++  ++K P  + +D+ ++R+YW D   + I   + +   +  +    + + EY  HPFSI  F + +YW+D  +  ++ A+K TG+DV+ +        + ++       +     +     +C  V   C   CLP             PRI E+   +        + +++ G +C+    Y     R  R R TK +P+S R  +   VQ      +  ++DD            T ++D  P+ N+++ +   T    Q  S  +  V     S F     V L I Y++
Sbjct:  186 CANVTKTTTPCLSHEYQC--KDRITCLHHSWLCDGDRDCPDGDDEHTANCKNVTCRADQFQCGDRS-CIPGHLTCNGDKDCADGSDERDCGLSLSLGINQGGCNATSEFDCGGG---QCVPLSKVCDKRKDCPDGEDEPAGKCGINECASKNGGCMHQCIDLKVGHHCECHEGYKLSPDKRNCQDINEC-EVPGKCSQICVNEIGGFKCECEAGYMRDPKNHTRCKASEGHASLLLARRHDIRKIALDHMEMTSIVNSTKAATALDFVF-------RTGMIFWSDVTTQ----------------SIYKAPIDEGNEKTVVLTKSSVTSDGLAVDWIYNHVYFTDTHKCTIELTNFEGSMGKVLVKDSLDIPRSIALDPIEGWMYWSDWGAS---PRIERAGMDGSHRTTIISYDVKWPNGITLDLVKKRIYWVDGKLNVISSANYDGSQRSQV----LYSGEYLRHPFSITTFEDNVYWTDWDKQAVFKANKFTGEDVEPV------TAMHMLQHPMVVHVYHPYRQPDGVNHCQSVNGHCSHLCLP------------APRINER-SPRISCACPTGLKLMVDGLMCVEDPLYLPPVTRPPRARKTKPRPKSPRRRLPTGVQVGHADIRIEINDDLQLSTRLPLLPTTFVADQRPVKNHTQ-IEKTTTPSEQPDSGFIALVVIASLSGFAVLLSVLLLIGYRY 833          

HSP 2 Score: 60.4622 bits (145), Expect = 4.410e-9
Identity = 67/216 (31.02%), Postives = 95/216 (43.98%), Query Frame = 1
Query:  109 CLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVN--CPPMICDKNQFKCPDSD-LCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKT-SENTCSH-ICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQ-GCQDN----GKSYNC----FCYDGYTEHDQKC 714
            C  D   CG  +   CI   W CD   DC D SDE N  C    C  +++ C   +  C+P   +CD   DC +  DE NC      +E   + CGN +   CI+    C+ + +C    D  E C    C + +E+TC++  CI K   + CD  PD     D R+C ++ K    P + H+  C+D       S+ C     C DG  EH   C
Sbjct:   31 CSSDQFRCGNGN---CIPNKWRCDQESDCADGSDEANELCRARTCSPDEYACKSGEGQCVPLAWMCDQSKDCSDGSDEHNCNQTCRADE---FTCGNGR---CIQKRWKCDHDDDCGDGSDEKE-CPVVPCDSVAEHTCTNGACIAK--RWVCDGDPDCSDGSDERSCANVTK-TTTPCLSHEYQCKDRITCLHHSWLCDGDRDCPDGDDEHTANC 233          

HSP 3 Score: 55.8398 bits (133), Expect = 1.326e-7
Identity = 50/211 (23.70%), Postives = 77/211 (36.49%), Query Frame = 1
Query:   97 CHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDS---------------------------------------DLCIPREKLCDGVNDCIENEDEWNCTNINSCNE---KTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCS-HICINKYSSFTCDCPPDMELSEDNRNC 597
            C  +    D Y  K+   QC+   W+CD ++DC D SDE NC    C  ++F C +                                          CI +  +CDG  DC +  DE +C N+           Y C +  ++ C+    +C+ + +C    D    NCK   C+  +  C    CI  +   TC+   D     D R+C
Sbjct:   67 CRARTCSPDEYACKSGEGQCVPLAWMCDQSKDCSDGSDEHNC-NQTCRADEFTCGNGRCIQKRWKCDHDDDCGDGSDEKECPVVPCDSVAEHTCTNGACIAKRWVCDGDPDCSDGSDERSCANVTKTTTPCLSHEYQCKD--RITCLHHSWLCDGDRDCPDGDDEHTANCKNVTCRADQFQCGDRSCIPGH--LTCNGDKDCADGSDERDC 272          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Fly
Match: LpR1 (gene:FBgn0066101 transcript:FBtr0335238)

HSP 1 Score: 191.815 bits (486), Expect = 6.166e-51
Identity = 165/705 (23.40%), Postives = 295/705 (41.84%), Query Frame = 1
Query:   79 CLNFYACHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDE--VNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCT-------NINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLEN-CKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYT---EHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSI--SNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYF-HPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVKPINLRIISKESNRQLIKKINEHKIGKYCSGVINTCRGSCLPNHDMPEMPKCFGIPRIEEKIRSKNQSLWLILIPVVILGFVCIVLFKY-----RFSRTRITK-QPESNRVFVYDSVQF--YEDQNSLHDD-----------NTIISDTVPIINNSE*VFPVTVLLLQRFSTLVNFV-----SMFHYWKLVFLSIQYKF 2073
            C N       CL  ++ C       C+   W+CD ++DC D  DE   NC  + C  +QF+C D   CIP    C+G  DC +  DE +C        N   CN  + ++CG     +C+ +  +C+   +C   +D     C  + C +    C H CI+      C+C    +LS D RNC+ IN+C + P  C Q C +    + C C  GY    ++  +C  +     + L         ++    +     + +     D +F       R  M+F+S +  +                 +Y + I   N++ + +   ++++   A+D   N ++FTD +  +I + N        +V      P +I +DP+ G ++W D G     P+I+ A MDGS + T++  ++K P  + +D+ ++R+YW D   + I   + +   +  +    + + EY  HPFSI  F + +YW+D  +  ++ A+K TG+DV+ +        + ++       +     +     +C  V   C   CLP             PRI E+   +        + +++ G +C+    Y     R  R R TK +P+S R  +   VQ    + +  ++DD            T ++D  P+ N+++ +   T    Q  S  +  V     S F     V L I Y++
Sbjct:  184 CANVTKTTTPCLSHEYQC--KDRITCLHHSWLCDGDRDCPDGDDEHTANCKNVTCRADQFQCGDRS-CIPGHLTCNGDKDCADGSDERDCGLSLSLGINQGGCNATSEFDCGGG---QCVPLSKVCDKRKDCPDGEDEPAGKCGINECASKNGGCMHQCIDLKVGHHCECHEGYKLSPDKRNCQDINEC-EVPGKCSQICVNEIGGFKCECEAGYMRDPKNHTRCKASEGHASLLLARRHDIRKIALDHMEMTSIVNSTKAATALDFVF-------RTGMIFWSDVTTQ----------------SIYKAPIDEGNEKTVVLTKSSVTSDGLAVDWIYNHVYFTDTHKCTIELTNFEGSMGKVLVKDSLDIPRSIALDPIEGWMYWSDWGAS---PRIERAGMDGSHRTTIISYDVKWPNGITLDLVKKRIYWVDGKLNVISSANYDGSQRSQV----LYSGEYLRHPFSITTFEDNVYWTDWDKQAVFKANKFTGEDVEPV------TAMHMLQHPMVVHVYHPYRQPDGVNHCQSVNGHCSHLCLP------------APRINER-SPRISCACPTGLKLMVDGLMCVEDPLYLPPVTRPPRARKTKPRPKSPRRRLPTGVQVGHADIRIEINDDLQLSTRLPLLPTTFVADQRPVKNHTQ-IEKTTTPSEQPDSGFIALVVIASLSGFAVLLSVLLLIGYRY 831          

HSP 2 Score: 73.9442 bits (180), Expect = 3.348e-13
Identity = 75/214 (35.05%), Postives = 99/214 (46.26%), Query Frame = 1
Query:  109 CLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPM-ICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKT-SENTCSH-ICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQ-GCQDN----GKSYNC----FCYDGYTEHDQKC 714
            C  D   CG  +   CI   W CD   DC D SDE N   M  C  N+FKC   D CIPR  LCDG NDC +  DE +C      +E   + CGN +   CI+    C+ + +C    D  E C    C + +E+TC++  CI K   + CD  PD     D R+C ++ K    P + H+  C+D       S+ C     C DG  EH   C
Sbjct:   31 CSSDQFRCGNGN---CIPNKWRCDQESDCADGSDEANELCMNACPNNEFKCQTVDQCIPRSWLCDGSNDCRDKSDEAHCNQTCRADE---FTCGNGR---CIQKRWKCDHDDDCGDGSDEKE-CPVVPCDSVAEHTCTNGACIAK--RWVCDGDPDCSDGSDERSCANVTK-TTTPCLSHEYQCKDRITCLHHSWLCDGDRDCPDGDDEHTANC 231          

HSP 3 Score: 50.447 bits (119), Expect = 6.138e-6
Identity = 51/172 (29.65%), Postives = 76/172 (44.19%), Query Frame = 1
Query:   97 CHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNE---KTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCS-HICINKYSSFTCDCPPDMELSEDNRNC 597
            C+  C  D+  CG     +CI K W CD++ DC D SDE  CP + CD        +  CI +  +CDG  DC +  DE +C N+           Y C +  ++ C+    +C+ + +C    D    NCK   C+  +  C    CI  +   TC+   D     D R+C
Sbjct:  106 CNQTCRADEFTCGNG---RCIQKRWKCDHDDDCGDGSDEKECPVVPCDSVAEHTCTNGACIAKRWVCDGDPDCSDGSDERSCANVTKTTTPCLSHEYQCKD--RITCLHHSWLCDGDRDCPDGDDEHTANCKNVTCRADQFQCGDRSCIPGH--LTCNGDKDCADGSDERDC 270          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Fly
Match: LpR1 (gene:FBgn0066101 transcript:FBtr0301469)

HSP 1 Score: 191.815 bits (486), Expect = 9.069e-51
Identity = 167/705 (23.69%), Postives = 295/705 (41.84%), Query Frame = 1
Query:   79 CLNFYACHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDE--VNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCT-------NINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLEN-CKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYT---EHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSI--SNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYF-HPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVKPINLRIISKESNRQLIKKINEHKIGKYCSGVINTCRGSCLPNHDMPEMPKCFGIPRIEEKIRSKNQSLWLILIPVVILGFVCIVLFKY-----RFSRTRITK-QPESNRVFVYDSVQFYED--QNSLHDD-----------NTIISDTVPIINNSE*VFPVTVLLLQRFSTLVNFV-----SMFHYWKLVFLSIQYKF 2073
            C N       CL  ++ C       C+   W+CD ++DC D  DE   NC  + C  +QF+C D   CIP    C+G  DC +  DE +C        N   CN  + ++CG     +C+ +  +C+   +C   +D     C  + C +    C H CI+      C+C    +LS D RNC+ IN+C + P  C Q C +    + C C  GY    ++  +C  +     + L         ++       H +   I        +LD  + R  M+F+S +  +                 +Y + I   N++ + +   ++++   A+D   N ++FTD +  +I + N        +V      P +I +DP+ G ++W D G     P+I+ A MDGS + T++  ++K P  + +D+ ++R+YW D   + I   + +   +  +    + + EY  HPFSI  F + +YW+D  +  ++ A+K TG+DV+ +        + ++       +     +     +C  V   C   CLP             PRI E+   +        + +++ G +C+    Y     R  R R TK +P+S R  +   VQ      +  ++DD            T ++D  P+ N+++ +   T    Q  S  +  V     S F     V L I Y++
Sbjct:  293 CANVTKTTTPCLSHEYQC--KDRITCLHHSWLCDGDRDCPDGDDEHTANCKNVTCRADQFQCGDRS-CIPGHLTCNGDKDCADGSDERDCGLSLSLGINQGGCNATSEFDCGGG---QCVPLSKVCDKRKDCPDGEDEPAGKCGINECASKNGGCMHQCIDLKVGHHCECHEGYKLSPDKRNCQDINEC-EVPGKCSQICVNEIGGFKCECEAGYMRDPKNHTRCKASEGHASLLLARRHDIRKIALD------HMEMTSIVNSTKAATALDF-VFRTGMIFWSDVTTQ----------------SIYKAPIDEGNEKTVVLTKSSVTSDGLAVDWIYNHVYFTDTHKCTIELTNFEGSMGKVLVKDSLDIPRSIALDPIEGWMYWSDWGAS---PRIERAGMDGSHRTTIISYDVKWPNGITLDLVKKRIYWVDGKLNVISSANYDGSQRSQV----LYSGEYLRHPFSITTFEDNVYWTDWDKQAVFKANKFTGEDVEPV------TAMHMLQHPMVVHVYHPYRQPDGVNHCQSVNGHCSHLCLP------------APRINER-SPRISCACPTGLKLMVDGLMCVEDPLYLPPVTRPPRARKTKPRPKSPRRRLPTGVQVGHADIRIEINDDLQLSTRLPLLPTTFVADQRPVKNHTQ-IEKTTTPSEQPDSGFIALVVIASLSGFAVLLSVLLLIGYRY 940          

HSP 2 Score: 50.8322 bits (120), Expect = 4.979e-6
Identity = 51/172 (29.65%), Postives = 76/172 (44.19%), Query Frame = 1
Query:   97 CHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNE---KTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCS-HICINKYSSFTCDCPPDMELSEDNRNC 597
            C+  C  D+  CG     +CI K W CD++ DC D SDE  CP + CD        +  CI +  +CDG  DC +  DE +C N+           Y C +  ++ C+    +C+ + +C    D    NCK   C+  +  C    CI  +   TC+   D     D R+C
Sbjct:  215 CNQTCRADEFTCGNG---RCIQKRWKCDHDDDCGDGSDEKECPVVPCDSVAEHTCTNGACIAKRWVCDGDPDCSDGSDERSCANVTKTTTPCLSHEYQCKD--RITCLHHSWLCDGDRDCPDGDDEHTANCKNVTCRADQFQCGDRSCIPGH--LTCNGDKDCADGSDERDC 379          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Fly
Match: LpR1 (gene:FBgn0066101 transcript:FBtr0301467)

HSP 1 Score: 191.815 bits (486), Expect = 9.510e-51
Identity = 167/705 (23.69%), Postives = 295/705 (41.84%), Query Frame = 1
Query:   79 CLNFYACHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDE--VNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCT-------NINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLEN-CKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYT---EHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSI--SNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYF-HPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVKPINLRIISKESNRQLIKKINEHKIGKYCSGVINTCRGSCLPNHDMPEMPKCFGIPRIEEKIRSKNQSLWLILIPVVILGFVCIVLFKY-----RFSRTRITK-QPESNRVFVYDSVQFYED--QNSLHDD-----------NTIISDTVPIINNSE*VFPVTVLLLQRFSTLVNFV-----SMFHYWKLVFLSIQYKF 2073
            C N       CL  ++ C       C+   W+CD ++DC D  DE   NC  + C  +QF+C D   CIP    C+G  DC +  DE +C        N   CN  + ++CG     +C+ +  +C+   +C   +D     C  + C +    C H CI+      C+C    +LS D RNC+ IN+C + P  C Q C +    + C C  GY    ++  +C  +     + L         ++       H +   I        +LD  + R  M+F+S +  +                 +Y + I   N++ + +   ++++   A+D   N ++FTD +  +I + N        +V      P +I +DP+ G ++W D G     P+I+ A MDGS + T++  ++K P  + +D+ ++R+YW D   + I   + +   +  +    + + EY  HPFSI  F + +YW+D  +  ++ A+K TG+DV+ +        + ++       +     +     +C  V   C   CLP             PRI E+   +        + +++ G +C+    Y     R  R R TK +P+S R  +   VQ      +  ++DD            T ++D  P+ N+++ +   T    Q  S  +  V     S F     V L I Y++
Sbjct:  334 CANVTKTTTPCLSHEYQC--KDRITCLHHSWLCDGDRDCPDGDDEHTANCKNVTCRADQFQCGDRS-CIPGHLTCNGDKDCADGSDERDCGLSLSLGINQGGCNATSEFDCGGG---QCVPLSKVCDKRKDCPDGEDEPAGKCGINECASKNGGCMHQCIDLKVGHHCECHEGYKLSPDKRNCQDINEC-EVPGKCSQICVNEIGGFKCECEAGYMRDPKNHTRCKASEGHASLLLARRHDIRKIALD------HMEMTSIVNSTKAATALDF-VFRTGMIFWSDVTTQ----------------SIYKAPIDEGNEKTVVLTKSSVTSDGLAVDWIYNHVYFTDTHKCTIELTNFEGSMGKVLVKDSLDIPRSIALDPIEGWMYWSDWGAS---PRIERAGMDGSHRTTIISYDVKWPNGITLDLVKKRIYWVDGKLNVISSANYDGSQRSQV----LYSGEYLRHPFSITTFEDNVYWTDWDKQAVFKANKFTGEDVEPV------TAMHMLQHPMVVHVYHPYRQPDGVNHCQSVNGHCSHLCLP------------APRINER-SPRISCACPTGLKLMVDGLMCVEDPLYLPPVTRPPRARKTKPRPKSPRRRLPTGVQVGHADIRIEINDDLQLSTRLPLLPTTFVADQRPVKNHTQ-IEKTTTPSEQPDSGFIALVVIASLSGFAVLLSVLLLIGYRY 981          

HSP 2 Score: 60.4622 bits (145), Expect = 5.552e-9
Identity = 67/216 (31.02%), Postives = 95/216 (43.98%), Query Frame = 1
Query:  109 CLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVN--CPPMICDKNQFKCPDSD-LCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKT-SENTCSH-ICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQ-GCQDN----GKSYNC----FCYDGYTEHDQKC 714
            C  D   CG  +   CI   W CD   DC D SDE N  C    C  +++ C   +  C+P   +CD   DC +  DE NC      +E   + CGN +   CI+    C+ + +C    D  E C    C + +E+TC++  CI K   + CD  PD     D R+C ++ K    P + H+  C+D       S+ C     C DG  EH   C
Sbjct:  179 CSSDQFRCGNGN---CIPNKWRCDQESDCADGSDEANELCRARTCSPDEYACKSGEGQCVPLAWMCDQSKDCSDGSDEHNCNQTCRADE---FTCGNGR---CIQKRWKCDHDDDCGDGSDEKE-CPVVPCDSVAEHTCTNGACIAKR--WVCDGDPDCSDGSDERSCANVTK-TTTPCLSHEYQCKDRITCLHHSWLCDGDRDCPDGDDEHTANC 381          

HSP 3 Score: 55.4546 bits (132), Expect = 1.589e-7
Identity = 50/211 (23.70%), Postives = 77/211 (36.49%), Query Frame = 1
Query:   97 CHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDS---------------------------------------DLCIPREKLCDGVNDCIENEDEWNCTNINSCNE---KTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCS-HICINKYSSFTCDCPPDMELSEDNRNC 597
            C  +    D Y  K+   QC+   W+CD ++DC D SDE NC    C  ++F C +                                          CI +  +CDG  DC +  DE +C N+           Y C +  ++ C+    +C+ + +C    D    NCK   C+  +  C    CI  +   TC+   D     D R+C
Sbjct:  215 CRARTCSPDEYACKSGEGQCVPLAWMCDQSKDCSDGSDEHNC-NQTCRADEFTCGNGRCIQKRWKCDHDDDCGDGSDEKECPVVPCDSVAEHTCTNGACIAKRWVCDGDPDCSDGSDERSCANVTKTTTPCLSHEYQCKD--RITCLHHSWLCDGDRDCPDGDDEHTANCKNVTCRADQFQCGDRSCIPGH--LTCNGDKDCADGSDERDC 420          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Fly
Match: LpR1 (gene:FBgn0066101 transcript:FBtr0301470)

HSP 1 Score: 191.815 bits (486), Expect = 1.253e-50
Identity = 167/705 (23.69%), Postives = 296/705 (41.99%), Query Frame = 1
Query:   79 CLNFYACHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDE--VNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCT-------NINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLEN-CKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYT---EHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSI--SNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYF-HPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVKPINLRIISKESNRQLIKKINEHKIGKYCSGVINTCRGSCLPNHDMPEMPKCFGIPRIEEKIRSKNQSLWLILIPVVILGFVCIVLFKY-----RFSRTRITK-QPESNRVFVYDSVQF--YEDQNSLHDD-----------NTIISDTVPIINNSE*VFPVTVLLLQRFSTLVNFV-----SMFHYWKLVFLSIQYKF 2073
            C N       CL  ++ C       C+   W+CD ++DC D  DE   NC  + C  +QF+C D   CIP    C+G  DC +  DE +C        N   CN  + ++CG     +C+ +  +C+   +C   +D     C  + C +    C H CI+      C+C    +LS D RNC+ IN+C + P  C Q C +    + C C  GY    ++  +C  +     + L         ++       H +   I        +LD  + R  M+F+S +  +                 +Y + I   N++ + +   ++++   A+D   N ++FTD +  +I + N        +V      P +I +DP+ G ++W D G     P+I+ A MDGS + T++  ++K P  + +D+ ++R+YW D   + I   + +   +  +    + + EY  HPFSI  F + +YW+D  +  ++ A+K TG+DV+ +        + ++       +     +     +C  V   C   CLP             PRI E+   +        + +++ G +C+    Y     R  R R TK +P+S R  +   VQ    + +  ++DD            T ++D  P+ N+++ +   T    Q  S  +  V     S F     V L I Y++
Sbjct:  373 CANVTKTTTPCLSHEYQC--KDRITCLHHSWLCDGDRDCPDGDDEHTANCKNVTCRADQFQCGDRS-CIPGHLTCNGDKDCADGSDERDCGLSLSLGINQGGCNATSEFDCGGG---QCVPLSKVCDKRKDCPDGEDEPAGKCGINECASKNGGCMHQCIDLKVGHHCECHEGYKLSPDKRNCQDINEC-EVPGKCSQICVNEIGGFKCECEAGYMRDPKNHTRCKASEGHASLLLARRHDIRKIALD------HMEMTSIVNSTKAATALDF-VFRTGMIFWSDVTTQ----------------SIYKAPIDEGNEKTVVLTKSSVTSDGLAVDWIYNHVYFTDTHKCTIELTNFEGSMGKVLVKDSLDIPRSIALDPIEGWMYWSDWGAS---PRIERAGMDGSHRTTIISYDVKWPNGITLDLVKKRIYWVDGKLNVISSANYDGSQRSQV----LYSGEYLRHPFSITTFEDNVYWTDWDKQAVFKANKFTGEDVEPV------TAMHMLQHPMVVHVYHPYRQPDGVNHCQSVNGHCSHLCLP------------APRINER-SPRISCACPTGLKLMVDGLMCVEDPLYLPPVTRPPRARKTKPRPKSPRRRLPTGVQVGHADIRIEINDDLQLSTRLPLLPTTFVADQRPVKNHTQ-IEKTTTPSEQPDSGFIALVVIASLSGFAVLLSVLLLIGYRY 1020          

HSP 2 Score: 72.0182 bits (175), Expect = 1.496e-12
Identity = 74/251 (29.48%), Postives = 98/251 (39.04%), Query Frame = 1
Query:  109 CLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPM-ICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCS------------------------------------HICINKY---SSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQ-GCQDN----GKSYNC----FCYDGYTEHDQKC 714
            C  D   CG  +   CI   W CD   DC D SDE N   M  C  N+FKC   D CIPR  LCDG NDC +  DE +C    +C+    Y C  + + +C+ +  +C+ + +CS   D   NC    C+  E TC                                     H C N       + CD  PD     D R+C ++ K    P + H+  C+D       S+ C     C DG  EH   C
Sbjct:  179 CSSDQFRCGNGN---CIPNKWRCDQESDCADGSDEANELCMNACPNNEFKCQTVDQCIPRSWLCDGSNDCRDKSDEAHC-RARTCSPD-EYAC-KSGEGQCVPLAWMCDQSKDCSDGSDE-HNCN-QTCRADEFTCGNGRCIQKRWKCDHDDDCGDGSDEKECPVVPCDSVAEHTCTNGACIAKRWVCDGDPDCSDGSDERSCANVTK-TTTPCLSHEYQCKDRITCLHHSWLCDGDRDCPDGDDEHTANC 420          

HSP 3 Score: 55.0694 bits (131), Expect = 2.396e-7
Identity = 50/211 (23.70%), Postives = 77/211 (36.49%), Query Frame = 1
Query:   97 CHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDS---------------------------------------DLCIPREKLCDGVNDCIENEDEWNCTNINSCNE---KTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCS-HICINKYSSFTCDCPPDMELSEDNRNC 597
            C  +    D Y  K+   QC+   W+CD ++DC D SDE NC    C  ++F C +                                          CI +  +CDG  DC +  DE +C N+           Y C +  ++ C+    +C+ + +C    D    NCK   C+  +  C    CI  +   TC+   D     D R+C
Sbjct:  254 CRARTCSPDEYACKSGEGQCVPLAWMCDQSKDCSDGSDEHNC-NQTCRADEFTCGNGRCIQKRWKCDHDDDCGDGSDEKECPVVPCDSVAEHTCTNGACIAKRWVCDGDPDCSDGSDERSCANVTKTTTPCLSHEYQCKD--RITCLHHSWLCDGDRDCPDGDDEHTANCKNVTCRADQFQCGDRSCIPGH--LTCNGDKDCADGSDERDC 459          

HSP 4 Score: 52.7582 bits (125), Expect = 1.274e-6
Identity = 51/172 (29.65%), Postives = 70/172 (40.70%), Query Frame = 1
Query:  154 CISKLWVCDYNQDCDDNSDE---------------------VNCPP-----------------------MICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI-CINK 534
            CI   +VCD + DC D+SDE                      NC P                         C  N+FKC   D CIPR  LCDG NDC +  DE +C    +C+    Y C  + + +C+ +  +C+ + +CS   D   NC    C+  E TC +  CI K
Sbjct:  148 CIPIRFVCDGDADCKDHSDEQIKECKFIEATCSSDQFRCGNGNCIPNKWRCDQESDCADGSDEANELCMNACPNNEFKCQTVDQCIPRSWLCDGSNDCRDKSDEAHC-RARTCSPD-EYAC-KSGEGQCVPLAWMCDQSKDCSDGSDE-HNCN-QTCRADEFTCGNGRCIQK 314          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Zebrafish
Match: vldlr (very low density lipoprotein receptor [Source:ZFIN;Acc:ZDB-GENE-040426-803])

HSP 1 Score: 197.208 bits (500), Expect = 7.846e-53
Identity = 137/484 (28.31%), Postives = 227/484 (46.90%), Query Frame = 1
Query:  106 KCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKA-KEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLS----AFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYF-HPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            KC   +  CG     +CI + W CD + DC D SDE NC    C  +QFKC D   CI   + C+G  DC++  DE NC N+  CN    + C   +  ECI++  +CN   +C    D  ++ C  + C  +   CSHIC +    F CDC P ++L  D + C  +N+C  NP +C Q C +    Y C C++GY        PTT   +               I  L    +   +I     +  +LD +  + +M+F++ L  K                    S++ +KQ+ E + K +         A+D     ++++D    SI V N     K  + +     P +I +DP+ G L+W D G      KI+ + M+G+ +  L+E +I+ P  + +D+ + RLYW D     +  +D+N  ++  +    + + +Y  HPF++ +F +R++W+D +   IY A+K TG DV ++
Sbjct:  234 KCSPSEMQCGSG---ECIHRKWRCDGDPDCKDGSDEKNCSARNCRPDQFKCDDGS-CIHGSRQCNGFRDCVDGTDEVNCKNLTQCNSSDQFKC---RSGECIEMSKVCNKVRDCPDWSDEPIKECNMNECLINNGGCSHICRDLTIGFECDCTPGLQLI-DRKTCGDVNECL-NPGICSQICINLKGGYKCECHNGYQMD-----PTTGVCKAVGKEPCLIFTNRRDIRKLGLERREYTQIVEQLRNTVALDADFIQ-QMIFWADLGQK-----------------AIFSTVLDKQD-ESHKKVIDDVQMPVGIAVDWIYKNIYWSDLGSKSITVANFNGTKKKVLFNSGLKEPASIAVDPLSGFLYWSDWGEP---AKIEKSGMNGNDRQVLVETDIQWPNGITLDLIKGRLYWVDSKLHMLCSVDLNGDNRRKV----LQSPDYLAHPFALTVFEDRVFWTDGENEAIYGANKFTGSDVTLL 677          

HSP 2 Score: 65.855 bits (159), Expect = 1.279e-10
Identity = 55/183 (30.05%), Postives = 82/183 (44.81%), Query Frame = 1
Query:   76 ICLNFY----ACHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKT----HYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNC 597
            +C   +    A   +C Q    CG     +CI  +W CD + DC D SDE +C    C +  F C  S  CIP+   CDG  DC +  DE    +I  C+ +T     ++CG     +CI +   C+   +C   +D + NC    C   E TCS   C+++   F C+   D     D ++C
Sbjct:   14 VCFQLWGFSRASRAECEQSQFQCGNG---RCIPSVWQCDGDMDCSDGSDETSCVRKTCAEVDFVC-RSGQCIPKRWQCDGEPDCEDGSDE----SIEMCHTRTCRVNEFSCG-VGSTQCIPVFWKCDGEKDCDNGEDEI-NCGNITCAPLEFTCSSGRCVSR--KFVCNGEDDCGDGSDEQDC 184          

HSP 3 Score: 62.003 bits (149), Expect = 1.950e-9
Identity = 67/212 (31.60%), Postives = 97/212 (45.75%), Query Frame = 1
Query:   97 CHFK-CLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDI-CNTNINCSTNKDSLENCKAD-----FCKTSENTC-SHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQG-CQDNGKSYNCF--CYDGYTE 699
            CH + C  ++  CG  S  QCI   W CD  +DCD+  DE+NC  + C   +F C  S  C+ R+ +C+G +DC +  DE +C   +SC+  +   CGN     CI    +  +       + +S E C  +      C  SE  C S  CI++   + CD  PD +   D +NC   N C  +   C  G C    +  N F  C DG  E
Sbjct:  104 CHTRTCRVNEFSCGVGST-QCIPVFWKCDGEKDCDNGEDEINCGNITCAPLEFTC-SSGRCVSRKFVCNGEDDCGDGSDEQDCAP-SSCS-PSEIPCGNNT---CIPRSWLCDDDVDCQDQSDESPERCGHNPTPPAKCSPSEMQCGSGECIHR--KWRCDGDPDCKDGSDEKNCSARN-CRPDQFKCDDGSCIHGSRQCNGFRDCVDGTDE 305          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Zebrafish
Match: vldlr (very low density lipoprotein receptor [Source:ZFIN;Acc:ZDB-GENE-040426-803])

HSP 1 Score: 197.208 bits (500), Expect = 9.546e-53
Identity = 137/484 (28.31%), Postives = 227/484 (46.90%), Query Frame = 1
Query:  106 KCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKA-KEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLS----AFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYF-HPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            KC   +  CG     +CI + W CD + DC D SDE NC    C  +QFKC D   CI   + C+G  DC++  DE NC N+  CN    + C   +  ECI++  +CN   +C    D  ++ C  + C  +   CSHIC +    F CDC P ++L  D + C  +N+C  NP +C Q C +    Y C C++GY        PTT   +               I  L    +   +I     +  +LD +  + +M+F++ L  K                    S++ +KQ+ E + K +         A+D     ++++D    SI V N     K  + +     P +I +DP+ G L+W D G      KI+ + M+G+ +  L+E +I+ P  + +D+ + RLYW D     +  +D+N  ++  +    + + +Y  HPF++ +F +R++W+D +   IY A+K TG DV ++
Sbjct:  234 KCSPSEMQCGSG---ECIHRKWRCDGDPDCKDGSDEKNCSARNCRPDQFKCDDGS-CIHGSRQCNGFRDCVDGTDEVNCKNLTQCNSSDQFKC---RSGECIEMSKVCNKVRDCPDWSDEPIKECNMNECLINNGGCSHICRDLTIGFECDCTPGLQLI-DRKTCGDVNECL-NPGICSQICINLKGGYKCECHNGYQMD-----PTTGVCKAVGKEPCLIFTNRRDIRKLGLERREYTQIVEQLRNTVALDADFIQ-QMIFWADLGQK-----------------AIFSTVLDKQD-ESHKKVIDDVQMPVGIAVDWIYKNIYWSDLGSKSITVANFNGTKKKVLFNSGLKEPASIAVDPLSGFLYWSDWGEP---AKIEKSGMNGNDRQVLVETDIQWPNGITLDLIKGRLYWVDSKLHMLCSVDLNGDNRRKV----LQSPDYLAHPFALTVFEDRVFWTDGENEAIYGANKFTGSDVTLL 677          

HSP 2 Score: 65.855 bits (159), Expect = 1.325e-10
Identity = 55/183 (30.05%), Postives = 82/183 (44.81%), Query Frame = 1
Query:   76 ICLNFY----ACHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKT----HYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNC 597
            +C   +    A   +C Q    CG     +CI  +W CD + DC D SDE +C    C +  F C  S  CIP+   CDG  DC +  DE    +I  C+ +T     ++CG     +CI +   C+   +C   +D + NC    C   E TCS   C+++   F C+   D     D ++C
Sbjct:   14 VCFQLWGFSRASRAECEQSQFQCGNG---RCIPSVWQCDGDMDCSDGSDETSCVRKTCAEVDFVC-RSGQCIPKRWQCDGEPDCEDGSDE----SIEMCHTRTCRVNEFSCG-VGSTQCIPVFWKCDGEKDCDNGEDEI-NCGNITCAPLEFTCSSGRCVSR--KFVCNGEDDCGDGSDEQDC 184          

HSP 3 Score: 62.003 bits (149), Expect = 2.108e-9
Identity = 67/212 (31.60%), Postives = 97/212 (45.75%), Query Frame = 1
Query:   97 CHFK-CLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDI-CNTNINCSTNKDSLENCKAD-----FCKTSENTC-SHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQG-CQDNGKSYNCF--CYDGYTE 699
            CH + C  ++  CG  S  QCI   W CD  +DCD+  DE+NC  + C   +F C  S  C+ R+ +C+G +DC +  DE +C   +SC+  +   CGN     CI    +  +       + +S E C  +      C  SE  C S  CI++   + CD  PD +   D +NC   N C  +   C  G C    +  N F  C DG  E
Sbjct:  104 CHTRTCRVNEFSCGVGST-QCIPVFWKCDGEKDCDNGEDEINCGNITCAPLEFTC-SSGRCVSRKFVCNGEDDCGDGSDEQDCA-PSSCS-PSEIPCGNNT---CIPRSWLCDDDVDCQDQSDESPERCGHNPTPPAKCSPSEMQCGSGECIHR--KWRCDGDPDCKDGSDEKNCSARN-CRPDQFKCDDGSCIHGSRQCNGFRDCVDGTDE 305          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Zebrafish
Match: vldlr (very low density lipoprotein receptor [Source:ZFIN;Acc:ZDB-GENE-040426-803])

HSP 1 Score: 197.208 bits (500), Expect = 1.018e-52
Identity = 137/484 (28.31%), Postives = 227/484 (46.90%), Query Frame = 1
Query:  106 KCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKA-KEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLS----AFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYF-HPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            KC   +  CG     +CI + W CD + DC D SDE NC    C  +QFKC D   CI   + C+G  DC++  DE NC N+  CN    + C   +  ECI++  +CN   +C    D  ++ C  + C  +   CSHIC +    F CDC P ++L  D + C  +N+C  NP +C Q C +    Y C C++GY        PTT   +               I  L    +   +I     +  +LD +  + +M+F++ L  K                    S++ +KQ+ E + K +         A+D     ++++D    SI V N     K  + +     P +I +DP+ G L+W D G      KI+ + M+G+ +  L+E +I+ P  + +D+ + RLYW D     +  +D+N  ++  +    + + +Y  HPF++ +F +R++W+D +   IY A+K TG DV ++
Sbjct:  234 KCSPSEMQCGSG---ECIHRKWRCDGDPDCKDGSDEKNCSARNCRPDQFKCDDGS-CIHGSRQCNGFRDCVDGTDEVNCKNLTQCNSSDQFKC---RSGECIEMSKVCNKVRDCPDWSDEPIKECNMNECLINNGGCSHICRDLTIGFECDCTPGLQLI-DRKTCGDVNECL-NPGICSQICINLKGGYKCECHNGYQMD-----PTTGVCKAVGKEPCLIFTNRRDIRKLGLERREYTQIVEQLRNTVALDADFIQ-QMIFWADLGQK-----------------AIFSTVLDKQD-ESHKKVIDDVQMPVGIAVDWIYKNIYWSDLGSKSITVANFNGTKKKVLFNSGLKEPASIAVDPLSGFLYWSDWGEP---AKIEKSGMNGNDRQVLVETDIQWPNGITLDLIKGRLYWVDSKLHMLCSVDLNGDNRRKV----LQSPDYLAHPFALTVFEDRVFWTDGENEAIYGANKFTGSDVTLL 677          

HSP 2 Score: 65.855 bits (159), Expect = 1.238e-10
Identity = 55/183 (30.05%), Postives = 82/183 (44.81%), Query Frame = 1
Query:   76 ICLNFY----ACHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKT----HYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNC 597
            +C   +    A   +C Q    CG     +CI  +W CD + DC D SDE +C    C +  F C  S  CIP+   CDG  DC +  DE    +I  C+ +T     ++CG     +CI +   C+   +C   +D + NC    C   E TCS   C+++   F C+   D     D ++C
Sbjct:   14 VCFQLWGFSRASRAECEQSQFQCGNG---RCIPSVWQCDGDMDCSDGSDETSCVRKTCAEVDFVC-RSGQCIPKRWQCDGEPDCEDGSDE----SIEMCHTRTCRVNEFSCG-VGSTQCIPVFWKCDGEKDCDNGEDEI-NCGNITCAPLEFTCSSGRCVSR--KFVCNGEDDCGDGSDEQDC 184          

HSP 3 Score: 62.3882 bits (150), Expect = 1.855e-9
Identity = 67/212 (31.60%), Postives = 97/212 (45.75%), Query Frame = 1
Query:   97 CHFK-CLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDI-CNTNINCSTNKDSLENCKAD-----FCKTSENTC-SHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQG-CQDNGKSYNCF--CYDGYTE 699
            CH + C  ++  CG  S  QCI   W CD  +DCD+  DE+NC  + C   +F C  S  C+ R+ +C+G +DC +  DE +C   +SC+  +   CGN     CI    +  +       + +S E C  +      C  SE  C S  CI++   + CD  PD +   D +NC   N C  +   C  G C    +  N F  C DG  E
Sbjct:  104 CHTRTCRVNEFSCGVGST-QCIPVFWKCDGEKDCDNGEDEINCGNITCAPLEFTC-SSGRCVSRKFVCNGEDDCGDGSDEQDCAP-SSCS-PSEIPCGNNT---CIPRSWLCDDDVDCQDQSDESPERCGHNPTPPAKCSPSEMQCGSGECIHR--KWRCDGDPDCKDGSDEKNCSARN-CRPDQFKCDDGSCIHGSRQCNGFRDCVDGTDE 305          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Zebrafish
Match: vldlr (very low density lipoprotein receptor [Source:ZFIN;Acc:ZDB-GENE-040426-803])

HSP 1 Score: 197.208 bits (500), Expect = 1.050e-52
Identity = 137/484 (28.31%), Postives = 227/484 (46.90%), Query Frame = 1
Query:  106 KCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKA-KEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLS----AFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYF-HPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            KC   +  CG     +CI + W CD + DC D SDE NC    C  +QFKC D   CI   + C+G  DC++  DE NC N+  CN    + C   +  ECI++  +CN   +C    D  ++ C  + C  +   CSHIC +    F CDC P ++L  D + C  +N+C  NP +C Q C +    Y C C++GY        PTT   +               I  L    +   +I     +  +LD +  + +M+F++ L  K                    S++ +KQ+ E + K +         A+D     ++++D    SI V N     K  + +     P +I +DP+ G L+W D G      KI+ + M+G+ +  L+E +I+ P  + +D+ + RLYW D     +  +D+N  ++  +    + + +Y  HPF++ +F +R++W+D +   IY A+K TG DV ++
Sbjct:  234 KCSPSEMQCGSG---ECIHRKWRCDGDPDCKDGSDEKNCSARNCRPDQFKCDDGS-CIHGSRQCNGFRDCVDGTDEVNCKNLTQCNSSDQFKC---RSGECIEMSKVCNKVRDCPDWSDEPIKECNMNECLINNGGCSHICRDLTIGFECDCTPGLQLI-DRKTCGDVNECL-NPGICSQICINLKGGYKCECHNGYQMD-----PTTGVCKAVGKEPCLIFTNRRDIRKLGLERREYTQIVEQLRNTVALDADFIQ-QMIFWADLGQK-----------------AIFSTVLDKQD-ESHKKVIDDVQMPVGIAVDWIYKNIYWSDLGSKSITVANFNGTKKKVLFNSGLKEPASIAVDPLSGFLYWSDWGEP---AKIEKSGMNGNDRQVLVETDIQWPNGITLDLIKGRLYWVDSKLHMLCSVDLNGDNRRKV----LQSPDYLAHPFALTVFEDRVFWTDGENEAIYGANKFTGSDVTLL 677          

HSP 2 Score: 65.855 bits (159), Expect = 1.209e-10
Identity = 55/183 (30.05%), Postives = 82/183 (44.81%), Query Frame = 1
Query:   76 ICLNFY----ACHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKT----HYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNC 597
            +C   +    A   +C Q    CG     +CI  +W CD + DC D SDE +C    C +  F C  S  CIP+   CDG  DC +  DE    +I  C+ +T     ++CG     +CI +   C+   +C   +D + NC    C   E TCS   C+++   F C+   D     D ++C
Sbjct:   14 VCFQLWGFSRASRAECEQSQFQCGNG---RCIPSVWQCDGDMDCSDGSDETSCVRKTCAEVDFVC-RSGQCIPKRWQCDGEPDCEDGSDE----SIEMCHTRTCRVNEFSCG-VGSTQCIPVFWKCDGEKDCDNGEDEI-NCGNITCAPLEFTCSSGRCVSR--KFVCNGEDDCGDGSDEQDC 184          

HSP 3 Score: 62.3882 bits (150), Expect = 1.795e-9
Identity = 67/212 (31.60%), Postives = 97/212 (45.75%), Query Frame = 1
Query:   97 CHFK-CLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDI-CNTNINCSTNKDSLENCKAD-----FCKTSENTC-SHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQG-CQDNGKSYNCF--CYDGYTE 699
            CH + C  ++  CG  S  QCI   W CD  +DCD+  DE+NC  + C   +F C  S  C+ R+ +C+G +DC +  DE +C   +SC+  +   CGN     CI    +  +       + +S E C  +      C  SE  C S  CI++   + CD  PD +   D +NC   N C  +   C  G C    +  N F  C DG  E
Sbjct:  104 CHTRTCRVNEFSCGVGST-QCIPVFWKCDGEKDCDNGEDEINCGNITCAPLEFTC-SSGRCVSRKFVCNGEDDCGDGSDEQDCA-PSSCS-PSEIPCGNNT---CIPRSWLCDDDVDCQDQSDESPERCGHNPTPPAKCSPSEMQCGSGECIHR--KWRCDGDPDCKDGSDEKNCSARN-CRPDQFKCDDGSCIHGSRQCNGFRDCVDGTDE 305          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Zebrafish
Match: vldlr (very low density lipoprotein receptor [Source:ZFIN;Acc:ZDB-GENE-040426-803])

HSP 1 Score: 197.208 bits (500), Expect = 1.055e-52
Identity = 137/484 (28.31%), Postives = 227/484 (46.90%), Query Frame = 1
Query:  106 KCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKA-KEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLS----AFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYF-HPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            KC   +  CG     +CI + W CD + DC D SDE NC    C  +QFKC D   CI   + C+G  DC++  DE NC N+  CN    + C   +  ECI++  +CN   +C    D  ++ C  + C  +   CSHIC +    F CDC P ++L  D + C  +N+C  NP +C Q C +    Y C C++GY        PTT   +               I  L    +   +I     +  +LD +  + +M+F++ L  K                    S++ +KQ+ E + K +         A+D     ++++D    SI V N     K  + +     P +I +DP+ G L+W D G      KI+ + M+G+ +  L+E +I+ P  + +D+ + RLYW D     +  +D+N  ++  +    + + +Y  HPF++ +F +R++W+D +   IY A+K TG DV ++
Sbjct:  234 KCSPSEMQCGSG---ECIHRKWRCDGDPDCKDGSDEKNCSARNCRPDQFKCDDGS-CIHGSRQCNGFRDCVDGTDEVNCKNLTQCNSSDQFKC---RSGECIEMSKVCNKVRDCPDWSDEPIKECNMNECLINNGGCSHICRDLTIGFECDCTPGLQLI-DRKTCGDVNECL-NPGICSQICINLKGGYKCECHNGYQMD-----PTTGVCKAVGKEPCLIFTNRRDIRKLGLERREYTQIVEQLRNTVALDADFIQ-QMIFWADLGQK-----------------AIFSTVLDKQD-ESHKKVIDDVQMPVGIAVDWIYKNIYWSDLGSKSITVANFNGTKKKVLFNSGLKEPASIAVDPLSGFLYWSDWGEP---AKIEKSGMNGNDRQVLVETDIQWPNGITLDLIKGRLYWVDSKLHMLCSVDLNGDNRRKV----LQSPDYLAHPFALTVFEDRVFWTDGENEAIYGANKFTGSDVTLL 677          

HSP 2 Score: 66.2402 bits (160), Expect = 1.192e-10
Identity = 55/183 (30.05%), Postives = 82/183 (44.81%), Query Frame = 1
Query:   76 ICLNFY----ACHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKT----HYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNC 597
            +C   +    A   +C Q    CG     +CI  +W CD + DC D SDE +C    C +  F C  S  CIP+   CDG  DC +  DE    +I  C+ +T     ++CG     +CI +   C+   +C   +D + NC    C   E TCS   C+++   F C+   D     D ++C
Sbjct:   14 VCFQLWGFSRASRAECEQSQFQCGNG---RCIPSVWQCDGDMDCSDGSDETSCVRKTCAEVDFVC-RSGQCIPKRWQCDGEPDCEDGSDE----SIEMCHTRTCRVNEFSCG-VGSTQCIPVFWKCDGEKDCDNGEDEI-NCGNITCAPLEFTCSSGRCVSR--KFVCNGEDDCGDGSDEQDC 184          

HSP 3 Score: 62.3882 bits (150), Expect = 1.818e-9
Identity = 67/212 (31.60%), Postives = 97/212 (45.75%), Query Frame = 1
Query:   97 CHFK-CLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDI-CNTNINCSTNKDSLENCKAD-----FCKTSENTC-SHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQG-CQDNGKSYNCF--CYDGYTE 699
            CH + C  ++  CG  S  QCI   W CD  +DCD+  DE+NC  + C   +F C  S  C+ R+ +C+G +DC +  DE +C   +SC+  +   CGN     CI    +  +       + +S E C  +      C  SE  C S  CI++   + CD  PD +   D +NC   N C  +   C  G C    +  N F  C DG  E
Sbjct:  104 CHTRTCRVNEFSCGVGST-QCIPVFWKCDGEKDCDNGEDEINCGNITCAPLEFTC-SSGRCVSRKFVCNGEDDCGDGSDEQDCAP-SSCS-PSEIPCGNNT---CIPRSWLCDDDVDCQDQSDESPERCGHNPTPPAKCSPSEMQCGSGECIHR--KWRCDGDPDCKDGSDEKNCSARN-CRPDQFKCDDGSCIHGSRQCNGFRDCVDGTDE 305          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Xenopus
Match: VLDLR (very low density lipoprotein receptor [Source:NCBI gene;Acc:733485])

HSP 1 Score: 199.519 bits (506), Expect = 1.709e-53
Identity = 136/488 (27.87%), Postives = 226/488 (46.31%), Query Frame = 1
Query:  106 KCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMV-----FYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNL----SAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNI-KTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            KC  ++  CG     +CI K W CD + DC D SDE+NCP   C  +QFKC D + CI   + CDGV DC++  DE  C N+N C+    + C   +  ECI I  +CN   +C    D  ++ C  + C+ +   CSH+C N    + CDC    +L  D + C  I++C +NPE+C Q C +    Y C C  GY       V      E  L                        IF  + DI    V L R E +       +++    ++ + S      +   ++ +    ++ +  ++K +    S  + A+D     +++ D    +I V N     +  + +     P +I +DP+ G ++W D G      KI+ A M+G  +   +  ++++P  +AID+ + RLYW D     +  +D+N L +  I K+   LA    HP ++ IF +R+YW D +   IY A+K +G++++ +
Sbjct:  226 KCSANEMPCGSG---ECIHKKWRCDGDPDCKDKSDEMNCPSRTCQPDQFKCEDGN-CIHGSRQCDGVRDCLDGTDEIRCKNVNQCSGPGKFKC---RSGECIDIAKVCNKQKDCKDWSDEPIKECYVNECEVNNGGCSHLCHNLVIGYECDCTAGFKLI-DRKTCGDIDEC-QNPEICSQICVNLKGGYKCECSKGYQMDPSTGVCKAVGKEPCL------------------------IFTNRRDIRK--VGLERKEYIQLVEQLRNTVALDADIKEQSLFWADTIQKAIFRAPFDTREKVGTHIKVVEDVHSPSAIAIDWIYKNIYWMDTGLKTISVSNFDGSKRKTLFNSGLQDPTSIAVDPISGFIYWSDWGEP---AKIEKAGMNGIDRQQFVTADVQRPSGIAIDVVKSRLYWVDSKLHTLSSVDLNGLDRRVILKSHEFLA----HPLALTIFEDRVYWIDGENEAIYGANKFSGQELETL 671          

HSP 2 Score: 72.4034 bits (176), Expect = 1.773e-12
Identity = 53/151 (35.10%), Postives = 76/151 (50.33%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDE-WNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNC 597
             CI+ LW CD ++DC D SDE +C    C +  F C ++ LC+PR   CDG  DC +  DE     ++ +C   T  +CG  +  +CI +   C+   +C   +D  ENC    C  +E TCS   CI+  S+F C+   D     D  NC
Sbjct:   32 HCITSLWKCDGDEDCSDGSDESSCVKKTCAETDFVC-NNGLCVPRRWECDGDPDCEDGSDETAELCHMRTC-RATEISCG-ARSTQCIPLSWKCDGESDCPNAEDE-ENCGNITCSPAEFTCSSGRCIS--STFVCNGQNDCSDGSDEENC 176          

HSP 3 Score: 67.0106 bits (162), Expect = 7.474e-11
Identity = 59/175 (33.71%), Postives = 81/175 (46.29%), Query Frame = 1
Query:   97 CHFK-CLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKD-SLENC-----KADFCKTSENTC-SHICINKYSSFTCDCPPDMELSEDNRNC 597
            CH + C   +  CG  S  QCI   W CD   DC +  DE NC  + C   +F C  S  CI    +C+G NDC +  DE NC    +C     + C N+    CI +  +C+ + +C+ + D SLE C         C  +E  C S  CI+K   + CD  PD +   D  NC
Sbjct:   96 CHMRTCRATEISCGARST-QCIPLSWKCDGESDCPNAEDEENCGNITCSPAEFTC-SSGRCISSTFVCNGQNDCSDGSDEENCVP-PTCGAH-EFQCKNSS---CIPLNWVCDDDSDCADHSDESLEQCGRQPIAPQKCSANEMPCGSGECIHK--KWRCDGDPDCKDKSDEMNC 261          

HSP 4 Score: 63.5438 bits (153), Expect = 1.151e-9
Identity = 52/161 (32.30%), Postives = 76/161 (47.20%), Query Frame = 1
Query:  142 SFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEW--NCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNCKHINKC 615
            S  +CIS  +VC+   DC D SDE NC P  C  ++F+C +S  CIP   +CD  +DC ++ DE    C       +K   N       ECI  +  C+ + +C    D + NC +  C+  +  C    CI  + S  CD   D     D   CK++N+C
Sbjct:  150 SSGRCISSTFVCNGQNDCSDGSDEENCVPPTCGAHEFQCKNSS-CIPLNWVCDDDSDCADHSDESLEQCGRQPIAPQKCSANEMPCGSGECIHKKWRCDGDPDCKDKSDEM-NCPSRTCQPDQFKCEDGNCI--HGSRQCDGVRDCLDGTDEIRCKNVNQC 306          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Xenopus
Match: VLDLR (very low density lipoprotein receptor [Source:NCBI gene;Acc:733485])

HSP 1 Score: 199.519 bits (506), Expect = 2.303e-53
Identity = 135/488 (27.66%), Postives = 227/488 (46.52%), Query Frame = 1
Query:  106 KCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMV-----FYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNL----SAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLS-QLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            KC  ++  CG     +CI K W CD + DC D SDE+NCP   C  +QFKC D + CI   + CDGV DC++  DE  C N+N C+    + C   +  ECI I  +CN   +C    D  ++ C  + C+ +   CSH+C N    + CDC    +L  D + C  I++C +NPE+C Q C +    Y C C  GY       V      E  L                        IF  + DI    V L R E +       +++    ++ + S      +   ++ +    ++ +  ++K +    S  + A+D     +++ D    +I V N     +  + +     P +I +DP+ G ++W D G      KI+ A M+G  +   +  ++++P  +AID+ + RLYW D     +  +D+N L  ++ +K+   LA    HP ++ IF +R+YW D +   IY A+K +G++++ +
Sbjct:  236 KCSANEMPCGSG---ECIHKKWRCDGDPDCKDKSDEMNCPSRTCQPDQFKCEDGN-CIHGSRQCDGVRDCLDGTDEIRCKNVNQCSGPGKFKC---RSGECIDIAKVCNKQKDCKDWSDEPIKECYVNECEVNNGGCSHLCHNLVIGYECDCTAGFKLI-DRKTCGDIDEC-QNPEICSQICVNLKGGYKCECSKGYQMDPSTGVCKAVGKEPCL------------------------IFTNRRDIRK--VGLERKEYIQLVEQLRNTVALDADIKEQSLFWADTIQKAIFRAPFDTREKVGTHIKVVEDVHSPSAIAIDWIYKNIYWMDTGLKTISVSNFDGSKRKTLFNSGLQDPTSIAVDPISGFIYWSDWGEP---AKIEKAGMNGIDRQQFVTADVQRPSGIAIDVVKSRLYWVDSKLHTLSSVDLNGLDRRVILKSHEFLA----HPLALTIFEDRVYWIDGENEAIYGANKFSGQELETL 681          

HSP 2 Score: 72.7886 bits (177), Expect = 1.542e-12
Identity = 53/151 (35.10%), Postives = 76/151 (50.33%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDE-WNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNC 597
             CI+ LW CD ++DC D SDE +C    C +  F C ++ LC+PR   CDG  DC +  DE     ++ +C   T  +CG  +  +CI +   C+   +C   +D  ENC    C  +E TCS   CI+  S+F C+   D     D  NC
Sbjct:   42 HCITSLWKCDGDEDCSDGSDESSCVKKTCAETDFVC-NNGLCVPRRWECDGDPDCEDGSDETAELCHMRTC-RATEISCG-ARSTQCIPLSWKCDGESDCPNAEDE-ENCGNITCSPAEFTCSSGRCIS--STFVCNGQNDCSDGSDEENC 186          

HSP 3 Score: 67.3958 bits (163), Expect = 6.665e-11
Identity = 59/175 (33.71%), Postives = 81/175 (46.29%), Query Frame = 1
Query:   97 CHFK-CLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKD-SLENC-----KADFCKTSENTC-SHICINKYSSFTCDCPPDMELSEDNRNC 597
            CH + C   +  CG  S  QCI   W CD   DC +  DE NC  + C   +F C  S  CI    +C+G NDC +  DE NC    +C     + C N+    CI +  +C+ + +C+ + D SLE C         C  +E  C S  CI+K   + CD  PD +   D  NC
Sbjct:  106 CHMRTCRATEISCGARST-QCIPLSWKCDGESDCPNAEDEENCGNITCSPAEFTC-SSGRCISSTFVCNGQNDCSDGSDEENCVP-PTCGAH-EFQCKNSS---CIPLNWVCDDDSDCADHSDESLEQCGRQPIAPQKCSANEMPCGSGECIHK--KWRCDGDPDCKDKSDEMNC 271          

HSP 4 Score: 63.5438 bits (153), Expect = 1.034e-9
Identity = 52/161 (32.30%), Postives = 76/161 (47.20%), Query Frame = 1
Query:  142 SFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEW--NCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNCKHINKC 615
            S  +CIS  +VC+   DC D SDE NC P  C  ++F+C +S  CIP   +CD  +DC ++ DE    C       +K   N       ECI  +  C+ + +C    D + NC +  C+  +  C    CI  + S  CD   D     D   CK++N+C
Sbjct:  160 SSGRCISSTFVCNGQNDCSDGSDEENCVPPTCGAHEFQCKNSS-CIPLNWVCDDDSDCADHSDESLEQCGRQPIAPQKCSANEMPCGSGECIHKKWRCDGDPDCKDKSDEM-NCPSRTCQPDQFKCEDGNCI--HGSRQCDGVRDCLDGTDEIRCKNVNQC 316          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Xenopus
Match: VLDLR (very low density lipoprotein receptor [Source:NCBI gene;Acc:733485])

HSP 1 Score: 199.134 bits (505), Expect = 2.511e-53
Identity = 135/480 (28.12%), Postives = 229/480 (47.71%), Query Frame = 1
Query:  106 KCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAK-EIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLS-QLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            KC  ++  CG     +CI K W CD + DC D SDE+NCP   C  +QFKC D + CI   + CDGV DC++  DE  C N+N C+    + C   +  ECI I  +CN   +C    D  ++ C  + C+ +   CSH+C N    + CDC    +L  D + C  I++C +NPE+C Q C +    Y C C  GY        P+T   +               I  +    K   ++     +  +LD ++ + + +F++  + K     V  LQ          S++     +  ++ + SA   A+D     +++ D    +I V N     +  + +     P +I +DP+ G ++W D G      KI+ A M+G  +   +  ++++P  +AID+ + RLYW D     +  +D+N L  ++ +K+   LA    HP ++ IF +R+YW D +   IY A+K +G++++ +
Sbjct:  236 KCSANEMPCGSG---ECIHKKWRCDGDPDCKDKSDEMNCPSRTCQPDQFKCEDGN-CIHGSRQCDGVRDCLDGTDEIRCKNVNQCSGPGKFKC---RSGECIDIAKVCNKQKDCKDWSDEPIKECYVNECEVNNGGCSHLCHNLVIGYECDCTAGFKLI-DRKTCGDIDEC-QNPEICSQICVNLKGGYKCECSKGYQMD-----PSTGVCKAVGKEPCLIFTNRRDIRKVGLERKEYIQLVEQLRNTVALDADI-KEQSLFWADTIQKAIFRFVIYLQ---------FSNLCTHIKVVEDVHSPSAI--AIDWIYKNIYWMDTGLKTISVSNFDGSKRKTLFNSGLQDPTSIAVDPISGFIYWSDWGEP---AKIEKAGMNGIDRQQFVTADVQRPSGIAIDVVKSRLYWVDSKLHTLSSVDLNGLDRRVILKSHEFLA----HPLALTIFEDRVYWIDGENEAIYGANKFSGQELETL 682          

HSP 2 Score: 72.4034 bits (176), Expect = 1.856e-12
Identity = 53/151 (35.10%), Postives = 76/151 (50.33%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDE-WNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNC 597
             CI+ LW CD ++DC D SDE +C    C +  F C ++ LC+PR   CDG  DC +  DE     ++ +C   T  +CG  +  +CI +   C+   +C   +D  ENC    C  +E TCS   CI+  S+F C+   D     D  NC
Sbjct:   42 HCITSLWKCDGDEDCSDGSDESSCVKKTCAETDFVC-NNGLCVPRRWECDGDPDCEDGSDETAELCHMRTC-RATEISCG-ARSTQCIPLSWKCDGESDCPNAEDE-ENCGNITCSPAEFTCSSGRCIS--STFVCNGQNDCSDGSDEENC 186          

HSP 3 Score: 63.1586 bits (152), Expect = 1.224e-9
Identity = 52/161 (32.30%), Postives = 76/161 (47.20%), Query Frame = 1
Query:  142 SFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEW--NCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNCKHINKC 615
            S  +CIS  +VC+   DC D SDE NC P  C  ++F+C +S  CIP   +CD  +DC ++ DE    C       +K   N       ECI  +  C+ + +C    D + NC +  C+  +  C    CI  + S  CD   D     D   CK++N+C
Sbjct:  160 SSGRCISSTFVCNGQNDCSDGSDEENCVPPTCGAHEFQCKNSS-CIPLNWVCDDDSDCADHSDESLEQCGRQPIAPQKCSANEMPCGSGECIHKKWRCDGDPDCKDKSDEM-NCPSRTCQPDQFKCEDGNCI--HGSRQCDGVRDCLDGTDEIRCKNVNQC 316          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Xenopus
Match: VLDLR (very low density lipoprotein receptor [Source:NCBI gene;Acc:733485])

HSP 1 Score: 199.134 bits (505), Expect = 2.592e-53
Identity = 136/488 (27.87%), Postives = 226/488 (46.31%), Query Frame = 1
Query:  106 KCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMV-----FYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNL----SAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNI-KTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            KC  ++  CG     +CI K W CD + DC D SDE+NCP   C  +QFKC D + CI   + CDGV DC++  DE  C N+N C+    + C   +  ECI I  +CN   +C    D  ++ C  + C+ +   CSH+C N    + CDC    +L  D + C  I++C +NPE+C Q C +    Y C C  GY       V      E  L                        IF  + DI    V L R E +       +++    ++ + S      +   ++ +    ++ +  ++K +    S  + A+D     +++ D    +I V N     +  + +     P +I +DP+ G ++W D G      KI+ A M+G  +   +  ++++P  +AID+ + RLYW D     +  +D+N L +  I K+   LA    HP ++ IF +R+YW D +   IY A+K +G++++ +
Sbjct:  215 KCSANEMPCGSG---ECIHKKWRCDGDPDCKDKSDEMNCPSRTCQPDQFKCEDGN-CIHGSRQCDGVRDCLDGTDEIRCKNVNQCSGPGKFKC---RSGECIDIAKVCNKQKDCKDWSDEPIKECYVNECEVNNGGCSHLCHNLVIGYECDCTAGFKLI-DRKTCGDIDEC-QNPEICSQICVNLKGGYKCECSKGYQMDPSTGVCKAVGKEPCL------------------------IFTNRRDIRK--VGLERKEYIQLVEQLRNTVALDADIKEQSLFWADTIQKAIFRAPFDTREKVGTHIKVVEDVHSPSAIAIDWIYKNIYWMDTGLKTISVSNFDGSKRKTLFNSGLQDPTSIAVDPISGFIYWSDWGEP---AKIEKAGMNGIDRQQFVTADVQRPSGIAIDVVKSRLYWVDSKLHTLSSVDLNGLDRRVILKSHEFLA----HPLALTIFEDRVYWIDGENEAIYGANKFSGQELETL 660          

HSP 2 Score: 72.4034 bits (176), Expect = 1.776e-12
Identity = 53/151 (35.10%), Postives = 76/151 (50.33%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDE-WNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNC 597
             CI+ LW CD ++DC D SDE +C    C +  F C ++ LC+PR   CDG  DC +  DE     ++ +C   T  +CG  +  +CI +   C+   +C   +D  ENC    C  +E TCS   CI+  S+F C+   D     D  NC
Sbjct:   21 HCITSLWKCDGDEDCSDGSDESSCVKKTCAETDFVC-NNGLCVPRRWECDGDPDCEDGSDETAELCHMRTC-RATEISCG-ARSTQCIPLSWKCDGESDCPNAEDE-ENCGNITCSPAEFTCSSGRCIS--STFVCNGQNDCSDGSDEENC 165          

HSP 3 Score: 67.0106 bits (162), Expect = 8.509e-11
Identity = 59/175 (33.71%), Postives = 81/175 (46.29%), Query Frame = 1
Query:   97 CHFK-CLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKD-SLENC-----KADFCKTSENTC-SHICINKYSSFTCDCPPDMELSEDNRNC 597
            CH + C   +  CG  S  QCI   W CD   DC +  DE NC  + C   +F C  S  CI    +C+G NDC +  DE NC    +C     + C N+    CI +  +C+ + +C+ + D SLE C         C  +E  C S  CI+K   + CD  PD +   D  NC
Sbjct:   85 CHMRTCRATEISCGARST-QCIPLSWKCDGESDCPNAEDEENCGNITCSPAEFTC-SSGRCISSTFVCNGQNDCSDGSDEENCVP-PTCGAH-EFQCKNSS---CIPLNWVCDDDSDCADHSDESLEQCGRQPIAPQKCSANEMPCGSGECIHK--KWRCDGDPDCKDKSDEMNC 250          

HSP 4 Score: 63.1586 bits (152), Expect = 1.192e-9
Identity = 52/161 (32.30%), Postives = 76/161 (47.20%), Query Frame = 1
Query:  142 SFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEW--NCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNCKHINKC 615
            S  +CIS  +VC+   DC D SDE NC P  C  ++F+C +S  CIP   +CD  +DC ++ DE    C       +K   N       ECI  +  C+ + +C    D + NC +  C+  +  C    CI  + S  CD   D     D   CK++N+C
Sbjct:  139 SSGRCISSTFVCNGQNDCSDGSDEENCVPPTCGAHEFQCKNSS-CIPLNWVCDDDSDCADHSDESLEQCGRQPIAPQKCSANEMPCGSGECIHKKWRCDGDPDCKDKSDEM-NCPSRTCQPDQFKCEDGNCI--HGSRQCDGVRDCLDGTDEIRCKNVNQC 295          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Xenopus
Match: VLDLR (very low density lipoprotein receptor [Source:NCBI gene;Acc:733485])

HSP 1 Score: 199.519 bits (506), Expect = 2.662e-53
Identity = 136/488 (27.87%), Postives = 226/488 (46.31%), Query Frame = 1
Query:  106 KCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMV-----FYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNL----SAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNI-KTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            KC  ++  CG     +CI K W CD + DC D SDE+NCP   C  +QFKC D + CI   + CDGV DC++  DE  C N+N C+    + C   +  ECI I  +CN   +C    D  ++ C  + C+ +   CSH+C N    + CDC    +L  D + C  I++C +NPE+C Q C +    Y C C  GY       V      E  L                        IF  + DI    V L R E +       +++    ++ + S      +   ++ +    ++ +  ++K +    S  + A+D     +++ D    +I V N     +  + +     P +I +DP+ G ++W D G      KI+ A M+G  +   +  ++++P  +AID+ + RLYW D     +  +D+N L +  I K+   LA    HP ++ IF +R+YW D +   IY A+K +G++++ +
Sbjct:  236 KCSANEMPCGSG---ECIHKKWRCDGDPDCKDKSDEMNCPSRTCQPDQFKCEDGN-CIHGSRQCDGVRDCLDGTDEIRCKNVNQCSGPGKFKC---RSGECIDIAKVCNKQKDCKDWSDEPIKECYVNECEVNNGGCSHLCHNLVIGYECDCTAGFKLI-DRKTCGDIDEC-QNPEICSQICVNLKGGYKCECSKGYQMDPSTGVCKAVGREPCL------------------------IFTNRRDIRK--VGLERKEYIQLVEQLRNTVALDADIKEQSLFWADTIQKAIFRAPFDTREKVGTHIKVVEDVHSPSAIAIDWIYKNIYWMDTGLKTISVSNFDGSKRKTLFNSGLQDPTSIAVDPISGFIYWSDWGEP---AKIEKAGMNGIDRQQFVTADVQRPSGIAIDVVKSRLYWVDSKLHTLSSVDLNGLDRRVILKSHEFLA----HPLALTIFEDRVYWIDGENEAIYGANKFSGQELETL 681          

HSP 2 Score: 72.7886 bits (177), Expect = 1.579e-12
Identity = 53/151 (35.10%), Postives = 76/151 (50.33%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDE-WNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNC 597
             CI+ LW CD ++DC D SDE +C    C +  F C ++ LC+PR   CDG  DC +  DE     ++ +C   T  +CG  +  +CI +   C+   +C   +D  ENC    C  +E TCS   CI+  S+F C+   D     D  NC
Sbjct:   42 HCITSLWKCDGDEDCSDGSDESSCVKKTCAETDFVC-NNGLCVPRRWECDGDPDCEDGSDETAELCHMRTC-RATEISCG-ARSTQCIPLSWKCDGESDCPNAEDE-ENCGNITCSPAEFTCSSGRCIS--STFVCNGQNDCSDGSDEENC 186          

HSP 3 Score: 63.5438 bits (153), Expect = 9.285e-10
Identity = 52/161 (32.30%), Postives = 76/161 (47.20%), Query Frame = 1
Query:  142 SFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEW--NCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNCKHINKC 615
            S  +CIS  +VC+   DC D SDE NC P  C  ++F+C +S  CIP   +CD  +DC ++ DE    C       +K   N       ECI  +  C+ + +C    D + NC +  C+  +  C    CI  + S  CD   D     D   CK++N+C
Sbjct:  160 SSGRCISSTFVCNGQNDCSDGSDEENCVPPTCGAHEFQCKNSS-CIPLNWVCDDDSDCADHSDESLEQCGRQPIAPQKCSANEMPCGSGECIHKKWRCDGDPDCKDKSDEM-NCPSRTCQPDQFKCEDGNCI--HGSRQCDGVRDCLDGTDEIRCKNVNQC 316          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Mouse
Match: Vldlr (very low density lipoprotein receptor [Source:MGI Symbol;Acc:MGI:98935])

HSP 1 Score: 193.356 bits (490), Expect = 1.492e-51
Identity = 140/492 (28.46%), Postives = 223/492 (45.33%), Query Frame = 1
Query:  100 HFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTE--HDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDL-----YLSSISNK--QNIEM--NLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLS-QLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            H KC   +  CG     +CI K W CD + DC D SDEVNCP   C  +QF+C D   CI   + C+G+ DC++  DE NC N+N C     + C   +  ECI +  +C+   +C    D  L+ C  + C  +   CSHIC +    + CDC    EL  D + C  I++C +NP +C Q C +    Y C C  GY        C    +E  +                          IF  + DI    + L R E +     +     L            DL     + +SI +K  ++ +M  N+ N +A   A+D     +++TD    +I V  L    +  + + D   P +I +DP+ G ++W D G      KI+ A M+G  +  L+ ++I+ P  + +D+ + RLYW D     +  +D+N    ++ +K+   LA    HP ++ IF +R+YW D +   +Y A+K TG ++  +
Sbjct:  195 HTKCPTSEIQCGSG---ECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGS-CIHGSRQCNGIRDCVDGSDEVNCKNVNQCLGPGKFKC---RSGECIDMSKVCDQEQDCRDWSDEPLKECHINECLVNNGGCSHICKDLVIGYECDCAAGFELI-DRKTCGDIDEC-QNPGICSQICINLKGGYKCECSRGYQMDLATGVCKAVGKEPSL--------------------------IFTNRRDIRK--IGLERKEYIQLVEQLRNTVALDADIAAQKLFWADLSQKAIFSASIDDKVGRHFKMIDNVYNPAAI--AVDWVYKTIYWTDAASKTISVATLDGAKRKFLFNSDLREPASIAVDPLSGFVYWSDWGEP---AKIEKAGMNGFDRRPLVTEDIQWPNGITLDLVKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLA----HPLALTIFEDRVYWIDGENEAVYGANKFTGSELATL 640          

HSP 2 Score: 60.4622 bits (145), Expect = 6.181e-9
Identity = 51/173 (29.48%), Postives = 75/173 (43.35%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEW--NCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNC-----KHINKCFKNPEVCHQGC 648
            +CI+ LW CD ++DC D SDE NC    C ++ F C +   C+P    CDG  DC +  DE    C NI        + C + +   C+    +CN   +C    D L+ C    C   E  CS          T  C P   + +D+ +C     + + +C + P V H  C
Sbjct:   44 RCITLLWKCDGDEDCADGSDEKNCVKKTCAESDFVCKNGQ-CVPNRWQCDGDPDCEDGSDESPEQCRNITC--SADEFTCSSGR---CVSRNFVCNGQDDCDDGSDELD-CAPPTCGAHEFQCS----------TSSCIPLSWVCDDDADCSDQSDESLEQCGRQP-VIHTKC 198          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Mouse
Match: Vldlr (very low density lipoprotein receptor [Source:MGI Symbol;Acc:MGI:98935])

HSP 1 Score: 192.971 bits (489), Expect = 2.535e-51
Identity = 140/492 (28.46%), Postives = 223/492 (45.33%), Query Frame = 1
Query:  100 HFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTE--HDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDL-----YLSSISNK--QNIEM--NLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLS-QLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            H KC   +  CG     +CI K W CD + DC D SDEVNCP   C  +QF+C D   CI   + C+G+ DC++  DE NC N+N C     + C   +  ECI +  +C+   +C    D  L+ C  + C  +   CSHIC +    + CDC    EL  D + C  I++C +NP +C Q C +    Y C C  GY        C    +E  +                          IF  + DI    + L R E +     +     L            DL     + +SI +K  ++ +M  N+ N +A   A+D     +++TD    +I V  L    +  + + D   P +I +DP+ G ++W D G      KI+ A M+G  +  L+ ++I+ P  + +D+ + RLYW D     +  +D+N    ++ +K+   LA    HP ++ IF +R+YW D +   +Y A+K TG ++  +
Sbjct:  236 HTKCPTSEIQCGSG---ECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGS-CIHGSRQCNGIRDCVDGSDEVNCKNVNQCLGPGKFKC---RSGECIDMSKVCDQEQDCRDWSDEPLKECHINECLVNNGGCSHICKDLVIGYECDCAAGFELI-DRKTCGDIDEC-QNPGICSQICINLKGGYKCECSRGYQMDLATGVCKAVGKEPSL--------------------------IFTNRRDIRK--IGLERKEYIQLVEQLRNTVALDADIAAQKLFWADLSQKAIFSASIDDKVGRHFKMIDNVYNPAAI--AVDWVYKTIYWTDAASKTISVATLDGAKRKFLFNSDLREPASIAVDPLSGFVYWSDWGEP---AKIEKAGMNGFDRRPLVTEDIQWPNGITLDLVKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLA----HPLALTIFEDRVYWIDGENEAVYGANKFTGSELATL 681          

HSP 2 Score: 64.3142 bits (155), Expect = 4.871e-10
Identity = 49/154 (31.82%), Postives = 75/154 (48.70%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKT----HYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNC 597
            +CI+ LW CD ++DC D SDE NC    C ++ F C +   C+P    CDG  DC +  DE    +   C+ +T      +CG  +  +CI +   C+   +C   +D  ENC    C   E TCS   C+++  +F C+   D +   D  +C
Sbjct:   44 RCITLLWKCDGDEDCADGSDEKNCVKKTCAESDFVCKNGQ-CVPNRWQCDGDPDCEDGSDE----SPEQCHMRTCRINEISCG-ARSTQCIPVSWRCDGENDCDNGEDE-ENCGNITCSADEFTCSSGRCVSR--NFVCNGQDDCDDGSDELDC 188          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Mouse
Match: Vldlr (very low density lipoprotein receptor [Source:MGI Symbol;Acc:MGI:98935])

HSP 1 Score: 193.356 bits (490), Expect = 2.757e-51
Identity = 140/492 (28.46%), Postives = 223/492 (45.33%), Query Frame = 1
Query:  100 HFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTE--HDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDL-----YLSSISNK--QNIEM--NLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLS-QLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            H KC   +  CG     +CI K W CD + DC D SDEVNCP   C  +QF+C D   CI   + C+G+ DC++  DE NC N+N C     + C   +  ECI +  +C+   +C    D  L+ C  + C  +   CSHIC +    + CDC    EL  D + C  I++C +NP +C Q C +    Y C C  GY        C    +E  +                          IF  + DI    + L R E +     +     L            DL     + +SI +K  ++ +M  N+ N +A   A+D     +++TD    +I V  L    +  + + D   P +I +DP+ G ++W D G      KI+ A M+G  +  L+ ++I+ P  + +D+ + RLYW D     +  +D+N    ++ +K+   LA    HP ++ IF +R+YW D +   +Y A+K TG ++  +
Sbjct:  236 HTKCPTSEIQCGSG---ECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGS-CIHGSRQCNGIRDCVDGSDEVNCKNVNQCLGPGKFKC---RSGECIDMSKVCDQEQDCRDWSDEPLKECHINECLVNNGGCSHICKDLVIGYECDCAAGFELI-DRKTCGDIDEC-QNPGICSQICINLKGGYKCECSRGYQMDLATGVCKAVGKEPSL--------------------------IFTNRRDIRK--IGLERKEYIQLVEQLRNTVALDADIAAQKLFWADLSQKAIFSASIDDKVGRHFKMIDNVYNPAAI--AVDWVYKTIYWTDAASKTISVATLDGAKRKFLFNSDLREPASIAVDPLSGFVYWSDWGEP---AKIEKAGMNGFDRRPLVTEDIQWPNGITLDLVKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLA----HPLALTIFEDRVYWIDGENEAVYGANKFTGSELATL 681          

HSP 2 Score: 64.3142 bits (155), Expect = 4.090e-10
Identity = 49/154 (31.82%), Postives = 75/154 (48.70%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKT----HYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNC 597
            +CI+ LW CD ++DC D SDE NC    C ++ F C +   C+P    CDG  DC +  DE    +   C+ +T      +CG  +  +CI +   C+   +C   +D  ENC    C   E TCS   C+++  +F C+   D +   D  +C
Sbjct:   44 RCITLLWKCDGDEDCADGSDEKNCVKKTCAESDFVCKNGQ-CVPNRWQCDGDPDCEDGSDE----SPEQCHMRTCRINEISCG-ARSTQCIPVSWRCDGENDCDNGEDE-ENCGNITCSADEFTCSSGRCVSR--NFVCNGQDDCDDGSDELDC 188          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Mouse
Match: Lrp4 (low density lipoprotein receptor-related protein 4 [Source:MGI Symbol;Acc:MGI:2442252])

HSP 1 Score: 181.03 bits (458), Expect = 1.005e-46
Identity = 130/484 (26.86%), Postives = 222/484 (45.87%), Query Frame = 1
Query:  154 CISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCN-EKTHYNCGNTKKLECIKIEDICNTNINC--STNKDSLENCKA----DFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQ-DDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIE--MNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVK-PINLRII 1572
            CI+  W CD + DCDD SDE NC   +C   QF+C  S  C+     CDG +DC +N DE NC N  S       + C N +   CI    +CN   +C  S+++   +NC+     + C  +   C+  C     +  C C     L+ED R C+ +N+C +    C QGC +   ++ C+C  GY     +  P     +             + I  + PH     +     ++  +LD + +R E+VF+S +                  +D  L +  N  N+E  ++    S    A+D   + L++TD   S I V NL    +  ++ +    P  I + P+ G ++W D GN    P+I+ ++MDGS +  + +  +  P  L ID   +R+YW D     I+  +++   +      +V++    HPF+I +F + +YW+D     I SA+K TGK+ ++I  ++  P+++  +
Sbjct:  243 CINSGWRCDGDADCDDQSDERNCTTSMCTAEQFRC-RSGRCVRLSWRCDGEDDCADNSDEENCENTGSPQCASDQFLCWNGR---CIGQRKLCNGINDCGDSSDESPQQNCRPRTGEENCNVNNGGCAQKCQMVRGAVQCTCHTGYRLTEDGRTCQDVNECAEE-GYCSQGCTNTEGAFQCWCEAGY-----ELRPDRRSCKALGPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFH-HRRELVFWSDVT-----------------LDRILRANLNGSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANLDGAHRKVLLWQSLEKPRAIALHPMEGTIYWTDWGNT---PRIEASSMDGSGRRIIADTHLFWPNGLTIDYAGRRMYWVDAKHHVIERANLDGSHRK-----AVISQGLPHPFAITVFEDSLYWTDWHTKSINSANKFTGKNQEIIRNKLHFPMDIHTL 690          

HSP 2 Score: 106.301 bits (264), Expect = 5.772e-23
Identity = 56/192 (29.17%), Postives = 95/192 (49.48%), Query Frame = 1
Query:  976 SNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVK 1551
               Q + ++    S    A+D   N L++TD     I V N     +  ++ ++   P +IV++P+ G ++W D G     PKI+ A MD S +  ++   +  P  LAID   QRLYW D   + +K I+   L     K    +  +  HPF + ++G RIYW+D +   I SA ++TG D + + + ++
Sbjct:  804 GTGQEVVVDTSLESPAGLAIDWVTNKLYWTDAGTDRIEVANTDGSMRTVLIWENLDRPRDIVVEPMGGYMYWTDWGAS---PKIERAGMDASSRQVIISSNLTWPNGLAIDYGSQRLYWAD---AGMKTIEFAGLDGSKRKVL--IGSQLPHPFGLTLYGQRIYWTDWQTKSIQSADRLTGLDRETLQENLE 987          

HSP 3 Score: 86.6557 bits (213), Expect = 7.034e-17
Identity = 84/368 (22.83%), Postives = 141/368 (38.32%), Query Frame = 1
Query:  490 CKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVKPINLRIISKESNRQ 1593
            C +    CSH+C+ + S F+C CP  ++L  D +       C  +PE           +Y  F   G                                 + + H        G +++ SLD +        +  + + D  L V +        DL  S++     I   LK       A+D     L++TD   ++I    L    +  +++     P  I + P  G LFW D G+     KI+ AN+DGS +  L+  ++  P  L +D + +R+YW D     I+  D+N       K   VL     HPF++      IYW+D +   I    K +G++ + +   V+ + + II     RQ
Sbjct: 1313 CGSRNGGCSHLCLPRPSGFSCACPTGIQLKGDRKT------CDPSPE-----------TYLLFSSRGSIRR--------------------------ISLDTDDHTDVHVPVPGLNNVISLDYD------SVHGKVYYTDVFLDVIR------RADLNGSNMETV--IGHGLKTTDGL--AVDWVARNLYWTDTGRNTIEASRLDGSCRKVLINNSLDEPRAIAVFPRKGYLFWTDWGHI---AKIERANLDGSERKVLINTDLGWPNGLTLDYDTRRIYWVDAHLDRIESADLNG------KLRQVLVSHVSHPFALTQQDRWIYWTDWQTKSIQRVDKYSGRNKETVLANVEGL-MDIIVVSPQRQ 1611          

HSP 4 Score: 77.7962 bits (190), Expect = 3.561e-14
Identity = 47/169 (27.81%), Postives = 81/169 (47.93%), Query Frame = 1
Query: 1030 ALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            A+D     +++TD   + I V NL    +  +V ++   P  IV+   MG ++W D G EN   K++ + MDGS +  L+   +  P  L +D    +L W D     I+  D+N  ++        L     HP+ + +  + IYW+D +   I+ A K TG +V ++
Sbjct: 1130 AVDAIGRKVYWTDTGTNRIEVGNLDGSMRKVLVWQNLDSPRAIVLYHEMGFMYWTDWG-EN--AKLERSGMDGSDRTVLINNNLGWPNGLTVDKTSSQLLWADAHTERIEVADLNGANR------HTLVSPVQHPYGLTLLDSYIYWTDWQTRSIHRADKSTGSNVILV 1289          

HSP 5 Score: 65.4698 bits (158), Expect = 2.368e-10
Identity = 40/111 (36.04%), Postives = 63/111 (56.76%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKA 483
            +CI + WVCD + DC+D+SDE +CPP  C++++F C +   CI     CDG NDC +N DE  C ++  C++K  + C +     CI     C+ + +C    D  E+C +
Sbjct:   82 KCIRRSWVCDGDNDCEDDSDEQDCPPRECEEDEFPCQNG-YCIRSLWHCDGDNDCGDNSDE-QC-DMRKCSDK-EFRCSDGS---CIAEHWYCDGDTDCKDGSDE-ESCPS 184          

HSP 6 Score: 61.6178 bits (148), Expect = 3.483e-9
Identity = 57/183 (31.15%), Postives = 79/183 (43.17%), Query Frame = 1
Query:   79 CLNFYACHFKCLQDDHYCGKNSFF---------QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCS-HICINKYSSFTCDCPPDMELSEDNRNC 597
            C +  A   +C      CG++ F           CI   W CD + DC D+SDE  C    C    F C D+  CI R  +CDG NDC ++ DE +C     C E+  + C N     CI+    C+ + +C  N D  E C    C   E  CS   CI ++  + CD   D +   D  +C
Sbjct:   15 CAHGIASSLECA-----CGRSHFTCAVSALGECTCIPAQWQCDGDNDCGDHSDEDGCTLPTCSPLDFHC-DNGKCIRRSWVCDGDNDCEDDSDEQDCPP-REC-EEDEFPCQNGY---CIRSLWHCDGDNDCGDNSD--EQCDMRKCSDKEFRCSDGSCIAEH--WYCDGDTDCKDGSDEESC 182          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Mouse
Match: Ldlr (low density lipoprotein receptor [Source:MGI Symbol;Acc:MGI:96765])

HSP 1 Score: 177.178 bits (448), Expect = 5.411e-46
Identity = 131/493 (26.57%), Postives = 222/493 (45.03%), Query Frame = 1
Query:  127 YCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKE--------IFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFS--------------TALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            +CG +   +CI + WVCD   DC D SDE +C    C  ++F+C D   CI   + CD  +DC +  DE  C N+  C+    + C +    ECI ++ +C++  +C    D  ++ CK + C  +   CSHIC +      C CP    L + +R C+ I++C + P+ C Q C +   SY C C  G+                                +++PH +  +        +F  + ++  +   L+R+E   Y+SL+   N+  V  L     N  +Y S +S K+     +      S               A+D     +++TD    S+ V +     +  +  +    P  IV+DPV G ++W D G      KIK   ++G   ++L+ + I+ P  + +D+   RLYW D    +I  ID+N     N KT         HPFS+ I+ +++YW+D+    I+SA+++TG DV ++
Sbjct:  204 HCGSS---ECIHRSWVCDGEADCKDKSDEEHCAVATCRPDEFQCADGS-CIHGSRQCDREHDCKDMSDELGCVNVTQCDGPNKFKCHSG---ECISLDKVCDSARDCQDWSDEPIKECKTNECLDNNGGCSHICKDLKIGSECLCPSGFRLVDLHR-CEDIDEC-QEPDTCSQLCVNLEGSYKCECQAGF--------------------------------HMDPHTRVCKAVGSIGYLLFTNRHEVRKM--TLDRSE---YTSLL--PNLKNVVALDTEVTNNRIYWSDLSQKKIYSALMDQAPNLSYDTIISEDLHAPDGLAVDWIHRNIYWTDSVPGSVSVADTKGVKRRTLFQEAGSRPRAIVVDPVHGFMYWTDWGTP---AKIKKGGLNGVDIHSLVTENIQWPNGITLDLSSGRLYWVDSKLHSISSIDVNGG---NRKTILEDENRLAHPFSLAIYEDKVYWTDVINEAIFSANRLTGSDVNLV 642          

HSP 2 Score: 58.9214 bits (141), Expect = 1.778e-8
Identity = 50/150 (33.33%), Postives = 71/150 (47.33%), Query Frame = 1
Query:  130 CGKNSF----FQCISKLWVCDYNQDCDDNSDEV--NCPPMICDKNQFKCPDS-DLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTC-SHICINKYSSFTCD 555
            C +N F     +CI+  WVCD + +C D SDE    C  + C  NQF C      CIP    CDG  DC  + DE  C    +C++   + C + K   CI  + +C+ + +C    D   +C+A  C  +   C S ICI   S + CD
Sbjct:   27 CSRNEFQCRDGKCIASKWVCDGSPECPDGSDESPETCMSVTCQSNQFSCGGRVSRCIPDSWRCDGQVDCENDSDEQGCPP-KTCSQD-DFRCQDGK---CISPQFVCDGDRDCLDGSDEA-HCQATTCGPAHFRCNSSICIP--SLWACD 168          
BLAST of low-density lipoprotein receptor-related protein 2 vs. UniProt/SwissProt
Match: sp|P98155|VLDLR_HUMAN (Very low-density lipoprotein receptor OS=Homo sapiens OX=9606 GN=VLDLR PE=1 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 1.044e-51
Identity = 142/492 (28.86%), Postives = 223/492 (45.33%), Query Frame = 1
Query:  100 HFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTE--HDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDL-----YLSSISNK--QNIEM--NLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLS-QLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            H KC   +  CG     +CI K W CD + DC D SDEVNCP   C  +QF+C D   CI   + C+G+ DC++  DE NC N+N C     + C   +  ECI I  +CN   +C    D  L+ C  + C  +   CSHIC +    + CDC    EL  D + C  I++C +NP +C Q C +    Y C C  GY        C    +E  +                          IF  + DI    + L R E +     +     L            DL     + +SI +K  ++++M  N+ N +A   A+D     +++TD    +I V  L    +  + + D   P +I +DP+ G ++W D G      KI+ A M+G  +  L+  +I+ P  + +D+ + RLYW D     +  +D+N    ++ +K+   LA    HP ++ IF +R+YW D +   +Y A+K TG ++  +
Sbjct:  236 HTKCPASEIQCGSG---ECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGS-CIHGSRQCNGIRDCVDGSDEVNCKNVNQCLGPGKFKC---RSGECIDISKVCNQEQDCRDWSDEPLKECHINECLVNNGGCSHICKDLVIGYECDCAAGFELI-DRKTCGDIDEC-QNPGICSQICINLKGGYKCECSRGYQMDLATGVCKAVGKEPSL--------------------------IFTNRRDIRK--IGLERKEYIQLVEQLRNTVALDADIAAQKLFWADLSQKAIFSASIDDKVGRHVKMIDNVYNPAAI--AVDWVYKTIYWTDAASKTISVATLDGTKRKFLFNSDLREPASIAVDPLSGFVYWSDWGEP---AKIEKAGMNGFDRRPLVTADIQWPNGITLDLIKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLA----HPLALTIFEDRVYWIDGENEAVYGANKFTGSELATL 681          

HSP 2 Score: 62.3882 bits (150), Expect = 1.325e-8
Identity = 50/154 (32.47%), Postives = 75/154 (48.70%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKT----HYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNC 597
            +CI+ LW CD ++DC D SDE NC    C ++ F C ++  C+P    CDG  DC +  DE    +   C+ +T      +CG     +CI +   C+   +C + +D  ENC    C   E TCS   CI++  +F C+   D     D  +C
Sbjct:   44 RCITLLWKCDGDEDCVDGSDEKNCVKKTCAESDFVC-NNGQCVPSRWKCDGDPDCEDGSDE----SPEQCHMRTCRIHEISCG-AHSTQCIPVSWRCDGENDCDSGEDE-ENCGNITCSPDEFTCSSGRCISR--NFVCNGQDDCSDGSDELDC 188          
BLAST of low-density lipoprotein receptor-related protein 2 vs. UniProt/SwissProt
Match: sp|P35953|VLDLR_RABIT (Very low-density lipoprotein receptor OS=Oryctolagus cuniculus OX=9986 GN=VLDLR PE=2 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 2.332e-51
Identity = 141/492 (28.66%), Postives = 223/492 (45.33%), Query Frame = 1
Query:  100 HFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTE--HDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVD-----LYLSSISNK--QNIEM--NLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLS-QLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            H KC   +  CG     +CI K W CD + DC D SDEVNCP   C  +QF+C D   CI   + C+G+ DC++  DE NC N+N C     + C   +  ECI I  +CN   +C    D  L+ C  + C  +   CSHIC +    + CDC    EL  D + C  I++C +NP +C Q C +    Y C C  GY        C    +E  +                          IF  + DI    + L R E +     +     L            D     ++ +SI +K  ++++M  N+ N +A   A+D     +++TD    +I V  L    +  + + D   P +I +DP+ G ++W D G      KI+ A M+G  +  L+  +I+ P  + +D+ + RLYW D     +  +D+N    ++ +K+   LA    HP ++ IF +R+YW D +   +Y A+K TG ++  +
Sbjct:  236 HTKCPASEIQCGSG---ECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGS-CIHGSRQCNGIRDCVDGSDEVNCKNVNQCLGPGKFKC---RSGECIDISKVCNQEQDCRDWSDEPLKECHVNECLVNNGGCSHICKDSVIGYECDCAAGFELI-DRKTCGDIDEC-QNPGICSQICINLKGGYKCECSRGYQMDLATGVCKAVGKEPSL--------------------------IFTNRRDIRK--IGLERKEYIQLVEQLRNTVALDADIAAQKLFWADVSQKAIFSASIDDKVGRHVKMIDNVYNPAAI--AVDWVYKTIYWTDAASRTISVATLDGAKRKFLFNSDLREPASIAVDPLSGFVYWSDWGEP---AKIEKAGMNGFDRRPLVTVDIQWPNGITLDLIKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLA----HPLALTIFEDRVYWIDGENEAVYGANKFTGSELATL 681          

HSP 2 Score: 66.6254 bits (161), Expect = 6.018e-10
Identity = 51/154 (33.12%), Postives = 78/154 (50.65%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKT----HYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNC 597
            +CI++LW CD ++DC D SDE NC    C ++ F C ++  CIP    CDG  DC +  DE    +   C+ +T      +CG  +  +CI +   C+   +C + +D  ENC    C + E TCS   CI++  +F C+   D     D  +C
Sbjct:   44 RCITQLWKCDGDEDCVDGSDEKNCVKKTCAESDFVC-NNGQCIPNRWQCDGDPDCEDGSDE----SPEQCHMRTCRINEISCG-ARSTQCIPVSWRCDGESDCDSGEDE-ENCGNVTCSSDEFTCSSGRCISR--NFVCNGQDDCSDGSDELDC 188          
BLAST of low-density lipoprotein receptor-related protein 2 vs. UniProt/SwissProt
Match: sp|P98166|VLDLR_RAT (Very low-density lipoprotein receptor OS=Rattus norvegicus OX=10116 GN=Vldlr PE=2 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 1.250e-50
Identity = 141/492 (28.66%), Postives = 223/492 (45.33%), Query Frame = 1
Query:  100 HFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTE--HDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDL-----YLSSISNK--QNIEM--NLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLS-QLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            H KC   +  CG     +CI K W CD + DC D SDEVNCP   C  +QF+C D   CI   + C+G+ DC++  DE NC N+N C     + C   +  ECI I  +C+   +C    D  L+ C  + C  +   CSHIC +    + CDC    EL  D + C  I++C +NP +C Q C +    Y C C  GY        C    +E  +                          IF  + DI    + L R E +     +     L            DL     + +SI +K  ++ +M  N+ N +A   A+D     +++TD    +I V  L    +  + + D   P +I +DP+ G ++W D G      KI+ A M+G  +  L+ ++I+ P  + +D+ + RLYW D     +  +D+N    ++ +K+   LA    HP ++ IF +R+YW D +   +Y A+K TG ++  +
Sbjct:  236 HTKCPTSEIQCGSG---ECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGS-CIHGSRQCNGIRDCVDGSDEVNCKNVNQCLGPGKFKC---RSGECIDITKVCDQEQDCRDWSDEPLKECHINECLVNNGGCSHICKDLVIGYECDCAAGFELI-DRKTCGDIDEC-QNPGICSQICINLKGGYKCECSRGYQMDLATGVCKAVGKEPSL--------------------------IFTNRRDIRK--IGLERKEYIQLVEQLRNTVALDADIAAQKLFWADLSQKAIFSASIDDKVGRHFKMIDNVYNPAAI--AVDWVYKTIYWTDAASKTISVATLDGTKRKFLFNSDLREPASIAVDPLSGFVYWSDWGEP---AKIEKAGMNGFDRRPLVTEDIQWPNGITLDLVKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLA----HPLALTIFEDRVYWIDGENEAVYGANKFTGSELATL 681          

HSP 2 Score: 62.003 bits (149), Expect = 1.546e-8
Identity = 49/154 (31.82%), Postives = 74/154 (48.05%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKT----HYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNC 597
            +CI+ LW CD ++DC D SDE NC    C ++ F C +   C+P    CDG  DC +  DE    +   C+ +T      +CG  +  +CI     C+   +C   +D  ENC    C   E TCS   C+++  +F C+   D +   D  +C
Sbjct:   44 RCITLLWKCDGDEDCTDGSDEKNCVKKTCAESDFVCKNGQ-CVPNRWQCDGDPDCEDGSDE----SPEQCHMRTCRINEISCG-ARSTQCIPESWRCDGENDCDNGEDE-ENCGNITCSADEFTCSSGRCVSR--NFVCNGQDDCDDGSDELDC 188          
BLAST of low-density lipoprotein receptor-related protein 2 vs. UniProt/SwissProt
Match: sp|P98156|VLDLR_MOUSE (Very low-density lipoprotein receptor OS=Mus musculus OX=10090 GN=Vldlr PE=1 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 1.929e-50
Identity = 140/492 (28.46%), Postives = 223/492 (45.33%), Query Frame = 1
Query:  100 HFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTE--HDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDL-----YLSSISNK--QNIEM--NLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLS-QLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            H KC   +  CG     +CI K W CD + DC D SDEVNCP   C  +QF+C D   CI   + C+G+ DC++  DE NC N+N C     + C   +  ECI +  +C+   +C    D  L+ C  + C  +   CSHIC +    + CDC    EL  D + C  I++C +NP +C Q C +    Y C C  GY        C    +E  +                          IF  + DI    + L R E +     +     L            DL     + +SI +K  ++ +M  N+ N +A   A+D     +++TD    +I V  L    +  + + D   P +I +DP+ G ++W D G      KI+ A M+G  +  L+ ++I+ P  + +D+ + RLYW D     +  +D+N    ++ +K+   LA    HP ++ IF +R+YW D +   +Y A+K TG ++  +
Sbjct:  236 HTKCPTSEIQCGSG---ECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGS-CIHGSRQCNGIRDCVDGSDEVNCKNVNQCLGPGKFKC---RSGECIDMSKVCDQEQDCRDWSDEPLKECHINECLVNNGGCSHICKDLVIGYECDCAAGFELI-DRKTCGDIDEC-QNPGICSQICINLKGGYKCECSRGYQMDLATGVCKAVGKEPSL--------------------------IFTNRRDIRK--IGLERKEYIQLVEQLRNTVALDADIAAQKLFWADLSQKAIFSASIDDKVGRHFKMIDNVYNPAAI--AVDWVYKTIYWTDAASKTISVATLDGAKRKFLFNSDLREPASIAVDPLSGFVYWSDWGEP---AKIEKAGMNGFDRRPLVTEDIQWPNGITLDLVKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLA----HPLALTIFEDRVYWIDGENEAVYGANKFTGSELATL 681          

HSP 2 Score: 64.3142 bits (155), Expect = 2.861e-9
Identity = 49/154 (31.82%), Postives = 75/154 (48.70%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKT----HYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNC 597
            +CI+ LW CD ++DC D SDE NC    C ++ F C +   C+P    CDG  DC +  DE    +   C+ +T      +CG  +  +CI +   C+   +C   +D  ENC    C   E TCS   C+++  +F C+   D +   D  +C
Sbjct:   44 RCITLLWKCDGDEDCADGSDEKNCVKKTCAESDFVCKNGQ-CVPNRWQCDGDPDCEDGSDE----SPEQCHMRTCRINEISCG-ARSTQCIPVSWRCDGENDCDNGEDE-ENCGNITCSADEFTCSSGRCVSR--NFVCNGQDDCDDGSDELDC 188          
BLAST of low-density lipoprotein receptor-related protein 2 vs. UniProt/SwissProt
Match: sp|P98165|VLDLR_CHICK (Very low-density lipoprotein receptor OS=Gallus gallus OX=9031 GN=VLDLR PE=1 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 3.737e-50
Identity = 139/489 (28.43%), Postives = 220/489 (44.99%), Query Frame = 1
Query:  103 FKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVD-----LYLSSISNKQNIEMNLKNL----SAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSL-SQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
             KC   +  CG     +CI K W CD + DC D SDE+NCP   C  +QF+C D + CI   + C+GV DC++  DE NC N+  C+    + C   +  ECI I  +CN + +C    D  L+ C  + C  +   CSHIC +    + CDCP   EL  D R C  I++C +NP +C Q C +    Y C C  GY       V      E  L                        IF  + DI    + L R E +     +     L     +      D     ++ +SI  +  +  + + L    S    A+D     +++TD +  +I V +L    +  +   +   P +I +DP+ G ++W D G      KI+ A M+G  +  L+  EI+ P  +A+D+ + RLYW D     +  +D+N    +L +K+   L     HP ++ IF +R++W D +   +Y A+K TG ++  +
Sbjct:  255 VKCSTSEVQCGSG---ECIHKKWRCDGDPDCKDGSDEINCPSRTCRPDQFRCEDGN-CIHGSRQCNGVRDCLDGTDEANCNNVIQCSGPGKFKC---RSGECIDINKVCNHHGDCKDWSDEPLKECNINECLVNNGGCSHICRDLVIGYECDCPAGFELV-DRRTCGDIDEC-QNPGICSQICINLKGGYKCECSRGYQMDLATGVCKAVGKEPCL------------------------IFTNRRDIRK--IGLERKEYIQLVEQLRNTVALDADIAEQKLYWADFSQKAIFSASIDTRDKVGTHTRILDNIHSPAGIAVDWIYKNIYWTDSSAKTISVASLNGKKRKVLFLSELREPASIAVDPLSGFMYWSDWGEP---AKIEKAGMNGFDRQQLVTTEIQWPNGIALDLVKSRLYWLDSKLHMLSSVDLNGQDRRLVLKSHMFLP----HPLALTIFEDRVFWIDGENEAVYGANKFTGAELVTL 701          

HSP 2 Score: 72.4034 bits (176), Expect = 1.036e-11
Identity = 62/175 (35.43%), Postives = 83/175 (47.43%), Query Frame = 1
Query:   97 CHFK-CLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKD-SLENCKAD-----FCKTSENTC-SHICINKYSSFTCDCPPDMELSEDNRNC 597
            CH + C  ++  CG  S  QCI   W CD  +DCD   DE NC  + C   +F C  S  CI +  +C+G +DC +  DE  C    +C     + C   K   CI I  +C+ + +CS + D SLE C         C TSE  C S  CI+K   + CD  PD +   D  NC
Sbjct:  126 CHMRTCRVNEISCGPQST-QCIPVSWKCDGEKDCDSGEDEENCGNVTCSAAEFTC-SSGQCISKSFVCNGQDDCSDGSDELECAP-PTCGVH-EFQC---KSSTCIPISWVCDDDADCSDHSDESLEQCGRQPAPPVKCSTSEVQCGSGECIHK--KWRCDGDPDCKDGSDEINC 291          

HSP 3 Score: 66.2402 bits (160), Expect = 8.363e-10
Identity = 52/154 (33.77%), Postives = 74/154 (48.05%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKT----HYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNC 597
            +CI  LW CD ++DC D SDE  C    C ++ F C +S  C+P    CDG  DC +  DE    +   C+ +T      +CG  +  +CI +   C+   +C + +D  ENC    C  +E TCS   CI+K  SF C+   D     D   C
Sbjct:   62 RCIPLLWKCDGDEDCSDGSDESACVKKTCAESDFVC-NSGQCVPNRWQCDGDPDCEDGSDE----SAELCHMRTCRVNEISCG-PQSTQCIPVSWKCDGEKDCDSGEDE-ENCGNVTCSAAEFTCSSGQCISK--SFVCNGQDDCSDGSDELEC 206          
BLAST of low-density lipoprotein receptor-related protein 2 vs. TrEMBL
Match: A0A1S6KMJ9 (Uncharacterized protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 1.397e-73
Identity = 165/520 (31.73%), Postives = 283/520 (54.42%), Query Frame = 1
Query:  154 CISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCT--NINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKD-----SLENCKADFCKTSEN-TCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQK---CVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVKPINLRIISKESNRQLIKKINEHKIGKYC--SGVINTCRGSCLP 1674
            CISK W CD NQDC+   DE NCPP +C +N+F C     CIP+  LCDG   C++  DE NCT   I SC+  + ++C    ++ CI I ++C+   NC  N+D     S++NC+ + CK   N  CSH C N ++   C CP   +L  DNR C  I++C  +P  C+Q C++   SY C CYDGY ++      C+  T+E + ++L +       +   N   H+  K ++   + + ++DV+L+++    +  +   +  L  SK+     N++ Y     N +N+  +         + D  R LLF+T   +  IYV N TS     ++++    P +I +DP+   ++WIDLG + + P+I+M  M+   +  L+ K +++P  L ID++E++LYW+D  P +I +I++++ +  N KT  +++ +  +PFSI +F N I+W+D ++++I S  KIT     V+ K VKP+ ++++    N+ +  KI+E  +  +      ++ C   CLP
Sbjct:   38 CISKDWWCDGNQDCESGKDESNCPPKVCLENEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCTKHEIKSCDSISQFDCNKDGEI-CIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCI--TKEGDRSILITLNGGRQLMIDLNTGSHF-YKPLYNSHESLVNIDVDLHQSPQTMF-WIQQSNGKLGQSKIDLKVNNIEKY--RFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYVTNTTSNVTSVLLNQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMMLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPN--NPKT--IISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVL----NKVIQPKIHESDVTSHACLKNKMHGCSHICLP 542          
BLAST of low-density lipoprotein receptor-related protein 2 vs. TrEMBL
Match: A0A3Q3FLF7 (Very low density lipoprotein receptor OS=Kryptolebias marmoratus OX=37003 PE=4 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 7.937e-54
Identity = 138/483 (28.57%), Postives = 231/483 (47.83%), Query Frame = 1
Query:  106 KCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKA-KEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNL---SAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNI-KTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            KC   +  C      +CI K W CD + DC D SDE NCP   C+++QFKC DS  C+P  + C+GV DC +  DE +C N+  CN    + C   +  ECI++  +CN   +C    D  L+ C  + C  +   CSHIC +    F CDC P ++L  D++ C  IN+C  NP +C Q C +    Y C C++GY        PTT   +               +  L    K   ++   Q ++ +LD +  + + +F++ L  K                    S++ +K++   + K +   S    A+D     L+++D    +I V N     +  +  +    P +I +DP+ G L+W D G      KI+ + M+G  +  L+  +I+ P  + +D+ + RLYW D     +  +D+N  ++  + ++  VLA    HPF++ +F +R++W+D +   IY A+K +G DV  +
Sbjct:  208 KCSPSEMQCASG---ECIHKKWRCDGDPDCKDGSDEANCPFRTCEEDQFKC-DSGGCVPGNRQCNGVRDCADGSDEASCRNVTQCNGPEKFKC---RSGECIEMSKVCNKIRDCPDWSDEPLKECNLNECLLNNGGCSHICKDMAIGFECDCTPGLQLL-DHKTCGDINECM-NPGICSQICINLKGGYKCECHNGYQMD-----PTTSVCKAVGKEPCLIFTNRRDVRRLGLERKEYTQMVEQQRNVVALDADF-KQQTLFWADLGQK-----------------AIFSTVLDKRDAGAHKKVIDVQSPVGVAVDWIYKNLYWSDLGTRTISVANFNGTKQKVLFSRGLKEPASIAVDPLSGFLYWSDWGEP---AKIEKSGMNGVDRQVLVATDIQWPNGITLDLIKGRLYWVDSKLHLLCSVDLNGDNRKKVLQSADVLA----HPFALTVFEDRVFWTDGENQAIYGANKFSGSDVVTL 651          

HSP 2 Score: 63.5438 bits (153), Expect = 1.485e-6
Identity = 60/175 (34.29%), Postives = 86/175 (49.14%), Query Frame = 1
Query:   97 CHFK-CLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKD-SLENCK-----ADFCKTSENTC-SHICINKYSSFTCDCPPDMELSEDNRNC 597
            CH + C  ++  CG  +  QCI   W CD  +DCD+  DEV+C  + C  N+F C  S  CI R  +C+G +DC +  DE +C   +SC   + + CGN+    CI    +C+ +++C    D S   C         C  SE  C S  CI+K   + CD  PD +   D  NC
Sbjct:   78 CHMRTCRVNEFSCGPGTT-QCIPFFWKCDGEKDCDNGEDEVDCGNVTCALNEFTCA-SGRCISRNFVCNGEDDCGDGSDELDCA-PSSCG-PSEFQCGNSS---CIPASWVCDDDVDCQDESDESPTRCGRHPTPPAKCSPSEMQCASGECIHK--KWRCDGDPDCKDGSDEANC 243          
BLAST of low-density lipoprotein receptor-related protein 2 vs. TrEMBL
Match: A0A3Q3ABG3 (Very low density lipoprotein receptor OS=Kryptolebias marmoratus OX=37003 PE=4 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 8.157e-54
Identity = 138/483 (28.57%), Postives = 231/483 (47.83%), Query Frame = 1
Query:  106 KCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKA-KEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNL---SAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNI-KTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            KC   +  C      +CI K W CD + DC D SDE NCP   C+++QFKC DS  C+P  + C+GV DC +  DE +C N+  CN    + C   +  ECI++  +CN   +C    D  L+ C  + C  +   CSHIC +    F CDC P ++L  D++ C  IN+C  NP +C Q C +    Y C C++GY        PTT   +               +  L    K   ++   Q ++ +LD +  + + +F++ L  K                    S++ +K++   + K +   S    A+D     L+++D    +I V N     +  +  +    P +I +DP+ G L+W D G      KI+ + M+G  +  L+  +I+ P  + +D+ + RLYW D     +  +D+N  ++  + ++  VLA    HPF++ +F +R++W+D +   IY A+K +G DV  +
Sbjct:  233 KCSPSEMQCASG---ECIHKKWRCDGDPDCKDGSDEANCPFRTCEEDQFKC-DSGGCVPGNRQCNGVRDCADGSDEASCRNVTQCNGPEKFKC---RSGECIEMSKVCNKIRDCPDWSDEPLKECNLNECLLNNGGCSHICKDMAIGFECDCTPGLQLL-DHKTCGDINECM-NPGICSQICINLKGGYKCECHNGYQMD-----PTTSVCKAVGKEPCLIFTNRRDVRRLGLERKEYTQMVEQQRNVVALDADF-KQQTLFWADLGQK-----------------AIFSTVLDKRDAGAHKKVIDVQSPVGVAVDWIYKNLYWSDLGTRTISVANFNGTKQKVLFSRGLKEPASIAVDPLSGFLYWSDWGEP---AKIEKSGMNGVDRQVLVATDIQWPNGITLDLIKGRLYWVDSKLHLLCSVDLNGDNRKKVLQSADVLA----HPFALTVFEDRVFWTDGENQAIYGANKFSGSDVVTL 676          

HSP 2 Score: 63.929 bits (154), Expect = 1.259e-6
Identity = 60/175 (34.29%), Postives = 86/175 (49.14%), Query Frame = 1
Query:   97 CHFK-CLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKD-SLENCK-----ADFCKTSENTC-SHICINKYSSFTCDCPPDMELSEDNRNC 597
            CH + C  ++  CG  +  QCI   W CD  +DCD+  DEV+C  + C  N+F C  S  CI R  +C+G +DC +  DE +C   +SC   + + CGN+    CI    +C+ +++C    D S   C         C  SE  C S  CI+K   + CD  PD +   D  NC
Sbjct:  103 CHMRTCRVNEFSCGPGTT-QCIPFFWKCDGEKDCDNGEDEVDCGNVTCALNEFTCA-SGRCISRNFVCNGEDDCGDGSDELDCAP-SSCG-PSEFQCGNSS---CIPASWVCDDDVDCQDESDESPTRCGRHPTPPAKCSPSEMQCASGECIHK--KWRCDGDPDCKDGSDEANC 268          
BLAST of low-density lipoprotein receptor-related protein 2 vs. TrEMBL
Match: A0A4W6E9M0 (Very low density lipoprotein receptor OS=Lates calcarifer OX=8187 PE=4 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 2.407e-53
Identity = 138/469 (29.42%), Postives = 226/469 (48.19%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKA-KEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFST----ALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYF-HPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            +CI K W CD + DC D SDE NCP   C  +QFKC D + CI   K C+G+ DC +  DE NC N+  CN    + C   +  ECI++  +CN   +C    D  ++ C  + C  +   CSHIC +    F CDC P ++L  D++ C  IN+C  NP +C Q C +    Y C C++GY        PTT   +               I  L    K   +I   Q +  +LD + ++ +M+F++ L  K                 +Y + +  + +I  + K +    T    A+D     L+F+D +  +I V N     +  ++++    P +I +DP+ G L+W D G      KI+ + M+G  +  L+  +I+ P  + +D+ + RLYW D     +  +D+N  ++  +   S    +Y  HPF++ +F +R++W+D +   IY A+K TG DV  +
Sbjct:  222 ECIHKKWRCDGDPDCKDGSDEANCPVRTCGPDQFKCDDGN-CIVGSKQCNGIRDCSDGSDEVNCKNMTQCNGPEKFKC---RSGECIEMSKVCNKARDCPDWSDEPIKECNLNECLLNNGGCSHICKDMVIGFECDCTPGLQLI-DHKTCGDINECL-NPGICSQICINLKGGYKCECHNGYQMD-----PTTGVCKAVGKEPCLIFTNRRDIRRLGLERKEYTQIVEQQRNTVALDADFDQ-QMIFWADLGQK----------------AVYSTVLDKRGDIGAHSKVIDNVQTPVGIAVDWIYKNLYFSDLSTKTISVANFNGTKQKVLLNRGLKEPASIAVDPLSGFLYWSDWGEP---AKIEKSGMNGVNRQVLVATDIQWPNGITLDLIKGRLYWVDSKLHMLCSVDLNGDNRKKVLQSS----DYLAHPFALTVFEDRVFWTDGENKAIYGANKFTGSDVVTL 655          

HSP 2 Score: 67.3958 bits (163), Expect = 9.983e-8
Identity = 62/175 (35.43%), Postives = 86/175 (49.14%), Query Frame = 1
Query:   97 CHFK-CLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKD-SLENCK-----ADFCKTSENTC-SHICINKYSSFTCDCPPDMELSEDNRNC 597
            CH + C  ++  CG  S  QCI   W CD  +DCD+  DEVNC  + C  N+F C  S  CI R  +C+G +DC +  DE  C   +SC   + + CGN+    CI    +C+ +++C    D S   C         C +SE  C S  CI+K   + CD  PD +   D  NC
Sbjct:   80 CHMRTCRVNEFSCGAGST-QCIPVFWKCDGEKDCDNGEDEVNCGNITCAPNEFTCA-SGRCISRNFVCNGEDDCGDGSDEVECA-PSSCG-PSEFQCGNSS---CIPASWVCDDDVDCQDQSDESPSRCGRHPTPPAKCSSSEMQCRSGECIHK--KWRCDGDPDCKDGSDEANC 245          
BLAST of low-density lipoprotein receptor-related protein 2 vs. TrEMBL
Match: A0A556U2W0 (Very low-density lipoprotein receptor OS=Bagarius yarrelli OX=175774 GN=Baya_7983 PE=4 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 2.930e-53
Identity = 136/482 (28.22%), Postives = 238/482 (49.38%), Query Frame = 1
Query:  106 KCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSA---FSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYF-HPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            KCL  +  CG     +CI   W CD + DC D SDE NCPP  C  +QFKC D   CI   + C+G  DC +  DE NC N+  C+    Y C   +  ECI+I  +CN   +C+   D  ++ C  + C  +   CSH+C N    + CDC P ++L  D++ C  IN+C  NP +C Q C +    Y C C++GY  +    V      E +L++++   I  + +       +  ++     +  +LD + +R + +F++ L  K                 ++ +++  +++   + K +        A+D     ++++D    +I V + +   +  + DKD   P +I +DP+ G L+W D G      KI+ + M+G  +  L+E +I+ P  + +D+ + RLYW D     +  +D+N  ++  +    + + +Y  HPF++ +F +RI+W+D +   IY A+K TG DV ++
Sbjct:  324 KCLASEIQCGSG---ECIHSKWRCDGDADCKDGSDERNCPPRSCHPDQFKCDDGS-CIHGSRQCNGFRDCADGTDEDNCKNLTQCSGPDKYKC---RSGECIEISKVCNKVRDCTDWSDEPIKECDLNECLINNGGCSHLCRNLVIGYECDCTPGLQLI-DHKTCGDINECL-NPGICSQICINLKGGYKCECHEGYQMNSSTGVCKAVGKEPSLIFTNRRDIRKLGLE----RREYTQLVEQLRNTVALDADFSR-QQIFWADLGQK----------------AIFSTALDKREDASRHTKVIDVQMPVGIAVDWIYKNIYWSDLGSKTIGVADFSGTRQKVLFDKDLKEPADIAVDPLSGFLYWSDWGEP---AKIEKSGMNGVDRQVLVETDIQWPNGITLDLIKSRLYWVDSKLHTLCSVDLNGDNRKKV----LQSQDYLAHPFALTVFEDRIFWTDGESEAIYGANKFTGSDVVML 768          

HSP 2 Score: 70.8626 bits (172), Expect = 8.492e-9
Identity = 68/212 (32.08%), Postives = 98/212 (46.23%), Query Frame = 1
Query:   97 CHFK-CLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKD-SLENCK-----ADFCKTSENTC-SHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQG-CQDNGKSYNCF--CYDGYTE 699
            CH + C  ++  CG  S   CI   W CD  +DCD+  DE++C  + C   +F C  S  C+ +  +C+G +DC +  DE +C+  +SC +   + C N     CI I  +C+ +I+C    D S  +C      A  C  SE  C S  CI  +S + CD   D +   D RNC     C  +   C  G C    +  N F  C DG  E
Sbjct:  194 CHSRTCRTNEFSCGTGSTL-CIPVSWKCDGERDCDNGEDEMSCGNITCSPLEFTCA-SGRCVSQNFVCNGEDDCGDGTDELDCSP-SSC-DANQFRCANAT---CIPISWVCDRDIDCQDQLDESPLHCGRNATPAAKCLASEIQCGSGECI--HSKWRCDGDADCKDGSDERNCPP-RSCHPDQFKCDDGSCIHGSRQCNGFRDCADGTDE 395          

HSP 3 Score: 62.003 bits (149), Expect = 4.523e-6
Identity = 51/162 (31.48%), Postives = 76/162 (46.91%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDE------WNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTC-SHICINKYSSFTCDCPPDMELSEDNRNCKHINKC 615
            +C+S+ +VC+   DC D +DE++C P  CD NQF+C ++  CIP   +CD   DC +  DE       N T    C   +   CG+    ECI  +  C+ + +C    D   NC    C   +  C    CI  + S  C+   D     D  NCK++ +C
Sbjct:  251 RCVSQNFVCNGEDDCGDGTDELDCSPSSCDANQFRCANA-TCIPISWVCDRDIDCQDQLDESPLHCGRNATPAAKC-LASEIQCGSG---ECIHSKWRCDGDADCKDGSDE-RNCPPRSCHPDQFKCDDGSCI--HGSRQCNGFRDCADGTDEDNCKNLTQC 404          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Cavefish
Match: vldlr (very low density lipoprotein receptor [Source:NCBI gene;Acc:103023739])

HSP 1 Score: 197.593 bits (501), Expect = 2.304e-53
Identity = 138/497 (27.77%), Postives = 225/497 (45.27%), Query Frame = 1
Query:  106 KCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGY----------TEHDQKCVPTTEENEIXXXXXXXXXXXX-----XXXXXLNPHYKAKEIF---RGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYF-HPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            KC   +  CG     +CI + W CD + DC D SDE NCP   C  +QFKC D   CI   + C+G+ DC +  DE NC N+  CN    + C   +  ECI +  +CN   +C    D  ++ C  + C  +   CSHIC +    + CDC P ++L  D + C  IN+C  NP +C Q C +    Y C C+ GY              + C+  T   +I  L               +   L+  +  + IF    GQ  IFS    L++ E V Y+ ++                             N++M          A+D     ++++D    +I V N     +  + D++   P +I +DP+ G L+W D G      KI+ + M+G  +  L+E +I+ P  + +D+ + RLYW D     +  +D+N  ++  +    + + +Y  HPF++ +F +R++W+D +   IY A+K TG DV ++
Sbjct:  155 KCSVSEILCGSG---ECIHRKWRCDGDADCKDGSDEKNCPARSCRPDQFKCEDGS-CIHGSRQCNGIRDCTDGTDEVNCKNLTQCNGPDKFKC---RSGECIDMHKVCNKARDCPDWSDEPIKECNLNECLLNNGGCSHICRDMVIGYECDCTPGLQLI-DRKTCGDINECL-NPGICSQICINLKGGYKCECHSGYLMDAATGVCKAVGKEPCLIFTNRRDIRKLGLERREYTQIVEQLRNTVALDADFTQQRIFWADLGQKAIFS--TVLDKREDVGYTKVI----------------------------DNVQM------PVGIAVDWIYKNIYWSDLGSKTIVVANFNGTKQKVLFDRNLKEPASIAVDPLSGFLYWSDWGEP---AKIEKSGMNGVDRQVLVETDIQWPNGITLDLIKSRLYWVDSKLHTLCSVDLNGDNRRKV----LQSQDYLAHPFALTVFEDRVFWTDGESEAIYGANKFTGSDVTML 599          

HSP 2 Score: 60.8474 bits (146), Expect = 3.637e-9
Identity = 48/160 (30.00%), Postives = 71/160 (44.38%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSH-ICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNP 627
            +CI  +W CD ++DC D SDE  C   +C +  F C +   CIP+   CDG  DC +  DE      N       + C + +   CI    +CN   +C    D  ++C    C  +E  C +  CI   S + CD  PD +   D    +   +C +NP
Sbjct:    2 RCIPSVWQCDGDEDCSDGSDESTCVRKMCAETDFVCRNGQ-CIPKRWHCDGEPDCEDGSDEGTEQCCNVTCALLEFTCTSGR---CISQNFVCNGEDDCGDGSDE-QDCAPSSCGPNEFQCGNATCIP--SGWVCDDDPDCQDHSD----ESPLRCGRNP 150          

HSP 3 Score: 59.6918 bits (143), Expect = 7.868e-9
Identity = 52/162 (32.10%), Postives = 79/162 (48.77%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDE------WNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCS-HICINKYSSFTCDCPPDMELSEDNRNCKHINKC 615
            +CIS+ +VC+   DC D SDE +C P  C  N+F+C ++  CIP   +CD   DC ++ DE       N T    C+  +   CG+    ECI  +  C+ + +C    D  +NC A  C+  +  C    CI  + S  C+   D     D  NCK++ +C
Sbjct:   82 RCISQNFVCNGEDDCGDGSDEQDCAPSSCGPNEFQCGNA-TCIPSGWVCDDDPDCQDHSDESPLRCGRNPTPPAKCS-VSEILCGSG---ECIHRKWRCDGDADCKDGSDE-KNCPARSCRPDQFKCEDGSCI--HGSRQCNGIRDCTDGTDEVNCKNLTQC 235          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Cavefish
Match: vldlr (very low density lipoprotein receptor [Source:NCBI gene;Acc:103023739])

HSP 1 Score: 197.208 bits (500), Expect = 8.762e-53
Identity = 138/497 (27.77%), Postives = 225/497 (45.27%), Query Frame = 1
Query:  106 KCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGY----------TEHDQKCVPTTEENEIXXXXXXXXXXXX-----XXXXXLNPHYKAKEIF---RGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYF-HPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            KC   +  CG     +CI + W CD + DC D SDE NCP   C  +QFKC D   CI   + C+G+ DC +  DE NC N+  CN    + C   +  ECI +  +CN   +C    D  ++ C  + C  +   CSHIC +    + CDC P ++L  D + C  IN+C  NP +C Q C +    Y C C+ GY              + C+  T   +I  L               +   L+  +  + IF    GQ  IFS    L++ E V Y+ ++                             N++M          A+D     ++++D    +I V N     +  + D++   P +I +DP+ G L+W D G      KI+ + M+G  +  L+E +I+ P  + +D+ + RLYW D     +  +D+N  ++  +    + + +Y  HPF++ +F +R++W+D +   IY A+K TG DV ++
Sbjct:  233 KCSVSEILCGSG---ECIHRKWRCDGDADCKDGSDEKNCPARSCRPDQFKCEDGS-CIHGSRQCNGIRDCTDGTDEVNCKNLTQCNGPDKFKC---RSGECIDMHKVCNKARDCPDWSDEPIKECNLNECLLNNGGCSHICRDMVIGYECDCTPGLQLI-DRKTCGDINECL-NPGICSQICINLKGGYKCECHSGYLMDAATGVCKAVGKEPCLIFTNRRDIRKLGLERREYTQIVEQLRNTVALDADFTQQRIFWADLGQKAIFS--TVLDKREDVGYTKVI----------------------------DNVQM------PVGIAVDWIYKNIYWSDLGSKTIVVANFNGTKQKVLFDRNLKEPASIAVDPLSGFLYWSDWGEP---AKIEKSGMNGVDRQVLVETDIQWPNGITLDLIKSRLYWVDSKLHTLCSVDLNGDNRRKV----LQSQDYLAHPFALTVFEDRVFWTDGESEAIYGANKFTGSDVTML 677          

HSP 2 Score: 60.4622 bits (145), Expect = 4.985e-9
Identity = 51/171 (29.82%), Postives = 75/171 (43.86%), Query Frame = 1
Query:  100 HFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKT----HYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTC-SHICINKYSSFTCDCPPDMELSEDNRNC 597
              +C      CG     +CI  +W CD ++DC D SDE  C   +C +  F C +   CIP+   CDG  DC +  DE        C  +T     ++CG      CI +   C+   +C   +D + NC    C   E TC S  CI++  +F C+   D     D ++C
Sbjct:   25 QAECETSQFQCGNG---RCIPSVWQCDGDEDCSDGSDESTCVRKMCAETDFVCRNGQ-CIPKRWHCDGEPDCEDGSDE----GTEQCYTRTCRMNEFSCG-VGSTPCIPVFWKCDGESDCDNGEDEM-NCGNVTCALLEFTCTSGRCISQ--NFVCNGEDDCGDGSDEQDC 183          

HSP 3 Score: 60.077 bits (144), Expect = 8.049e-9
Identity = 52/162 (32.10%), Postives = 79/162 (48.77%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDE------WNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCS-HICINKYSSFTCDCPPDMELSEDNRNCKHINKC 615
            +CIS+ +VC+   DC D SDE +C P  C  N+F+C ++  CIP   +CD   DC ++ DE       N T    C+  +   CG+    ECI  +  C+ + +C    D  +NC A  C+  +  C    CI  + S  C+   D     D  NCK++ +C
Sbjct:  160 RCISQNFVCNGEDDCGDGSDEQDCAPSSCGPNEFQCGNA-TCIPSGWVCDDDPDCQDHSDESPLRCGRNPTPPAKCS-VSEILCGSG---ECIHRKWRCDGDADCKDGSDE-KNCPARSCRPDQFKCEDGSCI--HGSRQCNGIRDCTDGTDEVNCKNLTQC 313          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Cavefish
Match: vldlr (very low density lipoprotein receptor [Source:NCBI gene;Acc:103023739])

HSP 1 Score: 196.823 bits (499), Expect = 9.727e-53
Identity = 138/497 (27.77%), Postives = 225/497 (45.27%), Query Frame = 1
Query:  106 KCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGY----------TEHDQKCVPTTEENEIXXXXXXXXXXXX-----XXXXXLNPHYKAKEIF---RGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYF-HPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            KC   +  CG     +CI + W CD + DC D SDE NCP   C  +QFKC D   CI   + C+G+ DC +  DE NC N+  CN    + C   +  ECI +  +CN   +C    D  ++ C  + C  +   CSHIC +    + CDC P ++L  D + C  IN+C  NP +C Q C +    Y C C+ GY              + C+  T   +I  L               +   L+  +  + IF    GQ  IFS    L++ E V Y+ ++                             N++M          A+D     ++++D    +I V N     +  + D++   P +I +DP+ G L+W D G      KI+ + M+G  +  L+E +I+ P  + +D+ + RLYW D     +  +D+N  ++  +    + + +Y  HPF++ +F +R++W+D +   IY A+K TG DV ++
Sbjct:  233 KCSVSEILCGSG---ECIHRKWRCDGDADCKDGSDEKNCPARSCRPDQFKCEDGS-CIHGSRQCNGIRDCTDGTDEVNCKNLTQCNGPDKFKC---RSGECIDMHKVCNKARDCPDWSDEPIKECNLNECLLNNGGCSHICRDMVIGYECDCTPGLQLI-DRKTCGDINECL-NPGICSQICINLKGGYKCECHSGYLMDAATGVCKAVGKEPCLIFTNRRDIRKLGLERREYTQIVEQLRNTVALDADFTQQRIFWADLGQKAIFS--TVLDKREDVGYTKVI----------------------------DNVQM------PVGIAVDWIYKNIYWSDLGSKTIVVANFNGTKQKVLFDRNLKEPASIAVDPLSGFLYWSDWGEP---AKIEKSGMNGVDRQVLVETDIQWPNGITLDLIKSRLYWVDSKLHTLCSVDLNGDNRRKV----LQSQDYLAHPFALTVFEDRVFWTDGESEAIYGANKFTGSDVTML 677          

HSP 2 Score: 60.077 bits (144), Expect = 6.232e-9
Identity = 51/171 (29.82%), Postives = 75/171 (43.86%), Query Frame = 1
Query:  100 HFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKT----HYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTC-SHICINKYSSFTCDCPPDMELSEDNRNC 597
              +C      CG     +CI  +W CD ++DC D SDE  C   +C +  F C +   CIP+   CDG  DC +  DE        C  +T     ++CG      CI +   C+   +C   +D + NC    C   E TC S  CI++  +F C+   D     D ++C
Sbjct:   25 QAECETSQFQCGNG---RCIPSVWQCDGDEDCSDGSDESTCVRKMCAETDFVCRNGQ-CIPKRWHCDGEPDCEDGSDE----GTEQCYTRTCRMNEFSCG-VGSTPCIPVFWKCDGESDCDNGEDEM-NCGNVTCALLEFTCTSGRCISQ--NFVCNGEDDCGDGSDEQDC 183          

HSP 3 Score: 59.3066 bits (142), Expect = 1.247e-8
Identity = 52/162 (32.10%), Postives = 79/162 (48.77%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDE------WNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCS-HICINKYSSFTCDCPPDMELSEDNRNCKHINKC 615
            +CIS+ +VC+   DC D SDE +C P  C  N+F+C ++  CIP   +CD   DC ++ DE       N T    C+  +   CG+    ECI  +  C+ + +C    D  +NC A  C+  +  C    CI  + S  C+   D     D  NCK++ +C
Sbjct:  160 RCISQNFVCNGEDDCGDGSDEQDCAPSSCGPNEFQCGNA-TCIPSGWVCDDDPDCQDHSDESPLRCGRNPTPPAKCS-VSEILCGSG---ECIHRKWRCDGDADCKDGSDE-KNCPARSCRPDQFKCEDGSCI--HGSRQCNGIRDCTDGTDEVNCKNLTQC 313          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Cavefish
Match: vldlr (very low density lipoprotein receptor [Source:NCBI gene;Acc:103023739])

HSP 1 Score: 196.823 bits (499), Expect = 1.053e-52
Identity = 138/497 (27.77%), Postives = 225/497 (45.27%), Query Frame = 1
Query:  106 KCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGY----------TEHDQKCVPTTEENEIXXXXXXXXXXXX-----XXXXXLNPHYKAKEIF---RGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYF-HPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            KC   +  CG     +CI + W CD + DC D SDE NCP   C  +QFKC D   CI   + C+G+ DC +  DE NC N+  CN    + C   +  ECI +  +CN   +C    D  ++ C  + C  +   CSHIC +    + CDC P ++L  D + C  IN+C  NP +C Q C +    Y C C+ GY              + C+  T   +I  L               +   L+  +  + IF    GQ  IFS    L++ E V Y+ ++                             N++M          A+D     ++++D    +I V N     +  + D++   P +I +DP+ G L+W D G      KI+ + M+G  +  L+E +I+ P  + +D+ + RLYW D     +  +D+N  ++  +    + + +Y  HPF++ +F +R++W+D +   IY A+K TG DV ++
Sbjct:  233 KCSVSEILCGSG---ECIHRKWRCDGDADCKDGSDEKNCPARSCRPDQFKCEDGS-CIHGSRQCNGIRDCTDGTDEVNCKNLTQCNGPDKFKC---RSGECIDMHKVCNKARDCPDWSDEPIKECNLNECLLNNGGCSHICRDMVIGYECDCTPGLQLI-DRKTCGDINECL-NPGICSQICINLKGGYKCECHSGYLMDAATGVCKAVGKEPCLIFTNRRDIRKLGLERREYTQIVEQLRNTVALDADFTQQRIFWADLGQKAIFS--TVLDKREDVGYTKVI----------------------------DNVQM------PVGIAVDWIYKNIYWSDLGSKTIVVANFNGTKQKVLFDRNLKEPASIAVDPLSGFLYWSDWGEP---AKIEKSGMNGVDRQVLVETDIQWPNGITLDLIKSRLYWVDSKLHTLCSVDLNGDNRRKV----LQSQDYLAHPFALTVFEDRVFWTDGESEAIYGANKFTGSDVTML 677          

HSP 2 Score: 60.4622 bits (145), Expect = 6.184e-9
Identity = 51/171 (29.82%), Postives = 75/171 (43.86%), Query Frame = 1
Query:  100 HFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKT----HYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTC-SHICINKYSSFTCDCPPDMELSEDNRNC 597
              +C      CG     +CI  +W CD ++DC D SDE  C   +C +  F C +   CIP+   CDG  DC +  DE        C  +T     ++CG      CI +   C+   +C   +D + NC    C   E TC S  CI++  +F C+   D     D ++C
Sbjct:   25 QAECETSQFQCGNG---RCIPSVWQCDGDEDCSDGSDESTCVRKMCAETDFVCRNGQ-CIPKRWHCDGEPDCEDGSDE----GTEQCYTRTCRMNEFSCG-VGSTPCIPVFWKCDGESDCDNGEDEM-NCGNVTCALLEFTCTSGRCISQ--NFVCNGEDDCGDGSDEQDC 183          

HSP 3 Score: 59.6918 bits (143), Expect = 1.033e-8
Identity = 52/162 (32.10%), Postives = 79/162 (48.77%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDE------WNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCS-HICINKYSSFTCDCPPDMELSEDNRNCKHINKC 615
            +CIS+ +VC+   DC D SDE +C P  C  N+F+C ++  CIP   +CD   DC ++ DE       N T    C+  +   CG+    ECI  +  C+ + +C    D  +NC A  C+  +  C    CI  + S  C+   D     D  NCK++ +C
Sbjct:  160 RCISQNFVCNGEDDCGDGSDEQDCAPSSCGPNEFQCGNA-TCIPSGWVCDDDPDCQDHSDESPLRCGRNPTPPAKCS-VSEILCGSG---ECIHRKWRCDGDADCKDGSDE-KNCPARSCRPDQFKCEDGSCI--HGSRQCNGIRDCTDGTDEVNCKNLTQC 313          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000019438.2 (low-density lipoprotein receptor-related protein 8 [Source:NCBI gene;Acc:103046677])

HSP 1 Score: 192.971 bits (489), Expect = 4.030e-51
Identity = 138/500 (27.60%), Postives = 235/500 (47.00%), Query Frame = 1
Query:  130 CGKNSF----FQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSL-ENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRV-KPINLRIISKESNRQLIKKIN 1611
            CG  +F     +CI   W CD + DC D SDE +CP + C  ++F+C D   CI   K C+   DC++  DE  C N   C     + C N    ECI    +C+   +C    D   + C  + C  +   CSHIC+++   + C CP   +L  D R C  I++C +NP+ C Q C +    + C CY GY E D   V  T + E    Y  F++ + +   +L       ++   Q +  ++DV++  N M +      K     + +  +   +V L  S + + + +            ALD  ++ L++TD  D SI V +     +  ++D +   P  I +DP  G +FW D G     PKI+ A M+G  +  L+ + I+ P  + +D+  +RLYW D     I  +D N   +  I + +       HP+++ +F +R+YW+D ++  +YSA++++G DV  + + +  P ++ +  + S  Q     N
Sbjct:  241 CGTGAFRCGSGECIRLAWRCDRDPDCKDKSDEADCPLLTCRPDEFQCGDGS-CIHGIKQCNKAFDCLDRSDEAGCVNATKCEGPLKFLCRNG---ECIDGAKVCDDVKDCKDRSDEPKKECGLNECMLNNGGCSHICVDRPIGYECQCPAGYKLL-DKRTCGDIDEC-ENPDACSQICINLKGDFKCECYQGY-EMDP--VSKTCKAEGKSPYLMFTNRHEIRRIDLV-KRDYTQVVPTQKNAVAMDVDVAANRMFWCDRFHRKIYSAYIHEASDPSRHVTLIDSELHSPEGL------------ALDWVQHNLYWTDSGDRSISVASADGSRRRVLIDTELSEPRAIAVDPEQGFMFWSDWGMR---PKIEKAGMNGVDRQVLVSEGIEWPNGITLDVVGKRLYWVDSKLHLISSVDFNGAQRRVILSSNE---RLGHPYALAVFEDRVYWTDREKEAVYSANRLSGLDVTSLAEHLNDPHDIVVFHELSQPQAPDSCN 712          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Sea Lamprey
Match: lrp2a (low density lipoprotein receptor-related protein 2a [Source:ZFIN;Acc:ZDB-GENE-050119-2])

HSP 1 Score: 168.703 bits (426), Expect = 1.712e-43
Identity = 135/475 (28.42%), Postives = 221/475 (46.53%), Query Frame = 1
Query:  109 CLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDE-VNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNC-TNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYT-EHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGR--LFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITG 1518
            C  D+  C  +    CI   W CD + DCDD SDE   CPP  C     +C D+  C+P    CDG NDC +  DE +C T    C   + + C N +   C+ +  +C+ N +C    D   +C    C  +   CSH C+       C CPP  +L +D +NC  +++C   P  C Q C +   S+ C C  GYT E D++     + +E+ LL  S S IYS +I    P+  +  +  G+  I ++D +     +  Y + V +D +   S L+N            +++Q +   +      + A+D     L++ D+   +I V  L    +  ++  +   P  +V+DP  G   +FW D G     P+I+ A MDG  + T++  ++  P  LAID     LY+ D +   I + D N  ++  +   S L ++  HP +I IF + +YW+D   +++  A+K  G
Sbjct: 1192 CHNDEFQCQSDGL--CIPAGWECDGHPDCDDGSDEHPGCPPRTCAAGYLRC-DNGNCVPESWRCDGDNDCRDGTDERDCPTPPYRCQSPSQWLCPNHRA--CVDLRKVCDGNFDCPDGGDESPHCNEHDCSVNNGGCSHGCVQGPFGAQCTCPPGFQLLDDTKNCADVDEC-DPPGSCSQQCVNEHGSFRCHCDLGYTMESDRRTCKANDRHEVLLLVPSRSQIYSDNITA-TPNVLSSVVRNGR-SIVAVDFDARAGRI--YWADVAEDKIW--SALRNG-----------TDRQLVHKQVGLTVTENLAVDWIGKNLYWLDFVLETIEVSRLDGSHRTVLISTNVTNPRGLVLDPRDGSRTMFWTDWGKN---PRIERAGMDGRLRRTIVSSKLYWPNGLAIDYATNLLYFADAYLDFIDFCDFNGQNRRQVLA-SDLILQ--HPHAITIFEDFVYWTDRSTNRVMRANKWHG 1637          

HSP 2 Score: 131.724 bits (330), Expect = 1.137e-31
Identity = 131/529 (24.76%), Postives = 229/529 (43.29%), Query Frame = 1
Query:  154 CISKLWVCDYNQDCDDNSDEV--NCPPMICDK-NQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTK----KLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHICIN-KYSSFTCDCPPDMELSEDNRN-CKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYT----EHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRN----EMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQN-----IEMNLKNLS-AFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAID-IEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVKPINLRIISKESNRQLIKKINEHKIGKYCSGVINTCRGSC 1668
            CI   W CD + DC D SDE   +C    C+   +F+C D++ CI   ++C+ V+DC +  DE      + C E T   C   +       CI +  +CN    C  N D     +      +E  C   C N   + F C C P    + +NRN C  +N+C +    C Q CQ+   +Y CFC DGY      + ++C+       + L        Y ++        K  +    ++DI +LD + + +     MV+Y+ L        + +          YL++ SN        I + L+ +S     A+D     +++TD   S I V  L    + ++++     P  I ++P +G ++W D G     PKI+MA MDG  +  L++  +  P  LA+D     R+YW D   + I+ +  +   +      +V++ +  +PF++ +F + +YW+  +  +++  +K  G  VK            I++  S     +   +H   +Y   V N C+G+C
Sbjct: 3819 CIPPSWKCDGDNDCGDGSDEELHHCLDTPCNPPGRFRC-DNNRCIYSHEICNAVDDCGDGSDE----TPDKCKEPTFAPCTEEEFKCASGRCIPMAAVCNNYNECRDNTDETGCNQGQDRTCAERICEQNCTNLPGNGFICSCRPGFTANAENRNNCDDVNEC-EVFGTCPQDCQNAKGTYECFCVDGYRSAAGSYGKRCIANDNSPVLLLADKVRVRKYDLTSQ------KQADYISNEEDIQALDFDWDHDGTGLSMVYYTVLRSGGKFGSIKR---------AYLAAFSNSSENFATGINLGLRYISQPDGIAVDWVGRHIYWTDAQTSRIEVALLDGRYRKQLINSVLDKPATIALNPKLGMMYWTDWGVV---PKIEMAWMDGQQRQHLVQGLLGWPTGLAVDHTNNGRIYWCDAKENVIESVRPDGGDRR-----TVISGDLGNPFTLDVFESNVYWTTRETGQVWQQNKF-GSGVKS----------HILTVNSWLSQARVFQKH---RYNVNVKNPCKGTC 4304          

HSP 3 Score: 115.546 bits (288), Expect = 1.665e-26
Identity = 65/183 (35.52%), Postives = 89/183 (48.63%), Query Frame = 1
Query:  154 CISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWN--CTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFC-KTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGY 693
            C+   + CD   DC D SDE  C    C +NQF C ++  CIPR   CDG NDC +  DE    C   +       + CG     EC+ I  +CN   +C+   D  + C  + C   S N C+H C N  +SF C C     L  + R C+ I++C + P+VC Q C++   SY C C  GY
Sbjct: 2967 CVHSRYRCDRRNDCGDGSDERGCTYPTCRQNQFTC-ENGRCIPRIFACDGDNDCGDGSDEDTHLCHQPSPTCAPGFFRCGAG---ECVAIHLVCNQANDCADGSDE-KGCGINECLYASINQCAHNCTNTLTSFYCSCWAGFRLMANGRACEDIDECNETPQVCSQLCENTAGSYFCKCAPGY 3144          

HSP 4 Score: 105.916 bits (263), Expect = 1.370e-23
Identity = 114/502 (22.71%), Postives = 207/502 (41.24%), Query Frame = 1
Query:   97 CHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTH---YNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSEN----TCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGY-TEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDV----------NLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGR--LFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDK 1542
            C  +C   +  C      +C+ + + CD+  DC D SDE  C    C  NQF C  S  CI +  +CDG +DC +  DE  C +  S   + +   + C  +K   CI    +C+   +C    D   N  A    + EN    +C + C    +   C CPP   +S ++  C   + C K   VC Q C++    + C C  GY  E+ + C                                A  +F    D+   D+          + NR   V          V     +QN  L+V++   ++    ++ +++      + A+D   N L+  + +   I V +L   +++ ++ ++   P  I +DP +G+  +F+ D  + +  P+++ A MDG+ +  L+  ++  P  + +D   QR++W D   +   YI+  +   L  KT         HPF I  F + +Y++D    ++   +   G D++V+ +
Sbjct:  152 CTARCPVGEFQCANE---RCVPQSYRCDHIDDCTDGSDENGCVYGTCQGNQFTCA-SGRCILQSWVCDGDDDCFDGSDERGCVSAASEERECYPEEWPCPGSKA--CIPFRKVCDGRRDCPHGTDE-SNSTAGLACSIENCGALSCEYRCHASPAGGACYCPPSFVVSNNSITCMDFDDC-KMWGVCDQFCENRPAGHMCQCSPGYLLEYGKHCRADVTSG------------------------VASLLFSNGKDLVMSDLQGRTVRVLVPSQNRGVAVGVDYHYILRRVFWTDTMQNKVLSVNMDTLAVETVLSVALDMPE----NLAVDWISNKLYIVESSVDRIDVTDLNGANRLTLIAENLGRPRGIALDPTVGKGSIFFSDWDDASGNPRLERAYMDGTNRLALVRTKLGWPAGITLDFVLQRVFWVD---NRFDYIESVTYDGLIRKTILSGGANVPHPFDITTFEHYVYFTDWTRMEVTRVNVFNGSDLQVVHR 614          

HSP 5 Score: 88.9669 bits (219), Expect = 2.709e-18
Identity = 60/188 (31.91%), Postives = 86/188 (45.74%), Query Frame = 1
Query:  112 LQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNC---PPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKT----HYNCGNTK--KLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSH-ICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQG 645
            + ++  CG     QCI   WVCD  QDC DN+DE +    P   C   QF C DS  CIP   +CDG NDC +  DE      ++C  +T     + C +    +  CI+   +C+ + +CS   D  +NC    C   E  C + +C+  +S + CD   D     D R C +   C +N   C  G
Sbjct: 2827 IANEFRCGNG---QCIPLSWVCDSEQDCTDNADEPSSCSDPGRTCPGTQFTC-DSGRCIPGSWICDGDNDCGDGSDE---DGRHACGARTCGPHEFTCADASPPRRRCIQRRFVCDGDADCSDALDEHQNCTRRSCTAGEFACDNGLCV--HSRYRCDRRNDCGDGSDERGCTY-PTCRQNQFTCENG 3004          

HSP 6 Score: 77.411 bits (189), Expect = 8.171e-15
Identity = 50/164 (30.49%), Postives = 76/164 (46.34%), Query Frame = 1
Query:  109 CLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSH-ICINKYSSFTCDCPPDMELSEDNRNC 597
            C      CG  +   CI + WVCD   DC D+SDE  C P  C   QF+C   + CI R  +CDG  DC +  DE      ++C+  +H+ C +     C++    C+   +C    D  ++C+   C  +E TC++  C N  ++  CD   +     D  NC
Sbjct:    1 CDSGQFRCGSGA---CIPRSWVCDSINDCSDDSDERGCSPATCTTLQFRCRSDNRCIARAFVCDGEADCADRSDEHQNCPGSTCSS-SHFTCASG---HCVQSAFRCDHFQDCDDRSDE-QSCQYPTC--AEMTCANGACFN--TAQRCDGVVNCRDLSDEANC 152          

HSP 7 Score: 72.0182 bits (175), Expect = 3.819e-13
Identity = 64/224 (28.57%), Postives = 90/224 (40.18%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS----LENCKADFCKTSENTC-SHICINKYSSFTCD--------------------CPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKC-----VPTTEE 732
            +CI   W CD   DC D SDE NC P  C +++F+C +   CIP   +C+  NDC +N DE +C  + +C    ++ CG+     CI     C+ + +C    D            +C  S   C +H+CI    S+ CD                    C P      DN      N+C  + E+C+    D        C DG  E   KC      P TEE
Sbjct: 3696 RCIPLRWRCDRYDDCGDGSDERNCAPRPCSESEFRCTNQR-CIPGRWVCNHENDCGDNSDERDC-ELQTC-LPGYFQCGSG---HCIPERLKCDGSADCQDFSDESLCPTRYPNGTWCPPSSFECDNHVCIP--PSWKCDGDNDCGDGSDEELHHCLDTPCNPPGRFRCDN------NRCIYSHEICN-AVDD--------CGDGSDETPDKCKEPTFAPCTEE 3896          

HSP 8 Score: 68.1662 bits (165), Expect = 6.580e-12
Identity = 66/245 (26.94%), Postives = 93/245 (37.96%), Query Frame = 1
Query:  130 CGKNSFF-----QCISKLWVCDYNQDCDDNSDE-------VNCPP---------------------MICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSH--ICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQG---CQDNG----KSYNC----FCYDGYTEHDQKCVPTT 726
            C    FF     +C+ +L++CD   DC D SDE       V C P                       C  +QF C   + CIPR  +CD  NDC +  DE  C    +C+    + C + +   CI    +C+ + +C    D    C  + C + + +CS    CI  Y  + CD   D     D   C       + P +CH     CQ +G      + C     C DG  EH   C P T
Sbjct: 1002 CSSTEFFACANGRCVPRLFLCDGYDDCHDGSDERGCGTGNVTCSPYAFTCTNRRCIPIDWRPTRLATTCRADQFTCASGNRCIPRYWICDTDNDCGDGSDERGCDMSGTCH-PMQFQCPDHR---CIDNAYVCDGDSDCVDGADE-RGCVFN-CTSYQFSCSSGDQCIATY--YRCDGAFDCRDRSDEVGCPT-----RAPGLCHNDEFQCQSDGLCIPAGWECDGHPDCDDGSDEH-PGCPPRT 1232          

HSP 9 Score: 65.0846 bits (157), Expect = 5.094e-11
Identity = 54/182 (29.67%), Postives = 87/182 (47.80%), Query Frame = 1
Query: 1015 SAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQ---RLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVK 1551
            S  S A D     L++TD  + ++ VM L    +  I+  +   P +IV+ P+ G +F+ D    N   KI  A  DGS    ++   +  P  LAID +     +LYW D F   I++ + N  ++  +   S LA    HPFSI I G   Y+SD + + I    K+ G +  +I + ++
Sbjct:  759 SVESLAYDWVSKNLYWTDTRNRAVTVMRLIDQSRRNIL-SNLQNPRSIVVHPLQGYIFYSDW---NRPAKIVRAWCDGSHATPIVNTSLGWPNGLAIDWQSPWNPKLYWVDAFFDRIEFSNFNGQNRQRLDRISHLA----HPFSISIHGGFAYFSDWRLNSIVRVQKMDGGEAVIIRQGIQ 932          

HSP 10 Score: 65.0846 bits (157), Expect = 5.270e-11
Identity = 50/219 (22.83%), Postives = 99/219 (45.21%), Query Frame = 1
Query: 1030 ALDPARNLLFFTDYNDSSIYVMNLTSFDK--IKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRV--KPINLRIISKESNRQLIKKINEHKIGKYCSGVINTCRGSCLP 1674
            A D     ++++DY + +I  M L   ++  + +V +    P  I++DP  G ++W D    +   KI+ A + G+F+  ++   +  P  L +D  E  LYW D +   I+   +    +  I + +V      +PF++ I    +YW+D     +Y A K  G D  V+ + +  +P+++ I++    ++     N+   G         C   C+P
Sbjct: 2433 AFDWINRRIYYSDYANQTIGSMGLDGGNRTVVALVPR----PRAIMLDPCKGYMYWTDW---SVNAKIERATLGGNFRVPIINSSLVWPNGLTLDYSENMLYWADAYRQKIERSTLTGDRREVIVSMAV------YPFALTIHEQHVYWTDWNTKSVYRATKDDGADQVVMIQNLPYRPMDIHILTASKQQRCSNPCNQFNGG---------CSHICVP 2629          

HSP 11 Score: 63.5438 bits (153), Expect = 1.744e-10
Identity = 56/226 (24.78%), Postives = 81/226 (35.84%), Query Frame = 1
Query:  121 DHYCGKNSF----FQCISKLWVCDYNQDCDDNSDE--VNCPPMICDKNQFKCPDSDL--------------------------------------------CIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQG 645
            +H C  N +     +CI   W+CD   DC D SDE    C    C   QF+C +                                               CIP   +C+G++DC +N DE  C  I +C+    Y C N +   CI +   C+   +C    D   NC    C  SE  C++  CI     + C+   D   + D R+C+ +  C      C  G
Sbjct: 3556 NHRCNSNQWQCMNKRCIPAAWLCDGGPDCQDGSDEDSATCAARTCAPGQFRCNNGRCIPRSWVCDVDDDCGDGSDEPHDTCMGPSHRCDSHTEFACRTNYRCIPTWAVCNGMDDCRDNSDEQGCAEI-TCDPLGDYRCDNHR---CIPLRWRCDRYDDCGDGSDE-RNCAPRPCSESEFRCTNQRCIP--GRWVCNHENDCGDNSDERDCE-LQTCLPGYFQCGSG 3773          

HSP 12 Score: 61.6178 bits (148), Expect = 6.022e-10
Identity = 36/129 (27.91%), Postives = 66/129 (51.16%), Query Frame = 1
Query: 1144 FPFNIVIDPVMGRLFWIDLGNENNGP-KIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYF-HPFSIFIFGNRIYWSDLKEHKIYSAHKITGKD 1524
            +P  I +DP  GRL+W D G+++  P K+  A+MDGS    L    +    F+ +D+ EQ+LYW       I+  D+  L+++ +       +++  HP+ + +  + +Y++D      Y   +  GKD
Sbjct: 1835 YPVGIALDPSRGRLYWTDHGSDSGVPAKVAAADMDGSNPTVLFSGNMDHVDFITLDMREQKLYWAVAGTGVIERGDVTGLNRITV-------VQHLSHPWGVAVHESHLYYTDYD----YEVVERVGKD 1952          

HSP 13 Score: 59.3066 bits (142), Expect = 2.993e-9
Identity = 38/127 (29.92%), Postives = 65/127 (51.18%), Query Frame = 1
Query: 1147 PFNIVIDPVMGR-LFWIDLGNENNGPKIKMANMDG-SFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGK 1521
            P  + + P  GR L+W D GN    P I    MDG + +  ++  +++ P  L ID    R++W+D   + I+Y +++   +      + LA    H F++ +F + I+W+D     I SAHK TG+
Sbjct: 3285 PRGVTLHPRFGRVLYWTDWGNT---PYIARVGMDGKNNKSVVISTKLEWPNGLTIDYTTDRIFWSDAHLNYIEYANLDGSHR-----HTTLAGSLPHVFALTVFEDTIFWTDWNTRSIESAHKYTGE 3403          

HSP 14 Score: 59.3066 bits (142), Expect = 3.044e-9
Identity = 53/214 (24.77%), Postives = 85/214 (39.72%), Query Frame = 1
Query:   97 CHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICD-KNQFKCPDSDLCIPREKLCDGVNDCIEN--EDEWNC--------------TNI---------------------------NSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHICINKYSSFTCD---CPPDMELSEDNRNC 597
            C F   +   +  +N   +C+   + CD+  DC D+SDE  C    CD   +F C +   CI R ++C+GVN+C +N   DE  C              TNI                           ++C     + CGN    +CI +  +C++  +C+ N D   +C +D  +T   T           FTCD   C P   + + + +C
Sbjct: 2697 CAFHTCEPTDFTCRNG--RCVRYGYRCDHTNDCGDSSDEEGCAFRTCDPAAEFACTNGR-CIARSQVCNGVNNCRDNATSDEQRCPERTCQPGLLKCLTTNICVLRHYLSGGAAEWRRNDLRRPPPLPLHTCFIANEFRCGNG---QCIPLSWVCDSEQDCTDNADEPSSC-SDPGRTCPGT----------QFTCDSGRCIPGSWICDGDNDC 2893          

HSP 15 Score: 57.7658 bits (138), Expect = 1.032e-8
Identity = 44/153 (28.76%), Postives = 65/153 (42.48%), Query Frame = 1
Query:  109 CLQDD-HYCGKNSFF----QCISKLWVCDYNQDCDDNSDEVN--CPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLEN-CKADFCKTSENTC--SHICINKY 537
            C+ D    CG + F     +CI     CD   +C D SDE+   C    C+   F C +   C+     CD  NDC ++ DE  C    +C+    + C N +   CI    +CN   NC  N  S E  C    C+     C  ++IC+ ++
Sbjct: 2653 CINDSGQQCGTSQFTCLNGRCIPFRNKCDNRDNCRDGSDELERVCAFHTCEPTDFTCRNGR-CVRYGYRCDHTNDCGDSSDEEGCA-FRTCDPAAEFACTNGR---CIARSQVCNGVNNCRDNATSDEQRCPERTCQPGLLKCLTTNICVLRH 2800          

HSP 16 Score: 51.9878 bits (123), Expect = 6.297e-7
Identity = 55/236 (23.31%), Postives = 100/236 (42.37%), Query Frame = 1
Query: 1030 ALDPARNLLFFTDY--NDSSIYVMNL-TSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKI----------------TGKDVKVIDKRVKPINLRIISKESNRQLIKKINEHKIGKYCSGVINTCRGSCLPNH 1680
            A+D     L+FT+   +++ + V  L TSF ++ +       P ++ +DP    LFW+D G     PKI+ A +DG+ +  +L+  +  P+ L ID     +YW D     I  +  +  +   ++        Y  P+ + I+G+ + W D    K+  A K                 T +DV + D RV+P    +I+    R     +N     ++C  + +    +C   H
Sbjct: 2112 AVDWVAGNLYFTNVFSSETHLEVQRLDTSFRRV-LFKTSVDRPRHLAVDPRARFLFWVDAGQR---PKIERAFLDGTNRSVVLDVGLLSPRSLTIDRATDWVYWADDGLDRIGRLAPDGSTWQVVRE----GRGYPAPYGLAIYGSNLIWVDRNLRKVLQASKEPQASPPPPEVIRDNLGTLRDVTIFDPRVQPTAPELINFNPCR-----LNNGGCQQFCFALPSVTTATCACAH 2334          

HSP 17 Score: 51.2174 bits (121), Expect = 9.700e-7
Identity = 50/197 (25.38%), Postives = 69/197 (35.03%), Query Frame = 1
Query:  193 CDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCS--HICINKYSSFTCDCPPDMELSEDNRNCKHI------------NKCFKNPEVCH------QGCQDNGKSYNCFCYDGYTEHDQKCVPT 723
            C DN  E   P   C   +F    +  C+PR  LCDG +DC +  DE  C   N       + C N +   CI I              D      A  C+  + TC+  + CI +Y  + CD   D     D R C               ++C  N  VC        G  + G  +NC  Y        +C+ T
Sbjct:  990 CADNPLEPPTPQ--CSSTEFFACANGRCVPRLFLCDGYDDCHDGSDERGCGTGNVTCSPYAFTCTNRR---CIPI--------------DWRPTRLATTCRADQFTCASGNRCIPRY--WICDTDNDCGDGSDERGCDMSGTCHPMQFQCPDHRCIDNAYVCDGDSDCVDGADERGCVFNCTSYQFSCSSGDQCIAT 1165          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Sea Lamprey
Match: lrp1ab (low density lipoprotein receptor-related protein 1Ab [Source:ZFIN;Acc:ZDB-GENE-030131-7126])

HSP 1 Score: 159.073 bits (401), Expect = 2.434e-40
Identity = 134/499 (26.85%), Postives = 222/499 (44.49%), Query Frame = 1
Query:  148 FQCISKL-----WVCDYNQDCDDNSDEV-------NCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINS----CNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADF----CKTSENTCS--HICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTE----------HDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIF--SLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLS-AFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIE----YFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDV 1527
            FQC + L     W CD   DC DNSDE         CPP      QF+C ++ +C    + CDGV++C +  DE NC   +     CN  + + CG T++ +CI  + +CN   +C         C  D     C    N C    IC +    + C+C P  +       C+ +N+C +   VC Q C +   SY C C   Y +           +Q  +   + NEI  L  +            NP+   ++ ++G   +   ++D ++  N  +F+++     ++ ++S L+ +P     +    S    +++++  L      A+D   + L++TD     I V  L    +  +V      P  IV+DP+ G+++W D GN     KI+ A+MDG+ ++  +EK+++ P  LAID   QRLYW D   S I  I ++        T  V+A++      HPFSI IF + IY      ++++  HK     V
Sbjct: 3628 FQCNNTLCKPLSWKCDGEDDCGDNSDETPEMCLKFQCPP----GRQFRCRNNRVCFWAGRQCDGVDNCGDGSDEENCEKPSPKPRICN-SSEFKCGGTER-KCISTQLVCNRFDDCGDGGSDEVACGGDQFVNECHRPLNPCGDDAICHDTLRGYYCECKPGFQRKATTSICEDVNECAQF-GVCTQLCNNTKGSYKCNCSKNYIKGLHHSCKAEGSEQMVLYIADNNEIRSLAPN------------NPNMAYEQAYQGDATVRIDAMDAHVKSNR-IFWTNW----HMGRISMLELYPAGEHRHRRQTSGTV-VDLDISGLKMPRGVAVDWVADNLYWTDSGRDVIEVAQLRGHYRKTLVSGMIDEPHAIVLDPIRGQMYWSDWGNN---AKIEQASMDGTRRHNFVEKDLQWPTGLAIDFMNQRLYWADAKLSVIGSIRLDG-------TDRVVAVDSKQGLLHPFSIEIFEDYIYGVTYVNNRVFRIHKFGSGTV 4091          

HSP 2 Score: 151.754 bits (382), Expect = 6.223e-38
Identity = 129/502 (25.70%), Postives = 225/502 (44.82%), Query Frame = 1
Query:  109 CLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMI--CDKN-QFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHIC-INKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEE-NEIXXXXXXXXXXXXXXXXXLNPHYKAKEIF-RGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAF--STALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKK---PKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYF--HPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKR-VKPINLRII 1572
            C  D+  C  +   QCI   W CD + DC D SDE  C  ++  CD   QF C D+  CI +   CDG NDC +N DE  C  +  C   +H +C N   + C+  + +C+ + +C    D  E    D C+ +   C+H C +       C CP  M+L +D ++C  ++ C ++   C Q C+       C CYDG+       +P  E    ++             I  ++ H     +   G  +  ++D +LN++ +  Y + V +D +                LS      ++E+ +++  A     A+D     +++ + N   I V  L    +  +V      P  I +DP  G LFW D   +++ P+I+  +M G+ ++ ++  E+     P  L +D  E R+ W D    +I Y  +   ++L      VL    F  HPF++ +FG  +YW+D + + +  A+K TG++V V+ +   +P +L + 
Sbjct: 1035 CHGDEFQCKADG--QCIPLRWRCDGDTDCIDTSDEKECDGVVRTCDPTLQFSCRDTGRCISKTWFCDGDNDCEDNSDEEGCETM-LCKPPSH-SCANDSSI-CLSPKKLCDGHSDCPDGSD--EGMLCDQCQVNNGGCTHNCTVAPGEGVVCSCPSGMQLGKDKKSCDFMDYCARHLR-CSQRCEQEKSIVKCGCYDGWM-----LMPDGENCQSLDPFVPFIIFSNRHEIRRIDLHKGDYSVLVPGLRNTIAIDFHLNQSSL--YWTDVVEDKIYHGK------------LSETGGLTSVEVVVQHGLATPEGLAVDWIAGNIYWVESNLDQIEVARLNGTMRSTLVAGGIEHPRAIALDPRYGILFWTDW--DSSFPRIEAISMSGTGRH-VIHHEMGAGGWPNGLTVDYLENRIMWIDARSDSI-YSALYDGTEL----IEVLRGHEFLSHPFAVTLFGGEVYWTDWRTNTLVRANKWTGQNVTVVQRTNTQPFDLHVF 1501          

HSP 3 Score: 129.413 bits (324), Expect = 7.746e-31
Identity = 103/454 (22.69%), Postives = 200/454 (44.05%), Query Frame = 1
Query:  232 ICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEW----NCTNINS-CNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSE-NTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFR-GQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKD-VKVIDKRVKPINLRI 1569
            +C  NQF+C +    +     CDG  DC +  DE     +C+  NS CN+ + + C N +   C+    +CN   +C    D   NC  + C     + C+  C +    + C C    +L +D + C   ++C +    C Q C ++  S+ C C DGY    Q+   +T    I+   +         +  +N       + + G ++  +LD   +  + V+++ +  + ++++   +      V L+ +S+SN   +            A+D     L++ D    +I V  L    +  +++     P  + +D   G L+W D G     P I    MDGS +  +++ +I  P  L++D    R+YW D     I++ D++  ++      +V++ +  H F++ +F + +YW+D +   +  AHK TG D   +I    +P++L +
Sbjct: 2826 MCGPNQFRCANGRCLLKSSWECDGDFDCHDRSDEAPINPHCSANNSKCNDSSSFPCANGR---CVNESMLCNNQDDCEDGSDE-RNCNINECADRRISGCTQECTDLKIGYKCKCRAGFQLKDDGKTCVDRDEC-RTTYPCSQTCLNSHGSFKCLCTDGYR---QRVNDSTSCKAISDEEAILIFANRYYLRKVNLDGSNYTLLKQGLNNAVALDFEWSE-QWVYWTDVTTQGSMIRRMHMNGSDTQV-LHRTSLSNPDGL------------AVDWIGGNLYWCDKGRDTIEVSKLNGLYRTVLLNNGLKEPRALAVDVRGGYLYWSDWGEH---PHIGRMGMDGSNRSVVIDTKITWPNGLSLDYVNNRIYWADAREDYIQFADMDGANR-----HTVVSEDIPHIFALSLFEDHVYWTDWETKTVNRAHKSTGADRTTLISTLHRPMDLHV 3249          

HSP 4 Score: 118.627 bits (296), Expect = 1.514e-27
Identity = 117/495 (23.64%), Postives = 193/495 (38.99%), Query Frame = 1
Query:  148 FQCISKLWVCDYNQDCDDNSDEVNCPPMICDK--------NQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGY-TEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHK--DNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDL------KEHKIYSAHKITGKDVKVIDKRVKPINLRIISKE 1581
              CIS  W CD  +DC D SDE    P IC K        N + C  ++LCI   KLCDG NDC +  D           E TH                           ++  ENC    C+       H C        C C    E++ D + CK  ++C      C Q C +   SY+C C +GY  + D K      +          ++  +V    LN                ++D + +  EM  + ++     ++ L  ++L          L   S ++ I ++L        A+D      +F D  D  I+V N      + ++D + Y P  I +DP MG+LF+ D G     PK++  +MDG     L++ +I  P  +A+D+  + +YW D +   + YI++      N +T  +      H F + +F N +Y + +      +   +   ++    D +V+ + VK   L I  + 
Sbjct:   16 LTCISLGWRCDGEKDCPDGSDE---SPEICQKPNEMKCQVNHYHCLGTELCIHMSKLCDGNNDCPDGYD-----------EGTHC--------------------------REFAENCTVTLCR-------HKCAVTREGPACYCTVGHEVTPDEKGCKDFDECAVY-GTCSQNCLNTDGSYSCSCVEGYLLQPDSKSCKAKNDPVDRPAALLIANSQNVVATYLNGSIVPGLTPVATRQASAMDFSYSE-EMACWVNVGDSPTESRLHCARLAG--------LKGFSGERVINISLNVHHVEQMAIDWLTGNFYFMDDVDDRIFVCNKQGDTCVTLLDLELYNPKAIALDPTMGKLFFTDYGQI---PKVERCDMDGGNCSKLVDSKIVFPHGIALDLVSRLVYWADAY---LDYIEVVDYEGRNRRTI-IQGPSVEHLFGLSVFENYLYATSIDNSNSPQNTTVIRVNRFNSTDYQVLTRVVKGGALHIYHRR 446          

HSP 5 Score: 78.1814 bits (191), Expect = 5.333e-15
Identity = 68/289 (23.53%), Postives = 117/289 (40.48%), Query Frame = 1
Query:  952 VDLYLSSISNKQNIEMNLKNL------SAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKE--HKIYSAHKITGKDVKVIDKRVKPINLRIISKESNRQLIKKINEHKIGKYCSGVINTCRGSCLPNHDMPEMPKCFGIPRIEEKIRSKNQSLWLILIPVVILGFV 1794
            VD+ LSSI   +  +   +++           A+D     +++ D     I V  L    +  ++ +    P  I + P  G LFW + G     P+I+ + +DG+ +  L+   I  P  +++D EE +LYW D     I+ ID+ +     +    VL+      FS+ +FG+ IYWSD       I    K    DV  +   +  + L+ + K  N++  K  N       C+     C   CL       M  C      E+ +  ++   +L+     IL  V
Sbjct: 1909 VDMGLSSIHRAKRDQTWREDIITNGLGRVEGIAVDWIAGNIYWIDQGFDVIEVARLNGSFRYVVISQGLDKPRAIAVHPDKGYLFWTEWGQN---PRIERSRLDGTERTVLVNVSIAWPNGISVDYEEDKLYWCDARTDKIERIDLETGENREV----VLSTSNMDMFSVSVFGDYIYWSDRTHANGSIKRGSKENATDVVALRTGIG-VQLKDV-KVFNKERQKGTN------VCARQNGGCEQLCLYRGKARRMCACAHGLLAEDGVSCRDYDGYLLYSERTILKSV 2182          

HSP 6 Score: 72.0182 bits (175), Expect = 3.948e-13
Identity = 49/221 (22.17%), Postives = 104/221 (47.06%), Query Frame = 1
Query:  949 NVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNL-----TSFDKIKIVDKDCY-FPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRV--KPINLRIISKESN 1587
            N+    +  + ++ I  N+ ++     A     + L++T Y  S+I    +      +FD+  +V       P   V+D  +  +FW +  NE + P I  + + G+    ++   I+ P  LAID   ++LY++D     I+  + +   +  +    +L  E  H F + ++G+ ++W+D     +  A+K TG DVKV+   +  +P+ +  ++ ++N
Sbjct: 2240 NIQQLFNDGTGRRVIVENVGSVEGL--AYHRGWDSLYWTSYTTSTITRHTVDQARPGAFDRETVVTMSADDHPRAFVMDECLNLMFWTNW-NELS-PSIMRSFLSGANVQVIVGSNIRTPNGLAIDHRAEKLYFSDATLDKIERCEYDGSHRYVV----ILRSEPVHSFGLAVYGDFVFWTDWVRRAVLRANKFTGTDVKVLRGEIPQQPMGMIALANDTN 2452          

HSP 7 Score: 71.633 bits (174), Expect = 5.361e-13
Identity = 48/206 (23.30%), Postives = 94/206 (45.63%), Query Frame = 1
Query:  991 IEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIK--IVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPK---IKMANMDGSFQYTLLE-KEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVKPINLRIISKESNR 1590
            ++ N+ N+     A+D     L++TD    +I V  L    + +  +++ +   P  I +DPV G ++W D   +  G K   I+ A MDG+ +   +  K +  P  L++DI    LYW D +   I+ I ++   +  +     L+    HPF +   G+ I+W++ +   +Y    I+     + ++R     +R   +E  +
Sbjct:  575 LKTNINNVEGI--AVDWMGYNLYWTDDGLKTINVARLEKASQARRTLIEGNMTHPRAIAVDPVHGFMYWTDWEEDPKGTKRGKIEHAWMDGTHRSIFVSSKTVLWPNGLSLDIPNGILYWCDAYFDQIERIKLDGTERKVVYDGQELS----HPFGLTHHGHNIFWTEYRLGTVYRYDTISRNTTVLRNERPPIFEIRTYDREQQK 774          

HSP 8 Score: 68.9366 bits (167), Expect = 3.916e-12
Identity = 45/137 (32.85%), Postives = 65/137 (47.45%), Query Frame = 1
Query:  103 FKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTC 513
            FKC      C KN    C +  ++CD + DC D SDE NC   +C  +QFKC  +  CIP    C+G ++C + EDE +C  +        + C +TK+  CI    +C+ + +C    D   NC    C   E  C
Sbjct: 3341 FKCRPGQFQC-KNGI--CTNPAFICDGDNDCGDGSDEANCDVHVCLPSQFKCRTTHRCIPGIFRCNGQDNCGDGEDEKDCPEVTC--APNQFQCSSTKR--CIPRVWVCDRDNDCGDGSDEPANCTQMTCGQEEFRC 3470          

HSP 9 Score: 62.003 bits (149), Expect = 4.547e-10
Identity = 50/155 (32.26%), Postives = 73/155 (47.10%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVN--CPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFC-KTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNCKH 603
            +CI + W CD + DC DNSDE    C    C  ++FKC  ++ CIP   LCDG NDC  +EDE N T          ++C +     CI +   C+ + +C    D   +C    C   ++  C++  CIN   ++ CD   D   + D   C H
Sbjct:  838 RCIQERWRCDGDNDCLDNSDEAPEICHQHTCPSDRFKC-QNNRCIPLRWLCDGDNDCGNSEDESNTTCAARTCPPNQFSCASG---HCIPMSWKCDLDDDCGDRSDEPPSCAYPTCFPLTQFACNNGRCINM--NWRCDADNDCADASDEIGCNH 986          

HSP 10 Score: 62.003 bits (149), Expect = 4.785e-10
Identity = 39/111 (35.14%), Postives = 56/111 (50.45%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKA 483
            +C+   W CDY+ DC DNSDE  C P  C +++F C +   CI     CDG +DC +  DE +C+    C+    + C N     CI     C+ +I+C    D  +NC A
Sbjct: 3516 RCVPGRWQCDYDNDCGDNSDEEGCTPRPCSESEFSCANG-RCIAGRWRCDGDHDCSDGSDEKDCS--PRCDHD-QFQCRNG---HCIPQRWRCDADIDCIDGSDE-DNCAA 3618          

HSP 11 Score: 58.9214 bits (141), Expect = 4.306e-9
Identity = 56/173 (32.37%), Postives = 76/173 (43.93%), Query Frame = 1
Query:  130 CGKNSF----FQCISKL-WVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDS-------DLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHICINKYSSFTCDCPPD-MELSEDNRNCKHIN 609
            CG N F     +C+ K  W CD + DC D SDE    P  C  N  KC DS         C+    LC+  +DC +  DE NC NIN C ++    C  T++   +KI   C          D       D C+T+   CS  C+N + SF C C     +   D+ +CK I+
Sbjct: 2827 CGPNQFRCANGRCLLKSSWECDGDFDCHDRSDEAPINPH-CSANNSKCNDSSSFPCANGRCVNESMLCNNQDDCEDGSDERNC-NINECADRRISGC--TQECTDLKIGYKCKCRAGFQLKDDGKTCVDRDECRTTY-PCSQTCLNSHGSFKCLCTDGYRQRVNDSTSCKAIS 2994          

HSP 12 Score: 56.9954 bits (136), Expect = 1.716e-8
Identity = 42/123 (34.15%), Postives = 60/123 (48.78%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDE-VNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCS 516
            +CI   W CD   DC D SDE  +CP   C   QF+C +  +C     +CDG NDC +  DE NC +++ C   + + C  T +  CI     CN   NC   +D  ++C    C  ++  CS
Sbjct: 3314 KCIPFWWKCDTEDDCGDRSDEPADCPDFKCRPGQFQCKNG-ICTNPAFICDGDNDCGDGSDEANC-DVHVC-LPSQFKCRTTHR--CIPGIFRCNGQDNCGDGEDE-KDCPEVTCAPNQFQCS 3430          

HSP 13 Score: 49.6766 bits (117), Expect = 3.147e-6
Identity = 48/161 (29.81%), Postives = 71/161 (44.10%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCN------EKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHICINKYS------SFTCDCPPDMELSEDNRNC 597
            +C+  L +C+   DC DNSDE+ C    C  ++F+C D   CI     C+ V DC +  DE  C  +N  +      + + Y   N+  L C+    IC+   +C    D  +NCK    K+    CS    N  S      ++ CD  PD +   D  NC
Sbjct: 2554 RCMETLKLCNGVNDCGDNSDEIACNNSTCGADEFRCGDGS-CIANVTRCNQVVDCDDISDEIGCGPMNCTHYHRLGVQASGYVSCNSTSL-CVLPAWICDGANDCGDYADE-KNCKK---KSGSPGCSPDYFNCPSGPCIPTAWKCDREPDCDDGADELNC 2708          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Sea Lamprey
Match: LRP8 (LDL receptor related protein 8 [Source:HGNC Symbol;Acc:HGNC:6700])

HSP 1 Score: 152.91 bits (385), Expect = 1.187e-39
Identity = 120/470 (25.53%), Postives = 195/470 (41.49%), Query Frame = 1
Query:  235 CDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNIN-SCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYT--EHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQ--NIEMNLKNLSAFST-------------ALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEY-----FHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDV-KVIDKRVKPINLRI 1569
            C  ++ +C D   C+P    CDG  DC +  DE +C N    C     + C   +  EC++   +C+   +C    D  L  C  + C T+   CSH C ++   + C CP   EL  D   C   ++C K P VC Q C +    Y C CY+GYT     Q C  T                          H K   IF  Q D+  +D++    + +   S       + V    N      +Y S +  KQ  +  M+  + S   T             A+D     L++TD    ++ V       +  +  +    P  I +DP+ G ++W D G      KI+ A M+G  +  ++ K+I+ P  + +D+  +RLYW D          + +LS +N+       + +      HPF+I IF +++YW+D ++  IYSA K TG  +  V++    P +L +
Sbjct:    4 CGASELRCTDGS-CVPGSSQCDGFRDCHDGSDEHDCNNTAVDCTGPGWFRC---RSGECLQDRQVCDGKRDCHDWSDEPLSLCNVNECATTNGGCSHTCWDRPLGYECGCPAGYELL-DEYTCGDTDEC-KQPGVCSQLCINYKGGYKCDCYEGYTMDPATQACKATE-------------------------HQKTYLIFANQRDVRRVDLHTRSYKQLI--SRTRNTVAVAVEITAN-----RIYWSDLGQKQVYSAHMDEAHDSTRHTSVLGEAPVFVEGIAIDWVHGNLYWTDSKAKTVAVAKPDGSRRRTLFGQGLSEPRAIAVDPLSGFVYWSDWGQP---AKIEKAGMNGVSRQVIVSKDIEWPNGITLDLVNKRLYWVDS--------KLRTLSSVNLAGGERHEVMHQTDALHHPFAIAIFEDKVYWADGEKEAIYSADKHTGSGISSVVEDLHSPQDLLV 424          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001137.1 (pep scaffold:Pmarinus_7.0:GL476464:95621:179961:-1 gene:ENSPMAG00000001008.1 transcript:ENSPMAT00000001137.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 154.066 bits (388), Expect = 8.434e-39
Identity = 122/461 (26.46%), Postives = 198/461 (42.95%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNC------PPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNC-TNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHIC-INKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGY--TEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSL---VHKDNVLQVSKLQNWPLNVDLYLSSIS----NKQNIEMNLKN--LSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSD 1476
             CI   WVCD + DC D SDE +       P   C +++F+C  +  CIP    CDG  DC++  DE  C     +CN  TH+ C       CI+   +C+ + +C  N D    C    C++ +  CSH C +       C CP  M+L ED + C   + C ++   C Q C+    +  C CYDG+      + C  T + +                            IF  + +I  +D++ +R+  V   SL   +  D     S L  W   VD+    I     N   +E  +    ++    A+D     +++ D+    I V  L    +  +V ++   P  I + P  G LFW + G+    P+I+   +DG+ +  L+   I  P  ++ID +E +LYW D     I+ +D+ + +  ++    VL       FS+ +FG+ IYWSD
Sbjct:  161 HCIPSQWVCDGDNDCGDVSDETHTCEFPARPLRQCREDEFRCAINGNCIPLRWRCDGDADCMDISDEKECDGQRRTCNPGTHFTC--VSNGICIRKAWVCDGDNDCEDNSDEA-GCHVYLCQSDKGGCSHNCTVTPVDGLVCSCPKGMQLGEDRKTCNFTDYCARHLR-CSQRCEQEKGAVKCGCYDGWRLMLDGKSCRSTADADPFVPFI----------------------IFSTRHEIRRIDLH-SRDYSVLVPSLRNAIAIDFHFGQSTLY-WTDVVDVRSRVIRRAFINGTGVETIVTTDVMNTHGLAVDWISGNIYWIDHAFDVIEVARLNGSYRYVVVSEELDKPLAIAVHPQKGYLFWSEWGHS---PRIERTLLDGTERMALVNSSIASPNGISIDYDEGKLYWCDGQTDRIERVDLETGANRHV----VLVATTSDMFSVSVFGSHIYWSD 586          

HSP 2 Score: 131.339 bits (329), Expect = 1.341e-31
Identity = 133/537 (24.77%), Postives = 215/537 (40.04%), Query Frame = 1
Query:   97 CHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMI--CDKNQFKCPDSDLCIPREKLCDGVNDCIENEDE-WNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCK-----ADFCKTSENTCSHI---CI------NKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYT--------EHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRN-----EMVFYSSLVHKDNVLQVSKLQNWPLNVDLY-----LSSISNKQ-----------------NIEMNLKNLSAFS-TALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIE----YFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            C  +C QD   C       CI + W CD + DC D SDE NC   +  C K++F+C +S LC P    CDG +DC +N DE  +      C  +  + C N +   C+ ++ +C+   NC  + D  E+C      A  C   E  C  +   CI      N +         +M    D R    +N+C  N       C D  + Y C C  G+         E   +C+     +++               F    H+  K     +  I+  D N  R          Y+ ++  D+ ++V  +        L+     L SIS+ +                  + + +  L   S  A+D     L++TD     + V  L+  ++  +V      P  I +DPV G+++W D GN     KI+ A+MDG+ +   +E+ ++ P  LA+D   QRLYW D   S I  I ++        T  V+A+       HPF+I +F + IY       +++  HK     V+ +
Sbjct:  949 CSLRCEQDQFQCQNG---HCIPQRWRCDNDADCLDGSDEENCGSAVRLCPKDEFQC-NSTLCKPFSWRCDGEDDCGDNSDEDADHCRAFQCPPRRQFRCRNDRV--CVSLDRVCDGINNCGDHSDE-EHCGEPARGARACTAEEFKCDSLERKCIDVRLLCNHHDDCGDGGSDEMACGGDPR----VNECLSNACGFEASCHDTLQGYYCSCRPGFQWNASISSCEDVDECLHFGTCSQVCNNTKGSHVCSCAENFVKVHHHSCKANDSERTMIYVADNNQVRGLSPQRANARYTQVLLGDDSVRVHSMGVHVRTARLFWTNWHLGSISSMELRPGAGRPRSVRDDTAAVVRLEIPGLRTPSGVAVDWVAGNLYWTDSGRDVVEVAQLSGQNRKTLVSGMIDDPHAIALDPVRGKMYWSDWGNN---AKIEQASMDGTRRRNFVEERVQWPTGLAVDYMNQRLYWADTKLSVISSIRLDG-------TDRVVAVSIKQGLLHPFAIDVFEDHIYGVTYTNSRVFRVHKFGNGTVEFL 1464          

HSP 3 Score: 69.707 bits (169), Expect = 1.958e-12
Identity = 62/169 (36.69%), Postives = 83/169 (49.11%), Query Frame = 1
Query:  154 CISKLWVCDYNQDCDDNSDEVN--CPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCT-NINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFC-KTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQG 645
            CI   W CD + DC D SDE+   C    C  ++FKC + + CIP   LCDG NDC ENEDE N T  + +C  +  + CGN K   CI I   C+ + +CS N D   +C    C   ++ +C++  CIN    + CD   D   S D   C   N C  +   C  G
Sbjct:    1 CIQDQWRCDGDNDCQDGSDELPEICQQHTCISDRFKCKN-NRCIPMRWLCDGDNDCGENEDESNTTCTVRTCPAE-QFTCGNGK---CIPIAWKCDLDNDCSDNSDEPPSCAYPTCLPLTQFSCNNGRCINIR--WRCDSDNDCADSSDEAGCN--NTCADSQFSCKNG 160          

HSP 4 Score: 61.2326 bits (147), Expect = 8.108e-10
Identity = 39/111 (35.14%), Postives = 56/111 (50.45%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKA 483
            +CI   W CDY+ DC DNSDE  C P  C +++F C +   CI     CDG +DC++  DE +C+      E+  + C N     CI     C+ + +C    D  ENC +
Sbjct:  887 RCIPGRWHCDYDNDCGDNSDEEGCTPRPCSESEFSCANG-RCIAGRWRCDGDHDCMDGSDEKDCSLR---CEQDQFQCQNG---HCIPQRWRCDNDADCLDGSDE-ENCGS 989          

HSP 5 Score: 55.8398 bits (133), Expect = 3.474e-8
Identity = 50/172 (29.07%), Postives = 77/172 (44.77%), Query Frame = 1
Query:  109 CLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVN--CPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHICINKYSSFTCD---CPPDMELSEDNRNCKHIN 609
            C+ D   C  N   +CI   W+CD + DC +N DE N  C    C   QF C +   CIP    CD  NDC +N DE       +C   T ++C N +   CI I   C+++ +C+ + D             E  C++ C +  S F+C    C P   + + + +C  ++
Sbjct:   30 CISDRFKCKNN---RCIPMRWLCDGDNDCGENEDESNTTCTVRTCPAEQFTCGNGK-CIPIAWKCDLDNDCSDNSDEPPSCAYPTCLPLTQFSCNNGR---CINIRWRCDSDNDCADSSD-------------EAGCNNTCAD--SQFSCKNGHCIPSQWVCDGDNDCGDVS 179          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005343.1 (pep scaffold:Pmarinus_7.0:GL479201:37125:45319:-1 gene:ENSPMAG00000004851.1 transcript:ENSPMAT00000005343.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.9821 bits (245), Expect = 2.337e-22
Identity = 55/185 (29.73%), Postives = 101/185 (54.59%), Query Frame = 1
Query:  991 IEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFD--KIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNI-KTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            IE  L  +     A+D   N L+   ++DS    +++ + D  + K+ D     P  IV+DP+ G L+W D G      KI+ A M+G+ ++ ++  +I+ P  +A+D+  +RLYW D     +  +D++   ++ +  ++S L     HPFSI +F +++YW+D +E  I+S +K TG   +V+
Sbjct:   17 IEQGLSFVEGL--AVDWIHNTLY---WSDSGFKTLSVATMDGRRRKLFDSGLQEPRAIVVDPIAGWLYWSDWGEP---AKIEKAGMNGANRHAIVTHDIQWPNGIALDLANRRLYWVDSKLHTLSSVDMSGQDRVTVLASYSDL----LHPFSIAVFEDKVYWTDGEEEAIFSMNKFTGSGRRVL 189          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Nematostella
Match: EDO48069 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJZ9])

HSP 1 Score: 181.8 bits (460), Expect = 6.040e-49
Identity = 139/535 (25.98%), Postives = 245/535 (45.79%), Query Frame = 1
Query:  109 CLQDDHYCGKNSF----FQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNC-------TNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELS-EDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYT-EHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMV-------------FYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTL--LEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRV-KPINLRIISKESNRQLIKKINEHKIG 1626
            C     YC  + +     +CI K WVCD   DC + SDE NC    C  +QF C +   CIP    C+G NDC++N DE +C       T   S  +   + CG++K  +CI    +C+ +++C+ + D  +NC  + CK +   C H C +  + + C C P  +++ +D ++C+ +++C   P  C Q C ++  SY C C +GY  E D+K      +                         K   +F  + DI  L ++ +    V             F + +++  +V++ S +++ PLN    + +I       +N+  L+    A+D     L++TD     I V NL   ++++++      P  IV+ P +G +FW D G E   PKI+   M+G  +  L  +   I  P  L ID    +++W D     I+  +++  ++  I + SV      HPF+I +F + IYW+D  +  IY A+K  GKD  ++   +  P+++ +  ++   +      E+  G
Sbjct:  115 CPNSSQYCKSSEYQCSTGECIHKSWVCDGEFDCLNKSDENNCHSSACHISQFTCANK-RCIPMRDRCNGNNDCLDNSDEADCRMFSLLATKPPSICKDGEFQCGSSK--QCIPESKVCDGSVDCTNSADEPDNCFINECKDNNGPCQHYCNDTKTGYFCSCRPGYKVALDDPKSCRDVDECAI-PGSCSQMCFNSKGSYKCTCMEGYRLEPDKKTCKALGD-------------------------KPFLLFTNRQDIRRLVMDSSDFTQVVPKLRAAIALDYDFATGVIYWSDVIEAS-IKSAPLNNGSAVETI-------VNMSLLTPDGIAVDWVNRKLYWTDTGTDVIEVANLDGRERMRLITTGLQEPRAIVVYPAIGYMFWTDWGEE---PKIERCGMNGDPKTRLQIVNTNILWPNALTIDYTIDKIWWADAKEHTIECANLDGTARRVITSDSV-----HHPFAITVFQDYIYWTDWVKESIYKANKFNGKDRSLVCSGLYSPMDIHVYQQQKQPKFSNPCGENNGG 604          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Nematostella
Match: EDO43938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXB8])

HSP 1 Score: 178.333 bits (451), Expect = 1.902e-47
Identity = 131/495 (26.46%), Postives = 229/495 (46.26%), Query Frame = 1
Query:  103 FKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNC------TNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYT-EHD-QKC--------VPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKE-IKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
             KC +++  C   +   C+ + W+CD  +DC D SDE  C  + C  ++F C +   CIP  + CDG ++C +  DE  C      T       + H+ CG++    CI    +C+   +C   +D   NC  D CK+    C  +C N  +SF C C    EL +D ++C+ IN+C + P +C Q C +   S+ C C +GY  E D ++C        V  T+ N I                 +    + K+  +G  D  +L  ++ +  M++++           + +Q   +  D  + ++     +E           A+D     +++ D   ++I V  L   + + ++      P  +V+DP  G ++W D G+     KI+ A+MDG+ +  L+  E +++P  LAID   +RLYW D     IK+ ++N       +   V+     +P +I +F + IYW+D +  KIY A+K TGK++ V+
Sbjct:  164 VKCRKNERMCADGN--GCVHRRWICDGERDCLDGSDEAGCGTIGCSSDEFTCTNQK-CIPLPQKCDGTDNCGDGSDEKMCRKYLFSTQPGQVCPRDHFRCGSSTI--CIANSKVCDATPHCPHGEDE-RNCDIDECKSFNGHCLQLCTNTKTSFYCSCFSGYELMDDRKSCRDINEC-EIPGMCSQKCYNTKGSFKCSCMEGYVLEPDGRRCKALGPRPYVLFTDRNSI--------------RLIMTDGKEYKQAVQGLKDARTLGFDV-KESMLYWTDKA-------ATAIQKAKMVPDTTIETVHETGLVE-------PAGLAIDWVGRKMYWADPGANTIEVSELDGSNTMTLISSGLDKPSAVVLDPTEGFIYWTDWGDP---AKIERASMDGTARKVLISGEHLERPAGLAIDYSTRRLYWIDSKLDVIKHCNLN-----GTEVRVVINTGIDNPTAITVFEDHIYWTDSR--KIYKANKFTGKNMTVL 612          

HSP 2 Score: 64.3142 bits (155), Expect = 1.069e-10
Identity = 59/208 (28.37%), Postives = 84/208 (40.38%), Query Frame = 1
Query:  130 CGKNSF----FQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTN-INSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVC--HQGCQDNGKSYNCFC----YDGYTEHDQKCVP 720
            C  N F     +CI+  + CD   DC D SDE  C    C   +F C  S  CIP    CD  +DC++  DE NC N   +CN  T + C N +   C+  E +C+   +C  + D  +NC                       T   PP ++  ++ R C   N C     +C   + C D      C       D +T  +QKC+P
Sbjct:   39 CSANEFRCDDGRCITSTFRCDREFDCTDRSDERGCVNKTCAPYEFTCAFSGRCIPGRFRCDHRSDCLDGSDEQNCQNAAKTCNPVTDHTCRNGR---CVLKEWLCDGMDDCGDSSDE-DNC----------------------LTRPTPPPVKCRKNERMCADGNGCVHRRWICDGERDCLDGSDEAGCGTIGCSSDEFTCTNQKCIP 220          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Nematostella
Match: EDO49498 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGB0])

HSP 1 Score: 172.94 bits (437), Expect = 6.788e-46
Identity = 126/477 (26.42%), Postives = 219/477 (45.91%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYT-EHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTL-LEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRV-KPINLRII 1572
            QCIS  W CD + DC D SDE NC    C   +F C +   CI R+ +CDG NDC +  DE +C  + SC     + C NT +  CI    +C+  ++C    D    C  D C ++   C+ +C++      C C P   L+ DN+ C+ IN+C  N   C Q C +   S++C C  GY  E D++     +  +    +  FS+   +    L P        R   +   +D +  R + +++S +  K  V+  S           Y +    +  I   L  ++A   A+D     L+++D     I V  L    +  ++ +D   P  +V+D   G LFW D G     P+++ + +DGS ++ +    +I  P  L +D+  +R+YW D     I   + +  S+  + + S    +  HPF++ +F + +YW+D +   +    K+ G++V ++   V KP+++  +
Sbjct:  175 QCISLAWRCDGDHDCADKSDERNCTGKTCKPFEFACANGRHCIQRKWICDGENDCGDRSDEVDC-GLESCGND-RWRCSNTSR--CIAKSQVCDGRVDCPDASDEGPGCGLDQCHSNNGGCAQLCMDVPEGVQCSCRPGFTLASDNKTCEDINECL-NSSSCSQRCFNTRGSFSCKCVQGYRLEPDKR---RCKAADSIRPFLYFSTRREIRKLGLPPSQSYTFAVRRLRNTIGIDFDW-REKRLYWSDVYKK--VISRS-----------YFNGTGREDLITDAL--ITAEGVAVDWIGRNLYWSDMRSDRIEVSTLEGKWRRVLLSEDVESPRGLVLDSNAGYLFWTDWGTS---PRVERSWLDGSNRFVISFGIKIVWPNGLTLDLATKRVYWIDAKLDHIVSCEYDGSSKRIVLSGSR---QINHPFAMTLFEDYLYWTDWQNKHVLRVSKLHGENVTLLSAGVSKPMDIHAV 621          

HSP 2 Score: 60.077 bits (144), Expect = 1.992e-9
Identity = 51/153 (33.33%), Postives = 75/153 (49.02%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDC--DDNSDEVNCPPMI-CDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNC 597
            +CI   W CD + DC   D SDE NC     C  + F+C +   C PR+ +CDG +DC +  DE  C N +SC     ++C + +   CI +   C+ + +CS   D    C    C  S+ +CS+  CI+   ++ CD   D     D RNC
Sbjct:   55 KCIPLSWRCDGDYDCLAPDLSDEANCSVATNCSASMFRCANGQ-CKPRDWVCDGFDDCGDGSDEKGCAN-HSCT-PAQFSCPSGR---CIPLRWRCDGDGDCSDGADE-RGCPPKNCTDSQFSCSNGQCISL--AWRCDGDHDCADKSDERNC 198          

HSP 3 Score: 58.5362 bits (140), Expect = 7.182e-9
Identity = 50/159 (31.45%), Postives = 70/159 (44.03%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDE---VNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENE--DEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTC-SHICINKYSSFTCDCPPDMELSEDNRNCKHIN 609
             CIS  W CD   DC DNSDE     C    C  ++F+C  S  CIP    CDG  DC+  +  DE NC+   +C+  + + C N    +C   + +C+   +C    D  + C    C  ++ +C S  CI     + CD   D     D R C   N
Sbjct:   12 HCISLRWKCDGENDCVDNSDEDEYAGCAEWSCRASEFRCQASRKCIPLSWRCDGDYDCLAPDLSDEANCSVATNCS-ASMFRCANG---QCKPRDWVCDGFDDCGDGSDE-KGCANHSCTPAQFSCPSGRCIPL--RWRCDGDGDCSDGADERGCPPKN 163          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Nematostella
Match: EDO49499 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGB1])

HSP 1 Score: 160.229 bits (404), Expect = 5.151e-41
Identity = 143/539 (26.53%), Postives = 211/539 (39.15%), Query Frame = 1
Query:  103 FKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKL-------------------------------------ECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYT-EHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDI--FSLDV--------NLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKD-VKVIDKRVKPINLRII 1572
            F C  D   C       CI+  WVCD + DC DNSDE+NC  + C   +F C +  +CIP+  +CDG NDC +  DE +  + + C+ K  + C N + +                                      CI +  +C+   +C  N D   +C    CK  +  CS  C+       C C P   +S+D   CK IN+C  +   C   C +   SY C C +GY  E    C P                        + P YK   IF    DI   SLD         NL R   V +  L  K     V +   +  N     SS +    I   L        A+D     L+F + +   IYV  L    +  ++  D   P  I +DP +G LFW D        +I+ ANMDGS +  L +  +     L +D   Q +YW +     I  +  + L +  ++       +  HPF I I+ N +++SD   H I S +K TG    K++     P+ L+I+
Sbjct:  160 FTCAPDKFACASGG---CIASRWVCDGDNDCGDNSDELNCTRLTCPPTKFLCANG-MCIPKSAVCDGENDCGDMSDEPSNCSAHICDPKLEFQCANGRCINKKWRCDGMKDCADGSDESTCGEGTCRPDEWHCIGTSRCIPLSRVCDGTNDCGDNYDEGSHCLDLDCK--KKNCSQRCVQTPRGGECRCFPGYTISKDLITCKDINEC-SSIGRCDHFCYNTPGSYKCACDEGYVLERPHTCKP------------------------VGP-YKPWLIFSNCKDIRQVSLDGTQYDLLIRNLTRAISVDFDWLEKKVYWTDVRENAIYRQNYTWASSSFATTV-IRTGLA--MPVGLAVDWVGRNLYFVESSVRRIYVSKLDGSMRTSLITTDLSKPRGIAVDPRVGYLFWTDW----EAHRIERANMDGSSRVILAKTNVYWANTLTLDYTLQTVYWVEAHLDYIGAMSYDGLKRREVRHNG----DIIHPFGIAIYRNELFFSDWVRHAIISINKFTGNGTTKLVSNLEVPMGLQIL 655          

HSP 2 Score: 74.7146 bits (182), Expect = 6.489e-14
Identity = 68/229 (29.69%), Postives = 92/229 (40.17%), Query Frame = 1
Query:   61 LFIFIICLNFYACHFKCLQDDHYCGKNSF-----FQCISKLWVCDYNQDCDDNSDEVNC---------------------------------------PPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSH-ICINKYSSFTCDCPPD-MELSEDNRNC-KHI 606
            L   I+  N Y  H K LQ    CG   F      +CI K W CD   DC D+SDE  C                                        P+ C    F CP+S  CIPR  LCDG+ +C +  DE NC       +K  + C +     CI    +C+ + +C  N D L NC    C  ++  C++ +CI K  S  CD   D  ++S++  NC  HI
Sbjct:   20 LVFLIVAWNHYHVHAKILQQAKNCGSRHFKCVSDGKCIPKSWRCDGEMDCPDSSDEEGCVNRTCSSKEFNCNNQCVPLSWKCDGEKDCRPGGFDEEGCEPVTCASTYFLCPNSSHCIPRRWLCDGLAECEDGSDEKNCQKFTCAPDK--FACASGG---CIASRWVCDGDNDCGDNSDEL-NCTRLTCPPTKFLCANGMCIPK--SAVCDGENDCGDMSDEPSNCSAHI 240          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Nematostella
Match: EDO43726 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXU8])

HSP 1 Score: 139.428 bits (350), Expect = 2.131e-34
Identity = 118/473 (24.95%), Postives = 204/473 (43.13%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYT-EHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDG--SFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLK--EHKIYSAHKITGKDVKVIDKRVKP 1554
            +C+   W CD  +DC D SDE  C    C  ++F C +   CIP  + CDG ++C ++ DE  C     C     + C +T +  CI    +C+   +C   +D    C  D CK     CS  C +    + C C    +L +  R C  I++C +    C Q C++   S+ C C  GY  + D +   T   N         S     ++       +A  I  G+  +  LD +   N ++F++         +  K+    L+    +  I     +  ++         +D +   +++TD   + I V  LT   ++ +       P  IV+DP  G L+W D G      +I+ A MDG  S +  ++  E+  P  L ID   +RLYW D   + +K I+ + L   + +  + +A +  HPF+I +F N +Y++D    E  +   +K TG +  ++ + + P
Sbjct:  218 ECVLGHWRCDGEKDCSDGSDEKGCRKSNCASSEFTCANGQ-CIPSSQRCDGTSNCRDSSDEKACVTPPPC-MPGEFKCQSTGR--CIPESKVCDGTRDCQDGEDEPLRCNIDECKDHNGHCSQKCNDLTLGYNCSCFSGYKL-QGARLCVDIDECAEYG-TCSQVCENRKGSFKCSCLPGYRIDGDGR---TCRANGTLPSLVYSSQFSIRNVTVSGAISQA--IVSGRKGVVGLDYDYKSN-LIFWTD-------AKAEKINRARLDGSGSVEEIVGDVKVPDDV--------TVDWSGRKIYWTDGEQNMIEVAELTGAHRMTLFSSGLDEPRAIVVDPSAGYLYWTDWGYN---ARIERAGMDGDASTRTIIISGELGWPNGLTIDYTIKRLYWAD---ARLKRIESSRLDGSDRRLIADIAPQ--HPFAITVFENYLYYTDWNRDERALRRVNKFTGGERTIVKRVLWP 655          

HSP 2 Score: 52.7582 bits (125), Expect = 4.615e-7
Identity = 52/155 (33.55%), Postives = 73/155 (47.10%), Query Frame = 1
Query:  100 HFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIEN--EDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHI-CINKYSSFTCD 555
             F+C+ D          +CI   W CD   DC D SDE    P  C ++QF C +   CI     CDG +DC +    DE NC N+ +C     + C N K   CI     C+   +C  N D   N +   C +++ TCS+  CI+  +S+TCD
Sbjct:    5 QFECVSDQ---------KCIVLRWRCDGEDDCSDGSDEQG-SPKTCLQDQFTCRNGK-CIQATWKCDGEDDCRDGYRSDESNCGNV-TCGAD-EFMCSNRK---CISRSWTCDNQDDCGDNSDEDRNVQR-TCASNQFTCSNGDCIS--NSWTCD 140          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Medaka
Match: vldlr (very low density lipoprotein receptor [Source:NCBI gene;Acc:100125475])

HSP 1 Score: 206.838 bits (525), Expect = 3.537e-56
Identity = 135/465 (29.03%), Postives = 224/465 (48.17%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDS-LENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKA-KEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYF-HPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            +CI K W CD + DC D SDE NCP   C  +QFKC D   CIP  + C+G+ DC +  DE +C N++ C+    + C   +  ECI +  +CN   +C    D  ++ C  + C  +   CSHIC +    F CDC P ++L  D++ C  IN+C  NP +C Q C +    Y C C++GY        PTT   +               +  L    K   +I + Q +  +LD + N+ + +F++ L  K     V   +    +V  + + I N Q         +    A+D      ++TD    +I V N     +  + ++    P +I +DP+ G L+W D G      KI+ + M+G  +  L+E +I+ P  + +D+ + RLYW D     +  +D+N  ++  +    + + EY  HPF++ +F +R++W+D +   IY A+K +G DV  +
Sbjct:  250 ECIHKKWRCDGDPDCKDGSDEANCPVRTCGPDQFKCEDGS-CIPGSRQCNGIRDCTDGSDEVDCKNLSQCSGPEKFKC---RSGECIDMSKVCNKVRDCPDWSDEPIKECNVNECLLNNGGCSHICKDMVIGFECDCTPGLQLI-DHKTCGDINECM-NPGICSQICINLKGGYKCECHNGYQMD-----PTTGVCKAVGKEPCLIFTNRRDVRRLGLERKEYTQIVKQQRNAVALDADFNQ-QTIFWADLGQKAIFSTVLDKRG---DVGTHKTVIENVQ---------TPVGIAVDWIYRNFYWTDLGTKTISVSNFNGTIQKVLFNQGLKEPASIAVDPLSGFLYWSDWGEP---AKIEKSGMNGVDRQVLVETDIQWPNGITLDLIKGRLYWVDSKLHMLCSVDLNGDNRKKV----LQSPEYLAHPFALTVFEDRVFWTDGENQAIYGANKFSGSDVVTL 683          

HSP 2 Score: 63.929 bits (154), Expect = 4.254e-10
Identity = 70/216 (32.41%), Postives = 101/216 (46.76%), Query Frame = 1
Query:   97 CHFK-CLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKD-SLENCK-----ADFCKTSENTC-SHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQG-CQDNGKSYNCF--CYDGYTEHDQK 711
            CH + C  ++  CG  +  QCI   W CD  +DCD+  DEVNC  + C  ++F C  S  CI +  +C+  +DC +  DE +C   +SC   + + CGN+    CI    +C+ +++C    D SL  C         C +SE  C S  CI+K   + CD  PD +   D  NC  +  C  +   C  G C    +  N    C DG  E D K
Sbjct:  108 CHMRTCRVNEFSCGAGTT-QCIPVSWKCDGEKDCDNGDDEVNCGNITCSPSEFTCT-SGRCISQNFVCNSEDDCGDGSDEVDCA-PSSCG-PSEFQCGNSS---CIPASWVCDDDVDCQDQSDESLSRCGRHPTPPAKCSSSEMQCLSGECIHK--KWRCDGDPDCKDGSDEANCP-VRTCGPDQFKCEDGSCIPGSRQCNGIRDCTDGSDEVDCK 313          

HSP 3 Score: 61.6178 bits (148), Expect = 2.075e-9
Identity = 52/176 (29.55%), Postives = 80/176 (45.45%), Query Frame = 1
Query:   85 NFYACHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKT----HYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTC-SHICINKYSSFTCDCPPDMELSEDNRNC 597
            + +A   +C  +   CG     +CI  +W CD   DC D SDE +C    C +  F C +   C+P+   CDG  DC +  DE    ++  C+ +T     ++CG     +CI +   C+   +C    D + NC    C  SE TC S  CI++  +F C+   D     D  +C
Sbjct:   25 HVHATKTECETNQFQCGNG---RCIPSIWQCDGEDDCTDGSDEKSCVQKTCAEVDFVCRNGQ-CVPKRWHCDGEPDCEDGSDE----SLEICHMRTCRVNEFSCG-AGTTQCIPVSWKCDGEKDCDNGDDEV-NCGNITCSPSEFTCTSGRCISQ--NFVCNSEDDCGDGSDEVDC 188          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Medaka
Match: ENSORLT00000013030.2 (low-density lipoprotein receptor-related protein 8 [Source:NCBI gene;Acc:101174135])

HSP 1 Score: 192.586 bits (488), Expect = 5.386e-51
Identity = 133/472 (28.18%), Postives = 223/472 (47.25%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSL-ENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKA-KEIFRGQDDIFSLDVNLNRNEMVF--------YSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            +CI   W CD + DC D SDE +CP + C  ++F+C D   CI   K C+ V+DC ++ DE  C N   C     + C N    ECI+   +C++  +C    D   + C  + C  +   CSHIC++    F C CP    L  D + C  I++C +NP+ C Q C +    + C CY+GY E D    P T+  +               I  ++   +   ++   Q +  +LD+++  N + +        YS+ +H+ N       Q  PL VD  L                +    ALD  ++ L++TD  D SI V+++    +  +++ D   P  I +DP  G ++W D G      KI+ A M+G  +  L+ + I+ P  + +D+  +RLYW D     I  +D+N   +   +T    A    HP+S+ +F +RIYW+D     ++ A+++TG+D++ +
Sbjct:  251 ECIRLTWKCDGDPDCKDKSDESDCPLLTCRPDEFQCGDGS-CIHGTKQCNKVHDCPDHSDESGCVNATKCEGPLKFQCKNG---ECIESSRVCDSVKDCKDRSDEPKKECGLNECMINNGGCSHICMDLPIGFECQCPTGYHLL-DKKTCGDIDEC-ENPDACSQICINYKGDFKCECYEGY-EMD----PVTKTCKAEGKSPYLLFTNRHEIRRIDLVKRDYSQVVSAQRNAVALDLDVANNRVFWCDRFHRKIYSAFIHEAN----DPSQQVPL-VDSSLQ---------------TPVGLALDWLQHNLYWTDSGDKSISVVSVDGTKRRVLINSDLSEPRAIAVDPHHGFMYWSDWGTRA---KIEKAGMNGVDRQVLVSENIEWPNGITLDLANRRLYWVDSKLHLIASVDLNGAHR---RTHLSSADTLGHPYSLAVFEDRIYWTDRDRAAVFMANRLTGQDIQAL 685          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Medaka
Match: ENSORLT00000036597.1 (low-density lipoprotein receptor-related protein 1B [Source:NCBI gene;Acc:100049327])

HSP 1 Score: 192.971 bits (489), Expect = 8.227e-51
Identity = 140/494 (28.34%), Postives = 230/494 (46.56%), Query Frame = 1
Query:  124 HYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCP--PMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKC-FKNPEVCHQGCQDNGKSYNCFCYDGY--TEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLT-----SFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKR-VKPINLRII 1572
            H C ++   +C+ + W+CD +QDC D SDE +CP  P  C+  Q++C     CIP    CDG  DC +N DE  C  +        + C +    EC+    +CN   NC+   D   +C+    +  +  CS  C +      C C    +L ED   C  +N+C  + P VC   C +   SY C C+ G+       +C  T E   +  + +        S         AK+       I +LD +  R++  F+        V   SK   W         S  ++++  + +K + A S A+D     L++ D   S I+ + L      S DK  I+D+D   P  + + P  G +FW ++GN     KI+ A MDGS +  ++   +K P  +A+DI  +R+YWT+     +K I   +L   +I+   +  I Y  PFS+ +F + +YWSD K+  + +A K++GK+ +++ KR  +P+ L+II
Sbjct:  348 HRCTQSK--ECLLQEWMCDGDQDCKDGSDEKDCPVAPADCEDFQWQCRSGSACIPTAWRCDGTKDCDDNSDEHECGKLTC--RPHEFQCVSK---ECLDPALVCNGITNCADGSDEGGSCQTKCPEAEQTRCSQGCYSTPEGSRCRCDAGYKLLEDGLTCVDVNECEGRTPAVCSHLCLNTPGSYQCDCHPGFIMEAGGHQCKITGEPFLLVSVQTELYLFGLRSGSLDVLKSPAKQ------GILALDYDW-RDQKAFW--------VSGDSKAIRW---------SSLDQKSTGVLVKGVQANSVAVDWLGRNLYWIDSGKSKIFAIKLAKITMKSMDKTTILDEDLDVPRCLTLLPQKGLMFWTEVGNS---AKIERAGMDGSQRKVVVNSSLKWPGDIAVDIISERIYWTEE---TLKAIGSATLDGDDIRILQMKKITY--PFSVAVFNDMLYWSDAKQRIVQAATKLSGKNRQIVLKRPGQPVALKII 802          

HSP 2 Score: 64.3142 bits (155), Expect = 3.604e-10
Identity = 56/190 (29.47%), Postives = 81/190 (42.63%), Query Frame = 1
Query:  172 VCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTC-SHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENE 738
            VCD   DC D SDE +C    CD +QF+C     CI + ++CDGV  C +  DE  C       E   + C  ++   CI    +C+   +C+   D   +C    C +SE  C S  C++  +S  CD  PD     D  +C     C  N   C Q       S  C   +   + DQ C   ++E +
Sbjct:  206 VCDGEPDCRDGSDEEDCLS-TCDSDQFQCAHGKKCIEKSQVCDGVPQCQDRSDELECAKY---MEGCAHQCDKSR---CIPSSFLCDGEQDCADGSDEA-SCAEKECSSSEFKCTSGQCVS--ASMHCDGHPDCWDGSDEESCVKAPVCTTN-HRCTQ-------SKECLLQEWMCDGDQDCKDGSDEKD 377          

HSP 3 Score: 56.225 bits (134), Expect = 1.182e-7
Identity = 64/263 (24.33%), Postives = 100/263 (38.02%), Query Frame = 1
Query:   64 FIFII---CLNFYACHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNT--KKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTC-----------------SHICINK----YSSFTCDCPPDMELSEDNRN-----------CKHINKCFKNPEVCHQ--GCQDNGKSYNCFCYDGYTEHD---QKCVPTT 726
            F+F+    C++  +   +C      C   S  +CI    +CD  QDC D SDE +C    C ++QF+C     CI ++ +CDG   C ++ DE  C        K   NC +    K  C+    +C+   +C    D   +C  D  +  E+                   S +C +K    + +  CD  PD     D  +           C H  KC +  +VC     CQD      C  Y     H     +C+P++
Sbjct:   30 FVFLTVKSCVSAGSSTKRCKVGTVLCKDGS--ECIQYSLLCDGEQDCADGSDEEDCESG-CREDQFQCAHGKKCIDKQHVCDGTAHCQDHSDEQQCM-------KRTDNCAHQCDDKNRCLPATFVCDGERDCLDGTDEA-SCDGDKQEEEEDITVPTAVPSEPLPIRCPLGSKLCRDKSDCVHYNHVCDGEPDCRDGSDEEDCLSTCDSDQFQCAHGKKCIEKSQVCDGVPQCQDRSDELECAKYMEGCAHQCDKSRCIPSS 281          

HSP 4 Score: 50.447 bits (119), Expect = 7.651e-6
Identity = 48/168 (28.57%), Postives = 70/168 (41.67%), Query Frame = 1
Query:   97 CHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSEN-TCSHICINKYSSFTCDCPPDMELSEDNRNC 597
            C   C  D   C      +CI K  VCD    C D SDE+ C   + +    +C D   CIP   LCDG  DC +  DE +C     C+  + + C +    +C+     C+ + +C    D     KA  C T+   T S  C+     + CD   D +   D ++C
Sbjct:  222 CLSTCDSDQFQCAHGK--KCIEKSQVCDGVPQCQDRSDELECAKYM-EGCAHQC-DKSRCIPSSFLCDGEQDCADGSDEASCAE-KECS-SSEFKCTSG---QCVSASMHCDGHPDCWDGSDEESCVKAPVCTTNHRCTQSKECL--LQEWMCDGDQDCKDGSDEKDC 378          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Medaka
Match: ENSORLT00000019609.2 (low-density lipoprotein receptor-related protein 1B [Source:NCBI gene;Acc:100049327])

HSP 1 Score: 192.586 bits (488), Expect = 9.566e-51
Identity = 142/494 (28.74%), Postives = 229/494 (46.36%), Query Frame = 1
Query:  124 HYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCP--PMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKC-FKNPEVCHQGCQDNGKSYNCFCYDGY--TEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLT-----SFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKR-VKPINLRII 1572
            H C ++   +C+ + W+CD +QDC D SDE +CP  P  C+  Q++C     CIP    CDG  DC +N DE  C  +        + C +    EC+    +CN   NC+   D   +C+    +  +  CS  C +      C C    +L ED   C  +N+C  + P VC   C +   SY C C+ G+       +C  T E   +  + +        S         AK+       I +LD +  R++  F+        V   SK   W        SS+  K    + +K + A S A+D     L++ D   S I+ + L      S DK  I+D+D   P  + + P  G +FW ++GN     KI+ A MDGS +  ++   +K P  +A+DI  +R+YWT+     +K I   +L   +I+   +  I Y  PFS+ +F + +YWSD K+  + +A K++GK+ +++ KR  +P+ L+II
Sbjct:  325 HRCTQSK--ECLLQEWMCDGDQDCKDGSDEKDCPVAPADCEDFQWQCRSGSACIPTAWRCDGTKDCDDNSDEHECGKLTC--RPHEFQCVSK---ECLDPALVCNGITNCADGSDEGGSCQTKCPEAEQTRCSQGCYSTPEGSRCRCDAGYKLLEDGLTCVDVNECEGRTPAVCSHLCLNTPGSYQCDCHPGFIMEAGGHQCKITGEPFLLVSVQTELYLFGLRSGSLDVLKSPAKQ------GILALDYDW-RDQKAFW--------VSGDSKAIRW--------SSLDQKSTGVL-VKGVQANSVAVDWLGRNLYWIDSGKSKIFAIKLAKITMKSMDKTTILDEDLDVPRCLTLLPQKGLMFWTEVGNS---AKIERAGMDGSQRKVVVNSSLKWPGDIAVDIISERIYWTEE---TLKAIGSATLDGDDIRILQMKKITY--PFSVAVFNDMLYWSDAKQRIVQAATKLSGKNRQIVLKRPGQPVALKII 779          

HSP 2 Score: 64.3142 bits (155), Expect = 4.558e-10
Identity = 56/190 (29.47%), Postives = 81/190 (42.63%), Query Frame = 1
Query:  172 VCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTC-SHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENE 738
            VCD   DC D SDE +C    CD +QF+C     CI + ++CDGV  C +  DE  C       E   + C  ++   CI    +C+   +C+   D   +C    C +SE  C S  C++  +S  CD  PD     D  +C     C  N   C Q       S  C   +   + DQ C   ++E +
Sbjct:  183 VCDGEPDCRDGSDEEDCLS-TCDSDQFQCAHGKKCIEKSQVCDGVPQCQDRSDELECAKY---MEGCAHQCDKSR---CIPSSFLCDGEQDCADGSDEA-SCAEKECSSSEFKCTSGQCVS--ASMHCDGHPDCWDGSDEESCVKAPVCTTN-HRCTQ-------SKECLLQEWMCDGDQDCKDGSDEKD 354          

HSP 3 Score: 55.0694 bits (131), Expect = 2.580e-7
Identity = 58/231 (25.11%), Postives = 88/231 (38.10%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNT--KKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTC-----------------SHICINK----YSSFTCDCPPDMELSEDNRN-----------CKHINKCFKNPEVCHQ--GCQDNGKSYNCFCYDGYTEHD---QKCVPTT 726
            +CI    +CD  QDC D SDE +C    C ++QF+C     CI ++ +CDG   C ++ DE  C        K   NC +    K  C+    +C+   +C    D   +C  D  +  E+                   S +C +K    + +  CD  PD     D  +           C H  KC +  +VC     CQD      C  Y     H     +C+P++
Sbjct:   37 ECIQYSLLCDGEQDCADGSDEEDCESG-CREDQFQCAHGKKCIDKQHVCDGTAHCQDHSDEQQCM-------KRTDNCAHQCDDKNRCLPATFVCDGERDCLDGTDEA-SCDGDKQEEEEDITVPTAVPSEPLPIRCPLGSKLCRDKSDCVHYNHVCDGEPDCRDGSDEEDCLSTCDSDQFQCAHGKKCIEKSQVCDGVPQCQDRSDELECAKYMEGCAHQCDKSRCIPSS 258          

HSP 4 Score: 50.0618 bits (118), Expect = 9.681e-6
Identity = 48/168 (28.57%), Postives = 70/168 (41.67%), Query Frame = 1
Query:   97 CHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSEN-TCSHICINKYSSFTCDCPPDMELSEDNRNC 597
            C   C  D   C      +CI K  VCD    C D SDE+ C   + +    +C D   CIP   LCDG  DC +  DE +C     C+  + + C +    +C+     C+ + +C    D     KA  C T+   T S  C+     + CD   D +   D ++C
Sbjct:  199 CLSTCDSDQFQCAHGK--KCIEKSQVCDGVPQCQDRSDELECAKYM-EGCAHQC-DKSRCIPSSFLCDGEQDCADGSDEASCAE-KECS-SSEFKCTSG---QCVSASMHCDGHPDCWDGSDEESCVKAPVCTTNHRCTQSKECL--LQEWMCDGDQDCKDGSDEKDC 355          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Medaka
Match: ldlrb (low-density lipoprotein receptor [Source:NCBI gene;Acc:101161779])

HSP 1 Score: 189.119 bits (479), Expect = 3.997e-50
Identity = 128/463 (27.65%), Postives = 221/463 (47.73%), Query Frame = 1
Query:  151 QCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLE-NCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVI 1536
            QCI   W CD   DCDD SDE+NC   +C + QF+C D   C+     C+ V DC +  DE +C+   +C+  + + C +    ECI +E++C+   +CS   D  E +C  + C T+   CSH C +    F C CP   +L  D RNC+ IN+C +  + C Q C +   SY C C  GY       V  T + E   + +   +        L  H +  ++  G  +  +LD+++ +  + +    + K   L ++   + P+ V    S I   + I            A+D     +++TD    +I V +     +  ++ ++   P  I IDPV   ++W D G+     KI+ + ++G+ +  L+ + I  P  + +D+  QRLYW D     +  ID+N  ++  +    V+     HPFS+ +F ++++W+D     IYSA ++TG+++  I
Sbjct:  207 QCIPGSWRCDGGIDCDDRSDELNCSRPVCLEGQFQCGDGS-CLQGNLKCNSVRDCSDGSDETDCS--TACDAPSEFKCSSG---ECISMENVCDKTKDCSDGSDEPESSCGINECSTANGGCSHHCNDLKIGFNCSCPAGYKLKADQRNCEDINECAE-ADTCSQICINLPGSYKCDCEWGYKIDP---VSNTCKAESGTVPALLFTTRHDVRKILVDHSEYVQVIPGLKNAAALDMDMAQKTLYWSDVSLKKIFRLNLADSSSKPVTV--IDSGIETPEGI------------AVDWVHGNIYWTDSTLKTISVASTDGTKRKTLIRENLDKPRAITIDPVNNFVYWTDWGHH---AKIEKSGLNGAGRVALVTENIVSPNGITLDMVNQRLYWVDSKLHTVFSIDVNGGTRHRV---VVINQRPSHPFSLTVFEDKVFWTDTGLRGIYSASRLTGRNLTQI 639          

HSP 2 Score: 75.8702 bits (185), Expect = 8.533e-14
Identity = 52/196 (26.53%), Postives = 100/196 (51.02%), Query Frame = 1
Query: 1000 NLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNL--TSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSA-IKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYS--AHKITGKDVKVIDKRVK-PINLRI 1569
             LKN +A    +D A+  L+++D +   I+ +NL  +S   + ++D     P  I +D V G ++W D    +    I +A+ DG+ + TL+ + + KP+ + ID     +YWTD    A I+   +N   ++ + T ++++    +  ++ +   R+YW D K H ++S   +  T   V VI++R   P +L +
Sbjct:  424 GLKNAAALD--MDMAQKTLYWSDVSLKKIFRLNLADSSSKPVTVIDSGIETPEGIAVDWVHGNIYWTD----STLKTISVASTDGTKRKTLIRENLDKPRAITIDPVNNFVYWTDWGHHAKIEKSGLNGAGRVALVTENIVSP---NGITLDMVNQRLYWVDSKLHTVFSIDVNGGTRHRVVVINQRPSHPFSLTV 610          

HSP 3 Score: 65.855 bits (159), Expect = 1.204e-10
Identity = 57/204 (27.94%), Postives = 86/204 (42.16%), Query Frame = 1
Query:   43 LQMRTILFIFIICLNFYACHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEV--NCPPMICDKNQFKCPDS-DLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHICINKYSSFTCD---CPPDMELSEDNRNCKHINKCFKNPEVC 636
            L   + L + I CL        C      CG     +C+++ W+CD   DC D +DE+   C    C  +QF C    + C+P+   CDG  DC    DE NCT +  C +   + C N    +CI +  +C+ + +CS   D             E TCS    N   SF C+   C P +   + + +C   +   + PE C
Sbjct:    8 LAELSCLLMLIHCLAKTDGALTCSSSQLKCGNG---RCVTRRWICDGTDDCGDGTDELLSTCASKTCLPSQFNCGAPINQCVPKSWHCDGKADCSNGADEKNCT-VKQC-KNDEFRCANG---QCISLSFVCDNDNDCSDGSD-------------ETTCSKPTCNPL-SFQCNNSVCVPSLWRCDGDEDCADGSD--EWPETC 187          

HSP 4 Score: 55.0694 bits (131), Expect = 2.273e-7
Identity = 53/171 (30.99%), Postives = 76/171 (44.44%), Query Frame = 1
Query:  109 CLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSL-ENCK----ADFCKTSENTCSHI-CINKYSSFTCDCPPDMELSEDNRNCKH 603
            CL     CG     QC+ K W CD   DC + +DE NC    C  ++F+C +   CI    +CD  NDC +  DE  C+   +CN  + + C N+    C+     C+ + +C+   D   E C     A  C  SE  C++  CI    S+ CD   D +   D  NC  
Sbjct:   71 CLPSQFNCGA-PINQCVPKSWHCDGKADCSNGADEKNCTVKQCKNDEFRCANGQ-CISLSFVCDNDNDCSDGSDETTCSK-PTCNPLS-FQCNNSV---CVPSLWRCDGDEDCADGSDEWPETCGGKKPAAKCSVSEFECANGQCI--PGSWRCDGGIDCDDRSDELNCSR 232          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Planmine SMEST
Match: SMESG000062507.1 (SMESG000062507.1)

HSP 1 Score: 1256.89 bits (3251), Expect = 0.000e+0
Identity = 635/638 (99.53%), Postives = 637/638 (99.84%), Query Frame = 1
Query:   49 MRTILFIFIICLNFYACHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVKPINLRIISKESNRQLIKKINEHKIGKYCSGVINTCRGSCLPNHDMPEMPKCFGIPRIEEKIRSKNQSLWLILIPVVILGFVCIVLFKYRFSRTRITKQPESNRVFVYDSVQFYEDQNSLHDDNTIISDTVPIINNSE 1962
            MRTILFIFIICLNFY CHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTE+DQKCVPTTEENEINLLYSSFSSIYSVSIFNLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVKPINLRIISKESNRQLIKKINEHKIGKYCSGVINTCRGSCLPNHDMPEMPKCFGIPRIEEKIRSKNQSLWLILIPVVILGFVCIVLFKYRFSRTRITKQPESNRVFVYDSVQFYEDQNSLH+DNTIISDTVPIINNSE
Sbjct:    1 MRTILFIFIICLNFYGCHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTENDQKCVPTTEENEINLLYSSFSSIYSVSIFNLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVKPINLRIISKESNRQLIKKINEHKIGKYCSGVINTCRGSCLPNHDMPEMPKCFGIPRIEEKIRSKNQSLWLILIPVVILGFVCIVLFKYRFSRTRITKQPESNRVFVYDSVQFYEDQNSLHNDNTIISDTVPIINNSE 638          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Planmine SMEST
Match: SMESG000034068.1 (SMESG000034068.1)

HSP 1 Score: 259.996 bits (663), Expect = 1.362e-76
Identity = 164/520 (31.54%), Postives = 282/520 (54.23%), Query Frame = 1
Query:  154 CISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCT--NINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKD-----SLENCKADFCKTSEN-TCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQK---CVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVKPINLRIISKESNRQLIKKINEHKIGKYC--SGVINTCRGSCLP 1674
            CISK W CD NQDC+   DE NCPP +C +N+F C     CIP+  LCDG   C++  DE NC    I SC+  + ++C    ++ CI I ++C+   NC  N+D     S++NC+ + CK   N  CSH C N ++   C CP   +L  DNR C  I++C  +P  C+Q C++   SY C CYDGY ++      C+  T+E + ++L +       +   N   H+  K ++   + + ++DV+L+++    +  +   +  L  SK+     N++ Y     N +N+  +         + D  R LLF+T   +  IYV N TS     ++++    P +I +DP+   ++WIDLG + + P+I+M  M+   +  L+ K +++P  L ID++E++LYW+D  P +I +I++++ +  N KT  +++ +  +PFSI +F N I+W+D ++++I S  KIT     V+ K VKP+ ++++    N+ +  KI+E  +  +      ++ C   CLP
Sbjct:   38 CISKDWWCDGNQDCESGKDESNCPPKVCLENEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCMKHEIKSCDSISQFDCNKDGEI-CIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCI--TKEGDRSILITLNGGRQLMIDLNTGSHF-YKPLYNSHESLVNIDVDLHQSPQTMF-WIQQSNGKLGQSKIDLKVNNIEKY--RFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYVTNTTSNVTSVLLNQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMVLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPN--NPKT--IISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVL----NKVIQPKIHESDVTSHACLKNRMHGCSHICLP 542          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Planmine SMEST
Match: SMESG000034068.1 (SMESG000034068.1)

HSP 1 Score: 259.996 bits (663), Expect = 1.814e-76
Identity = 164/520 (31.54%), Postives = 282/520 (54.23%), Query Frame = 1
Query:  154 CISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCT--NINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKD-----SLENCKADFCKTSEN-TCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQK---CVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVKPINLRIISKESNRQLIKKINEHKIGKYC--SGVINTCRGSCLP 1674
            CISK W CD NQDC+   DE NCPP +C +N+F C     CIP+  LCDG   C++  DE NC    I SC+  + ++C    ++ CI I ++C+   NC  N+D     S++NC+ + CK   N  CSH C N ++   C CP   +L  DNR C  I++C  +P  C+Q C++   SY C CYDGY ++      C+  T+E + ++L +       +   N   H+  K ++   + + ++DV+L+++    +  +   +  L  SK+     N++ Y     N +N+  +         + D  R LLF+T   +  IYV N TS     ++++    P +I +DP+   ++WIDLG + + P+I+M  M+   +  L+ K +++P  L ID++E++LYW+D  P +I +I++++ +  N KT  +++ +  +PFSI +F N I+W+D ++++I S  KIT     V+ K VKP+ ++++    N+ +  KI+E  +  +      ++ C   CLP
Sbjct:   38 CISKDWWCDGNQDCESGKDESNCPPKVCLENEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCMKHEIKSCDSISQFDCNKDGEI-CIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCI--TKEGDRSILITLNGGRQLMIDLNTGSHF-YKPLYNSHESLVNIDVDLHQSPQTMF-WIQQSNGKLGQSKIDLKVNNIEKY--RFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYVTNTTSNVTSVLLNQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMVLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPN--NPKT--IISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVL----NKVIQPKIHESDVTSHACLKNRMHGCSHICLP 542          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Planmine SMEST
Match: SMESG000034068.1 (SMESG000034068.1)

HSP 1 Score: 259.61 bits (662), Expect = 1.951e-76
Identity = 164/520 (31.54%), Postives = 282/520 (54.23%), Query Frame = 1
Query:  154 CISKLWVCDYNQDCDDNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCT--NINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKD-----SLENCKADFCKTSEN-TCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGYTEHDQK---CVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVKPINLRIISKESNRQLIKKINEHKIGKYC--SGVINTCRGSCLP 1674
            CISK W CD NQDC+   DE NCPP +C +N+F C     CIP+  LCDG   C++  DE NC    I SC+  + ++C    ++ CI I ++C+   NC  N+D     S++NC+ + CK   N  CSH C N ++   C CP   +L  DNR C  I++C  +P  C+Q C++   SY C CYDGY ++      C+  T+E + ++L +       +   N   H+  K ++   + + ++DV+L+++    +  +   +  L  SK+     N++ Y     N +N+  +         + D  R LLF+T   +  IYV N TS     ++++    P +I +DP+   ++WIDLG + + P+I+M  M+   +  L+ K +++P  L ID++E++LYW+D  P +I +I++++ +  N KT  +++ +  +PFSI +F N I+W+D ++++I S  KIT     V+ K VKP+ ++++    N+ +  KI+E  +  +      ++ C   CLP
Sbjct:   38 CISKDWWCDGNQDCESGKDESNCPPKVCLENEFLCHSGTQCIPKLLLCDGTFHCVDKSDERNCMKHEIKSCDSISQFDCNKDGEI-CIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRTCVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCI--TKEGDRSILITLNGGRQLMIDLNTGSHF-YKPLYNSHESLVNIDVDLHQSPQTMF-WIQQSNGKLGQSKIDLKVNNIEKY--RFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYVTNTTSNVTSVLLNQGLENPRSIAVDPINTGVYWIDLGTKKSSPRIEMVLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPN--NPKT--IISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVL----NKVIQPKIHESDVTSHACLKNRMHGCSHICLP 542          
BLAST of low-density lipoprotein receptor-related protein 2 vs. Planmine SMEST
Match: SMESG000013396.1 (SMESG000013396.1)

HSP 1 Score: 157.147 bits (396), Expect = 1.299e-39
Identity = 146/540 (27.04%), Postives = 236/540 (43.70%), Query Frame = 1
Query:  109 CLQDDHYCGKNSFFQCISKLWVCDYNQDCDDN-SDEVNCPPMICDKNQF-KCPDSDLCIPREKLCDGVNDCIENEDEWNCTNIN----SCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSL-----ENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRN-CKHINKCFKNPEVCHQGCQDNGKSYNCFCYDG-YTEHDQKCVPTTEENEIXXXXXXXXXXXXXXXXXLNPHYKAKEIFRGQDDIFSLDVNLN-RNEMVFYSSLVHKDNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPF-NIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFS---VLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVKPINLRIISKESNRQLIKKINEHKIGKYCSGVINTCRGSCLP 1674
            C  ++ YCG  S   CI+K W CD + DC +   DE+NC    C  ++  +C   D C   ++ CDG  DC +N DE  C+N +    SC+    + C   K   CI  + +C+   +C    D       ENC  + CK +   C   CIN YS   C C P   +   N   C  I++C  +  VC   C +   SY C C++G Y   D K      E  +     +      +    ++  Y  K       +   + ++ + +++ +F++       ++Q+  L +   N+         K    ++ +  S    A D    LLF++D + + I V+N+T+  +  +V    +    +IV+ P   R+FW D G E   PKI+   MDG  +  L++  +  P  LA+D     LYW D             +S  N+KTF    V++    H F I +F + +Y SD    KI   HK TGK  K++    KP+ +++       QL + +N   I   C  + +TC+  CLP
Sbjct:  206 CQNNEFYCGSGSTVPCIAKEWRCDGSYDCPETYRDELNCTNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEKFCSNPSQHDVSCDPFNEFKC--VKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDEC-ADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGEKFLLYSTKNSIRELRLLRHYMDMLYSPKN---PTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNM---------KPRTLVHSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKE---PKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVD--------AKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQ-KILVSSPKPMGVKLF-----HQLAQPVN---IENAC--INHTCQYLCLP 708          

HSP 2 Score: 60.077 bits (144), Expect = 5.068e-9
Identity = 69/236 (29.24%), Postives = 101/236 (42.80%), Query Frame = 1
Query:  106 KCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDE-------VNCPPMI-CDKN-QFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTH----------------YNCGNTKKLECIKIEDICNTNINC-STNKDSLENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVC--HQGCQDNGKSYNCFCYDGYTEHDQKCVPTTE 729
            KC  D   C +     CISK  +C++N DC D SDE       +N P ++ CD +  F+C +  LCI R   CDG +DC +  DE NC +  +   K+                 + CG+   + CI  E  C+ + +C  T +D L NC                    ++F  +C PD    + NR CK I+ C+ N + C  +  C DN     C      ++HD  C P  E
Sbjct:   97 KCSIDQFMC-RTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLTDLVKQSTICQNNEFYCGSGSTVPCIAKEWRCDGSYDCPETYRDEL-NC--------------------TNF--ECSPD----KPNR-CKTIDSCYDNDQRCDGYPDCTDNSDEKFC---SNPSQHDVSCDPFNE 300          

HSP 3 Score: 50.447 bits (119), Expect = 4.656e-6
Identity = 61/194 (31.44%), Postives = 84/194 (43.30%), Query Frame = 1
Query:   64 FIFIICLNFYACHFKCLQDDHYCGKNSFFQ-------CISKLWVCDYNQDCDDNSDEVNCPPMICD-KNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKD-SLENCK---ADFCKTSENTCSHICINKY----SSFTCDCPPDMELSEDNRNC 597
            ++ I CL F      C+    Y  +   FQ       CI +   CD + +C DNSDE      ICD +  F C DS++ I + +LCDG  DC  +ED   C   N C+    + C  TK + CI    +CN N +CS   D S E C+          +N+    C NK       + CD   D     D +NC
Sbjct:    3 YLLISCLVF---SIVCVVSSQYYKRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDE------ICDHRETFTCSDSNI-ILKTELCDGKADCDNDEDPKICVK-NKCS-IDQFMC-RTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNC 183          
The following BLAST results are available for this feature:
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VLDLR2.174e-5228.86very low density lipoprotein receptor [Source:HGNC... [more]
VLDLR3.026e-5228.86very low density lipoprotein receptor [Source:HGNC... [more]
LDLR1.233e-5024.96low density lipoprotein receptor [Source:HGNC Symb... [more]
LRP42.241e-4626.86LDL receptor related protein 4 [Source:HGNC Symbol... [more]
LDLR1.253e-4526.45low density lipoprotein receptor [Source:HGNC Symb... [more]
back to top
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrp-15.299e-3726.89Low-density lipoprotein receptor-related protein ... [more]
lrp-25.218e-3626.34Low-density lipoprotein RecePtor related [Source:... [more]
T13C2.66.129e-3425.14pep chromosome:WBcel235:II:6783427:6788255:1 gene:... [more]
T13C2.66.164e-3425.59pep chromosome:WBcel235:II:6783427:6788255:1 gene:... [more]
rme-21.108e-2424.75Receptor Mediated Endocytosis [Source:UniProtKB/T... [more]
back to top
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LpR15.317e-5123.40gene:FBgn0066101 transcript:FBtr0301466[more]
LpR16.166e-5123.40gene:FBgn0066101 transcript:FBtr0335238[more]
LpR19.069e-5123.69gene:FBgn0066101 transcript:FBtr0301469[more]
LpR19.510e-5123.69gene:FBgn0066101 transcript:FBtr0301467[more]
LpR11.253e-5023.69gene:FBgn0066101 transcript:FBtr0301470[more]
back to top
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vldlr7.846e-5328.31very low density lipoprotein receptor [Source:ZFIN... [more]
vldlr9.546e-5328.31very low density lipoprotein receptor [Source:ZFIN... [more]
vldlr1.018e-5228.31very low density lipoprotein receptor [Source:ZFIN... [more]
vldlr1.050e-5228.31very low density lipoprotein receptor [Source:ZFIN... [more]
vldlr1.055e-5228.31very low density lipoprotein receptor [Source:ZFIN... [more]
back to top
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VLDLR1.709e-5327.87very low density lipoprotein receptor [Source:NCBI... [more]
VLDLR2.303e-5327.66very low density lipoprotein receptor [Source:NCBI... [more]
VLDLR2.511e-5328.13very low density lipoprotein receptor [Source:NCBI... [more]
VLDLR2.592e-5327.87very low density lipoprotein receptor [Source:NCBI... [more]
VLDLR2.662e-5327.87very low density lipoprotein receptor [Source:NCBI... [more]
back to top
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vldlr1.492e-5128.46very low density lipoprotein receptor [Source:MGI ... [more]
Vldlr2.535e-5128.46very low density lipoprotein receptor [Source:MGI ... [more]
Vldlr2.757e-5128.46very low density lipoprotein receptor [Source:MGI ... [more]
Lrp41.005e-4626.86low density lipoprotein receptor-related protein 4... [more]
Ldlr5.411e-4626.57low density lipoprotein receptor [Source:MGI Symbo... [more]
back to top
BLAST of low-density lipoprotein receptor-related protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P98155|VLDLR_HUMAN1.044e-5128.86Very low-density lipoprotein receptor OS=Homo sapi... [more]
sp|P35953|VLDLR_RABIT2.332e-5128.66Very low-density lipoprotein receptor OS=Oryctolag... [more]
sp|P98166|VLDLR_RAT1.250e-5028.66Very low-density lipoprotein receptor OS=Rattus no... [more]
sp|P98156|VLDLR_MOUSE1.929e-5028.46Very low-density lipoprotein receptor OS=Mus muscu... [more]
sp|P98165|VLDLR_CHICK3.737e-5028.43Very low-density lipoprotein receptor OS=Gallus ga... [more]
back to top
BLAST of low-density lipoprotein receptor-related protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S6KMJ91.397e-7331.73Uncharacterized protein OS=Schmidtea mediterranea ... [more]
A0A3Q3FLF77.937e-5428.57Very low density lipoprotein receptor OS=Kryptoleb... [more]
A0A3Q3ABG38.157e-5428.57Very low density lipoprotein receptor OS=Kryptoleb... [more]
A0A4W6E9M02.407e-5329.42Very low density lipoprotein receptor OS=Lates cal... [more]
A0A556U2W02.930e-5328.22Very low-density lipoprotein receptor OS=Bagarius ... [more]
back to top
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vldlr2.304e-5327.77very low density lipoprotein receptor [Source:NCBI... [more]
vldlr8.762e-5327.77very low density lipoprotein receptor [Source:NCBI... [more]
vldlr9.727e-5327.77very low density lipoprotein receptor [Source:NCBI... [more]
vldlr1.053e-5227.77very low density lipoprotein receptor [Source:NCBI... [more]
ENSAMXT00000019438.24.030e-5127.60low-density lipoprotein receptor-related protein 8... [more]
back to top
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrp2a1.712e-4328.42low density lipoprotein receptor-related protein 2... [more]
lrp1ab2.434e-4026.85low density lipoprotein receptor-related protein 1... [more]
LRP81.187e-3925.53LDL receptor related protein 8 [Source:HGNC Symbol... [more]
ENSPMAT00000001137.18.434e-3926.46pep scaffold:Pmarinus_7.0:GL476464:95621:179961:-1... [more]
ENSPMAT00000005343.12.337e-2229.73pep scaffold:Pmarinus_7.0:GL479201:37125:45319:-1 ... [more]
back to top
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO480696.040e-4925.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439381.902e-4726.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494986.788e-4626.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494995.151e-4126.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437262.131e-3424.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of low-density lipoprotein receptor-related protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vldlr3.537e-5629.03very low density lipoprotein receptor [Source:NCBI... [more]
ENSORLT00000013030.25.386e-5128.18low-density lipoprotein receptor-related protein 8... [more]
ENSORLT00000036597.18.227e-5128.34low-density lipoprotein receptor-related protein 1... [more]
ENSORLT00000019609.29.566e-5128.74low-density lipoprotein receptor-related protein 1... [more]
ldlrb3.997e-5027.65low-density lipoprotein receptor [Source:NCBI gene... [more]
back to top
BLAST of low-density lipoprotein receptor-related protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062507.10.000e+099.53SMESG000062507.1[more]
SMESG000034068.11.362e-7631.54SMESG000034068.1[more]
SMESG000034068.11.814e-7631.54SMESG000034068.1[more]
SMESG000034068.11.951e-7631.54SMESG000034068.1[more]
SMESG000013396.11.299e-3927.04SMESG000013396.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020449 ID=SMED30020449|Name=low-density lipoprotein receptor-related protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2153bp
TCTGTCGTTACTATATATTCAGTATTAATATATTTATAGTAATTGCAAAT
GAGAACAATATTATTCATTTTTATTATATGTCTAAATTTTTACGCTTGTC
ATTTTAAGTGTTTACAAGATGATCATTATTGTGGAAAAAATAGTTTCTTC
CAATGTATTAGTAAATTATGGGTTTGTGATTACAATCAAGACTGCGATGA
CAATTCTGATGAAGTTAATTGCCCACCGATGATATGTGACAAAAATCAAT
TCAAGTGCCCTGATTCCGATCTCTGTATACCTCGCGAAAAACTATGTGAC
GGTGTAAATGATTGCATCGAGAACGAAGATGAATGGAATTGCACGAACAT
CAATAGTTGTAATGAAAAAACTCATTATAATTGCGGAAATACTAAGAAAT
TAGAATGTATCAAAATTGAAGATATTTGTAATACAAATATTAATTGTTCT
ACAAACAAAGATAGCTTAGAAAATTGCAAGGCTGATTTTTGTAAAACTTC
AGAAAATACTTGCAGTCATATATGTATTAACAAATATTCATCGTTCACAT
GTGACTGTCCTCCTGACATGGAATTGTCTGAAGATAATCGAAATTGTAAA
CATATAAATAAGTGTTTCAAAAATCCCGAGGTTTGCCATCAGGGTTGTCA
AGATAATGGAAAATCATATAATTGTTTTTGTTATGATGGATACACTGAAC
ATGATCAGAAATGTGTCCCAACTACTGAGGAAAATGAAATAAATTTATTG
TATTCTAGCTTCAGTAGTATTTACAGTGTATCTATCTTTAATTTAAATCC
TCATTACAAGGCCAAAGAAATTTTCAGAGGCCAGGATGATATTTTTTCAT
TAGATGTCAATTTAAATAGAAATGAAATGGTGTTTTATTCAAGTCTTGTT
CATAAAGACAATGTATTACAAGTTTCGAAATTACAGAATTGGCCATTAAA
CGTGGATTTATATTTATCGTCAATTTCTAATAAACAGAATATAGAAATGA
ATTTAAAAAATTTATCGGCTTTTAGCACTGCACTAGATCCAGCTAGAAAT
TTGCTCTTTTTTACCGATTATAACGATTCTTCTATTTATGTTATGAATCT
GACTAGTTTTGACAAAATAAAAATTGTCGATAAAGATTGCTATTTCCCAT
TTAATATTGTGATTGATCCTGTAATGGGAAGATTATTTTGGATTGATTTG
GGTAATGAAAACAATGGACCTAAAATTAAAATGGCTAATATGGATGGCAG
TTTTCAATATACACTATTAGAGAAGGAAATTAAAAAACCAAAATTTCTTG
CAATCGATATTGAGGAGCAACGACTTTATTGGACTGATCATTTTCCTTCT
GCAATTAAGTATATTGACATTAATTCCTTAAGCCAGCTCAACATTAAAAC
TTTTTCGGTTTTGGCTATAGAATATTTCCATCCTTTTTCCATATTCATAT
TTGGAAATAGAATATATTGGTCGGATCTTAAAGAACATAAAATCTATTCT
GCACATAAAATTACCGGTAAAGACGTTAAAGTTATAGACAAGAGAGTCAA
ACCAATAAATTTACGAATTATATCTAAAGAGTCAAATCGCCAACTTATTA
AAAAAATTAATGAACATAAAATTGGGAAATATTGTTCTGGTGTCATAAAT
ACTTGCCGCGGTAGTTGTTTACCAAATCATGATATGCCTGAAATGCCAAA
ATGCTTTGGAATTCCAAGAATTGAAGAAAAAATAAGAAGTAAAAATCAAT
CGCTTTGGTTGATTTTGATTCCAGTTGTTATATTGGGTTTCGTATGTATA
GTTTTATTTAAATATCGATTTTCAAGAACTCGAATCACAAAGCAACCTGA
AAGTAACAGAGTTTTTGTCTATGACTCTGTACAGTTCTATGAGGATCAAA
ACAGCCTTCATGATGATAATACAATAATATCAGATACTGTCCCTATAATT
AACAACAGCGAATAGGTTTTCCCAGTAACGGTTTTATTGCTACAAAGATT
TTCGACTTTGGTTAACTTTGTTAGCATGTTTCATTATTGGAAATTAGTGT
TTTTGAGTATACAATATAAATTTCATTTGACAATTTTCATGTATCATCTT
TTGTGTTATTTAATAATGTGTTTGAAATAAAAAATATGTATTTTAAAAAA
AAA
back to top

protein sequence of SMED30020449-orf-1

>SMED30020449-orf-1 ID=SMED30020449-orf-1|Name=SMED30020449-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=639bp
MRTILFIFIICLNFYACHFKCLQDDHYCGKNSFFQCISKLWVCDYNQDCD
DNSDEVNCPPMICDKNQFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTN
INSCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSLENCKADFCKT
SENTCSHICINKYSSFTCDCPPDMELSEDNRNCKHINKCFKNPEVCHQGC
QDNGKSYNCFCYDGYTEHDQKCVPTTEENEINLLYSSFSSIYSVSIFNLN
PHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWPL
NVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMN
LTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANMDG
SFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIK
TFSVLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRV
KPINLRIISKESNRQLIKKINEHKIGKYCSGVINTCRGSCLPNHDMPEMP
KCFGIPRIEEKIRSKNQSLWLILIPVVILGFVCIVLFKYRFSRTRITKQP
ESNRVFVYDSVQFYEDQNSLHDDNTIISDTVPIINNSE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036055LDL_receptor-like_sf
IPR040093LRAD1
IPR002172LDrepeatLR_classA_rpt
IPR001881EGF-like_Ca-bd_dom
IPR000033LDLR_classB_rpt
IPR000742EGF-like_dom
IPR0110426-blade_b-propeller_TolB-like
IPR023415LDLR_class-A_CS
IPR009030Growth_fac_rcpt_cys_sf
IPR013809ENTH
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPRINTSPR00261LDLRECEPTORcoord: 34..55
score: 48.34
coord: 118..139
score: 24.17
coord: 74..95
score: 44.79
IPR002172Low-density lipoprotein (LDL) receptor class A repeatSMARTSM00192LDLa_2coord: 103..145
e-value: 0.27
score: 9.2
coord: 20..60
e-value: 2.8E-7
score: 40.2
coord: 62..100
e-value: 3.1E-9
score: 46.7
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPFAMPF00057Ldl_recept_acoord: 63..98
e-value: 1.5E-7
score: 31.5
coord: 20..58
e-value: 1.9E-8
score: 34.4
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 20..59
score: 11.05
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 62..99
score: 12.55
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 63..98
e-value: 1.05336E-8
score: 49.1274
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 21..58
e-value: 2.32803E-7
score: 45.2754
IPR000033LDLR class B repeatSMARTSM00135LY_2coord: 404..446
e-value: 0.049
score: 22.8
coord: 316..356
e-value: 4.9
score: 12.6
coord: 357..403
e-value: 3.3E-4
score: 30.0
coord: 453..493
e-value: 16.0
score: 8.4
IPR000033LDLR class B repeatPFAMPF00058Ldl_recept_bcoord: 377..421
e-value: 1.2E-7
score: 32.1
IPR000033LDLR class B repeatPROSITEPS51120LDLRBcoord: 470..485
score: 6.884
IPR000033LDLR class B repeatPROSITEPS51120LDLRBcoord: 377..423
score: 12.43
IPR000033LDLR class B repeatPROSITEPS51120LDLRBcoord: 334..376
score: 8.276
IPR000033LDLR class B repeatPROSITEPS51120LDLRBcoord: 424..443
score: 6.42
IPR000742EGF-like domainSMARTSM00181egf_5coord: 147..184
e-value: 6.7E-4
score: 29.0
coord: 188..223
e-value: 14.0
score: 14.4
IPR001881EGF-like calcium-binding domainSMARTSM00179egfca_6coord: 144..184
e-value: 8.6E-4
score: 26.6
coord: 185..223
e-value: 0.0088
score: 18.4
IPR011042Six-bladed beta-propeller, TolB-likeGENE3DG3DSA:2.120.10.30coord: 230..559
e-value: 3.6E-44
score: 153.0
NoneNo IPR availablePFAMPF14670FXa_inhibitioncoord: 148..183
e-value: 9.7E-9
score: 35.4
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 146..221
e-value: 5.6E-12
score: 47.5
NoneNo IPR availablePANTHERPTHR22722FAMILY NOT NAMEDcoord: 20..508
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.807
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 148..191
NoneNo IPR availableSUPERFAMILYSSF63825YWTD domaincoord: 304..499
NoneNo IPR availableTMHMMTMhelixcoord: 567..589
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 67..98
e-value: 1.7E-9
score: 39.7
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 18..66
e-value: 5.6E-10
score: 41.2
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 57..99
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 20..60
IPR040093Low-density lipoprotein receptor class A domain-containing protein 1PANTHERPTHR22722:SF5LOW-DENSITY LIPOPROTEIN RECEPTOR CLASS A DOMAIN-CONTAINING PROTEIN 1-RELATEDcoord: 20..508
IPR023415Low-density lipoprotein (LDL) receptor class A, conserved sitePROSITEPS01209LDLRA_1coord: 76..98
IPR009030Growth factor receptor cysteine-rich domain superfamilySUPERFAMILYSSF57184Growth factor receptor domaincoord: 187..223