aadc

Overview
Nameaadc (AGS83412.1)
Smed IDSMED30020439
Length (bp)1797
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of aadc (SMED30020439) t-SNE clustered cells

Violin plots show distribution of expression levels for aadc (SMED30020439) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of aadc (SMED30020439) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for aadc (SMED30020439) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020439

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 25

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30020439SMESG000066844.1 SmedASXL_008859SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30020439SMESG000066844.1 dd_Smed_v4_11320_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30020439SMESG000066844.1 dd_Smed_v4_11320_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020439SMESG000066844.1 dd_Smed_v4_11320_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30020439SMESG000066844.1 dd_Smed_v4_11320_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020439SMESG000066844.1 Contig46219newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020439SMESG000066844.1 Contig46219uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020439SMESG000066844.1 Contig51377newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020439SMESG000066844.1 Contig51377uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020439SMESG000066844.1 Contig7378newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020439SMESG000066844.1 Contig7378uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020439SMESG000066847.1 SMESG000066846.1 SMESG000066844.1 Contig13374newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020439SMESG000066847.1 SMESG000066846.1 SMESG000066844.1 Contig13374uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020439SMESG000066847.1 SMESG000066846.1 SMESG000066844.1 Contig18383newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020439SMESG000066847.1 SMESG000066846.1 SMESG000066844.1 Contig18383uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parapharyngeal regionSMED30020439SMESG000066844.1 dd_Smed_v6_11320_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
eyeSMED30020439SMESG000066844.1 KC568452smed_ncbi_20200123PMID:24131630
März et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
ventral region of the whole animalSMED30020439SMESG000066844.1 KC568452smed_ncbi_20200123PMID:24131630
März et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
parapharyngeal regionSMED30020439SMESG000066844.1 KC568452smed_ncbi_20200123PMID:24131630
März et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
serotonergic neuronSMED30020439SMESG000066844.1 KC568452smed_ncbi_20200123PMID:24131630
März et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
photoreceptor neuronSMED30020439SMESG000066844.1 SMED30020439smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
secretory cellSMED30020439SMESG000066844.1 KF134115smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
ventral region of the whole animalSMED30020439SMESG000066844.1 KF134115smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
parapharyngeal regionSMED30020439SMESG000066844.1 KF134115smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
serotonergic neuronSMED30020439SMESG000066844.1 KF134115smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of aadc vs. Ensembl Human
Match: DDC (dopa decarboxylase [Source:HGNC Symbol;Acc:HGNC:2719])

HSP 1 Score: 531.176 bits (1367), Expect = 0.000e+0
Identity = 267/473 (56.45%), Postives = 338/473 (71.46%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSE-SGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKR-KMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKE--GKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDIT 1667
            M+A EFR+RGKEM+D++ANY+E I+  +V+P VEPGYL  +I A  P +P+ +++I+NDV  +IMPG+THWH P+F AYFP A+SY AM  D+L G IGCIGF+WA+SPACTELE VMMDWL KML+LPK FL+E +G GGGVI  + SEAT VALLAAR K I   +  + +  Q  IM KLV Y SDQAHSSVERAGL+  +K++ + S     MR S LQE ++ D   G  PF+ VATLGTT  C+FD+L E+GPIC    IWLHVDAAYAGSA IC E+RHLL+G+E+A SF FNPHKW+LVNFDCSA+W K    +   F +DP YLKH  +  G   D+RHW I LGRRFRSLK+WFV R+YGV G+Q YIR H++L+H FE L+  D RFEI  EV +GLVCFRLKG+N++N+ L  RI    +IH+V       D   LRFA+C +     HV+ A+  I ++ 
Sbjct:    1 MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDVEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIMEKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFMVATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQIPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVNEALLQRINSAKKIHLVPCHLR--DKFVLRFAICSRTVESAHVQRAWEHIKELA 471          
BLAST of aadc vs. Ensembl Human
Match: DDC (dopa decarboxylase [Source:HGNC Symbol;Acc:HGNC:2719])

HSP 1 Score: 531.176 bits (1367), Expect = 0.000e+0
Identity = 267/473 (56.45%), Postives = 338/473 (71.46%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSE-SGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKR-KMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKE--GKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDIT 1667
            M+A EFR+RGKEM+D++ANY+E I+  +V+P VEPGYL  +I A  P +P+ +++I+NDV  +IMPG+THWH P+F AYFP A+SY AM  D+L G IGCIGF+WA+SPACTELE VMMDWL KML+LPK FL+E +G GGGVI  + SEAT VALLAAR K I   +  + +  Q  IM KLV Y SDQAHSSVERAGL+  +K++ + S     MR S LQE ++ D   G  PF+ VATLGTT  C+FD+L E+GPIC    IWLHVDAAYAGSA IC E+RHLL+G+E+A SF FNPHKW+LVNFDCSA+W K    +   F +DP YLKH  +  G   D+RHW I LGRRFRSLK+WFV R+YGV G+Q YIR H++L+H FE L+  D RFEI  EV +GLVCFRLKG+N++N+ L  RI    +IH+V       D   LRFA+C +     HV+ A+  I ++ 
Sbjct:    1 MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDVEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIMEKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFMVATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQIPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVNEALLQRINSAKKIHLVPCHLR--DKFVLRFAICSRTVESAHVQRAWEHIKELA 471          
BLAST of aadc vs. Ensembl Human
Match: DDC (dopa decarboxylase [Source:HGNC Symbol;Acc:HGNC:2719])

HSP 1 Score: 483.797 bits (1244), Expect = 7.306e-167
Identity = 242/473 (51.16%), Postives = 308/473 (65.12%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSE-SGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKR-KMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKE--GKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDIT 1667
            M+A EFR+RGKEM+D++ANY+E I+  +V+P VEPGYL  +I A  P +P+ +++I+NDV  +IMPG                                      A+SPACTELE VMMDWL KML+LPK FL+E +G GGGVI  + SEAT VALLAAR K I   +  + +  Q  IM KLV Y SDQAHSSVERAGL+  +K++ + S     MR S LQE ++ D   G  PF+ VATLGTT  C+FD+L E+GPIC    IWLHVDAAYAGSA IC E+RHLL+G+E+A SF FNPHKW+LVNFDCSA+W K    +   F +DP YLKH  +  G   D+RHW I LGRRFRSLK+WFV R+YGV G+Q YIR H++L+H FE L+  D RFEI  EV +GLVCFRLKG+N++N+ L  RI    +IH+V       D   LRFA+C +     HV+ A+  I ++ 
Sbjct:    1 MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDVEKIIMPG--------------------------------------AASPACTELETVMMDWLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIMEKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFMVATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQIPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVNEALLQRINSAKKIHLVPCHLR--DKFVLRFAICSRTVESAHVQRAWEHIKELA 433          
BLAST of aadc vs. Ensembl Human
Match: DDC (dopa decarboxylase [Source:HGNC Symbol;Acc:HGNC:2719])

HSP 1 Score: 468.389 bits (1204), Expect = 6.391e-161
Identity = 245/472 (51.91%), Postives = 308/472 (65.25%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSE-SGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKE--GKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDIT 1667
            M+A EFR+RGKEM+D++ANY+E I+  +V+P VEPGYL  +I A  P +P+ +++I+NDV  +IMPG+THWH P+F AYFP A+SY AM  D+L G IGCIGF+WA+SPACTELE VMMDWL KML+LPK FL+E +G GGGVI  + SEAT VALLAAR K I   +  + +  Q  IM KLV Y SDQ                                                VATLGTT  C+FD+L E+GPIC    IWLHVDAAYAGSA IC E+RHLL+G+E+A SF FNPHKW+LVNFDCSA+W K    +   F +DP YLKH  +  G   D+RHW I LGRRFRSLK+WFV R+YGV G+Q YIR H++L+H FE L+  D RFEI  EV +GLVCFRLKG+N++N+ L  RI    +IH+V       D   LRFA+C +     HV+ A+  I ++ 
Sbjct:    1 MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDVEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIMEKLVAYSSDQM-----------------------------------------------VATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQIPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVNEALLQRINSAKKIHLVPCHLR--DKFVLRFAICSRTVESAHVQRAWEHIKELA 423          
BLAST of aadc vs. Ensembl Human
Match: HDC (histidine decarboxylase [Source:HGNC Symbol;Acc:HGNC:4855])

HSP 1 Score: 458.759 bits (1179), Expect = 7.700e-154
Identity = 228/471 (48.41%), Postives = 313/471 (66.45%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLS--ESGTGGGVIYNTCSEATFVALLAAR-NKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKR-KMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIID 1661
            M+ EE+R+RG+EM+D++  YL  + E +V P V+PGYL   +    P  P+ WD+I  D+  +IMPG+ HW  PH HAY+PA  S+ ++ GD+L+  I C+GFTWASSPACTELE+ +MDWLAKML LP+ FL    S  GGGV+ +T SE+T +ALLAAR NK +E +  E  D D+  + ++LV Y SDQAHSSVE+AGL+S++KM+ +       +RG  LQ+ I+ED + G  P +  ATLGTTG CAFD L E+GPIC    +WLH+DAAYAG+A +C E+R  L GIEYA SF FNP KWM+V+FDC+  W KD   + +TF+V+P+YL+H   G   DF HW I L RRFRS+K+WFV+R +GV  +Q ++R+  ++A  FE L+  D  FEI  +  +GLV FRLKG N + + +   I   GR+ ++ +     D L +RF V  QF T D +   +  I D
Sbjct:    2 MEPEEYRERGREMVDYICQYLSTVRERRVTPDVQPGYLRAQLPESAPEDPDSWDSIFGDIERIIMPGVVHWQSPHMHAYYPALTSWPSLLGDMLADAINCLGFTWASSPACTELEMNVMDWLAKMLGLPEHFLHHHPSSQGGGVLQSTVSESTLIALLAARKNKILEMKTSEP-DADESCLNARLVAYASDQAHSSVEKAGLISLVKMKFLPVDDNFSLRGEALQKAIEEDKQRGLVPVFVCATLGTTGVCAFDCLSELGPICAREGLWLHIDAAYAGTAFLCPEFRGFLKGIEYADSFTFNPSKWMMVHFDCTGFWVKDKYKLQQTFSVNPIYLRHANSGVATDFMHWQIPLSRRFRSVKLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRNDPSFEIPAKRHLGLVVFRLKGPNCLTENVLKEIAKAGRLFLIPATIQ--DKLIIRFTVTSQFTTRDDILRDWNLIRD 469          
BLAST of aadc vs. Ensembl Celegans
Match: tdc-1 (Tyrosine decarboxylase [Source:UniProtKB/Swiss-Prot;Acc:Q95ZS2])

HSP 1 Score: 489.574 bits (1259), Expect = 1.709e-166
Identity = 237/475 (49.89%), Postives = 336/475 (70.74%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFL--SESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKS-IKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQM 1676
            M  +EFR+ GKE +D++ +YLENI + +V P +EPGYL  +I ++ P  PE ++++M D   +IMPGITHW HP FHAYFPA NS+ ++  D+LS  IGC+GF+WA+ PA TELE++M+DW  KM+ LP +FL  +E+G GGGVI ++ SE  FV LLAAR + ++  R+     ++  ++SKL+ Y S +AHSSVE+A ++ M+K+R +++  K ++RG  L+  I+ED   G  PF+   TLGTT  C+FD L EIGPIC+ +++WLHVDAAY+GSA IC E+R L++GIEYAMSF  NP+KW+L+NFDCS +W +D   + +   VDP+YL+H    K  D+RHW I L RRFRSLK+WFV+R+YG+DG+QKYIR H++LA   E L+  D +FEIV EV MGLVCFR+KG++E+N+ L +R+   GRIH+V +     D   +RF VC + AT+  ++ AY  I   T  +
Sbjct:   77 MTRDEFRQYGKETVDYIVDYLENIQKRRVVPAIEPGYLKDLIPSEAPNTPESFESVMEDFEKLIMPGITHWQHPRFHAYFPAGNSFPSIIADMLSDAIGCVGFSWAACPAMTELELIMLDWFGKMIGLPAEFLPLTENGKGGGVIQSSASECNFVTLLAARFEVMKELRQRFPFVEEGLLLSKLIAYCSKEAHSSVEKACMIGMVKLRILETDSKFRLRGDTLRNAIQEDRNLGLIPFFVSTTLGTTSCCSFDVLSEIGPICKENELWLHVDAAYSGSAFICPEFRPLMNGIEYAMSFNTNPNKWLLINFDCSTMWVRDRFKLTQALVVDPLYLQHSWMDKSIDYRHWGIPLSRRFRSLKLWFVIRMYGIDGLQKYIREHVRLAKKMETLLRADAKFEIVNEVIMGLVCFRMKGDDELNQTLLTRLNASGRIHMVPASLG--DRFVIRFCVCAENATDKDIEVAYEIIAQATQHV 549          
BLAST of aadc vs. Ensembl Celegans
Match: tdc-1 (Tyrosine decarboxylase [Source:UniProtKB/Swiss-Prot;Acc:Q95ZS2])

HSP 1 Score: 489.574 bits (1259), Expect = 1.709e-166
Identity = 237/475 (49.89%), Postives = 336/475 (70.74%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFL--SESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKS-IKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQM 1676
            M  +EFR+ GKE +D++ +YLENI + +V P +EPGYL  +I ++ P  PE ++++M D   +IMPGITHW HP FHAYFPA NS+ ++  D+LS  IGC+GF+WA+ PA TELE++M+DW  KM+ LP +FL  +E+G GGGVI ++ SE  FV LLAAR + ++  R+     ++  ++SKL+ Y S +AHSSVE+A ++ M+K+R +++  K ++RG  L+  I+ED   G  PF+   TLGTT  C+FD L EIGPIC+ +++WLHVDAAY+GSA IC E+R L++GIEYAMSF  NP+KW+L+NFDCS +W +D   + +   VDP+YL+H    K  D+RHW I L RRFRSLK+WFV+R+YG+DG+QKYIR H++LA   E L+  D +FEIV EV MGLVCFR+KG++E+N+ L +R+   GRIH+V +     D   +RF VC + AT+  ++ AY  I   T  +
Sbjct:   77 MTRDEFRQYGKETVDYIVDYLENIQKRRVVPAIEPGYLKDLIPSEAPNTPESFESVMEDFEKLIMPGITHWQHPRFHAYFPAGNSFPSIIADMLSDAIGCVGFSWAACPAMTELELIMLDWFGKMIGLPAEFLPLTENGKGGGVIQSSASECNFVTLLAARFEVMKELRQRFPFVEEGLLLSKLIAYCSKEAHSSVEKACMIGMVKLRILETDSKFRLRGDTLRNAIQEDRNLGLIPFFVSTTLGTTSCCSFDVLSEIGPICKENELWLHVDAAYSGSAFICPEFRPLMNGIEYAMSFNTNPNKWLLINFDCSTMWVRDRFKLTQALVVDPLYLQHSWMDKSIDYRHWGIPLSRRFRSLKLWFVIRMYGIDGLQKYIREHVRLAKKMETLLRADAKFEIVNEVIMGLVCFRMKGDDELNQTLLTRLNASGRIHMVPASLG--DRFVIRFCVCAENATDKDIEVAYEIIAQATQHV 549          
BLAST of aadc vs. Ensembl Celegans
Match: tdc-1 (Tyrosine decarboxylase [Source:UniProtKB/Swiss-Prot;Acc:Q95ZS2])

HSP 1 Score: 489.574 bits (1259), Expect = 9.358e-166
Identity = 237/475 (49.89%), Postives = 336/475 (70.74%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFL--SESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKS-IKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQM 1676
            M  +EFR+ GKE +D++ +YLENI + +V P +EPGYL  +I ++ P  PE ++++M D   +IMPGITHW HP FHAYFPA NS+ ++  D+LS  IGC+GF+WA+ PA TELE++M+DW  KM+ LP +FL  +E+G GGGVI ++ SE  FV LLAAR + ++  R+     ++  ++SKL+ Y S +AHSSVE+A ++ M+K+R +++  K ++RG  L+  I+ED   G  PF+   TLGTT  C+FD L EIGPIC+ +++WLHVDAAY+GSA IC E+R L++GIEYAMSF  NP+KW+L+NFDCS +W +D   + +   VDP+YL+H    K  D+RHW I L RRFRSLK+WFV+R+YG+DG+QKYIR H++LA   E L+  D +FEIV EV MGLVCFR+KG++E+N+ L +R+   GRIH+V +     D   +RF VC + AT+  ++ AY  I   T  +
Sbjct:   77 MTRDEFRQYGKETVDYIVDYLENIQKRRVVPAIEPGYLKDLIPSEAPNTPESFESVMEDFEKLIMPGITHWQHPRFHAYFPAGNSFPSIIADMLSDAIGCVGFSWAACPAMTELELIMLDWFGKMIGLPAEFLPLTENGKGGGVIQSSASECNFVTLLAARFEVMKELRQRFPFVEEGLLLSKLIAYCSKEAHSSVEKACMIGMVKLRILETDSKFRLRGDTLRNAIQEDRNLGLIPFFVSTTLGTTSCCSFDVLSEIGPICKENELWLHVDAAYSGSAFICPEFRPLMNGIEYAMSFNTNPNKWLLINFDCSTMWVRDRFKLTQALVVDPLYLQHSWMDKSIDYRHWGIPLSRRFRSLKLWFVIRMYGIDGLQKYIREHVRLAKKMETLLRADAKFEIVNEVIMGLVCFRMKGDDELNQTLLTRLNASGRIHMVPASLG--DRFVIRFCVCAENATDKDIEVAYEIIAQATQHV 549          
BLAST of aadc vs. Ensembl Celegans
Match: bas-1 (Biogenic Amine Synthesis related [Source:UniProtKB/TrEMBL;Acc:O45137])

HSP 1 Score: 380.178 bits (975), Expect = 1.194e-125
Identity = 218/515 (42.33%), Postives = 310/515 (60.19%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFL-SESGTGGGVIYNTCSEATFVALLAARNKAIEF-------------------------RRKENLDEDQY-----------TIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIK-----RKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGN-NEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQM 1676
            MD+++ R  GK+M+DFVA+Y + I + K  P V+PGY++ ++ A  P  PE+W  I +D+ +V++ G THWHHPHF AYFP A SY ++  DILSGGI  IGFTW S P+ TELE+  +DW+  ++ LP+ F  S +G G G+I +T S++T +A++AAR   +E                          R K N  +D+            T+  + V Y SDQAHSSVE+  +LS ++MR++K+ +       +    LQ  IKED   G+ PF  +AT+GTT SC  D +DE+GP+C    ++LHVDAAYAG+  +C+E+++L+ G+E+  SF FN HK  +VNFDCS +WFK+   V   F VD VYL H+ +    D+RH  + LGRRFRSLKIWFVLR  GVD I++Y+R    LA  F KL+L + +FE      +GL CFRLK + N  N++L + I  D RIH+V S      T +LR  VC Q  T D + YA   I ++  ++
Sbjct:    1 MDSQKLRTEGKKMLDFVADYWDGIRDRKPLPDVKPGYINDLVPAQAPATPEDWAKIFDDLENVVVNGATHWHHPHFFAYFPTALSYQSIMADILSGGIAGIGFTWKSCPSMTELEMSSLDWVVDLMGLPEHFKNSHNGPGCGIIQSTASDSTMIAIMAARATHVERIKSEPTFMKWVSETGVGKTLKNIFDRVKVNKVDDEASGMITPYFHDPTVFERFVMYCSDQAHSSVEKGAMLSAVRMRKLKATRGFLGNYGVSRETLQNAIKEDRARGYIPFMFLATVGTTCSCGVDQVDELGPVCVEEGLYLHVDAAYAGTFALCEEFKYLIRGMEHVDSFNFNLHKAGMVNFDCSPMWFKNGTHVSRYFNVDAVYLAHEYQTTASDYRHLQVALGRRFRSLKIWFVLRNMGVDKIREYLRRTELLAAEFSKLILENGKFEHFVPQHLGLTCFRLKNSTNADNEKLCNAINDDRRIHLVPSTVH--GTYFLRMVVCSQLTTLDDIIYARDVIFELAEKL 513          
BLAST of aadc vs. Ensembl Celegans
Match: bas-1 (Biogenic Amine Synthesis related [Source:UniProtKB/TrEMBL;Acc:O45137])

HSP 1 Score: 378.637 bits (971), Expect = 5.874e-125
Identity = 217/524 (41.41%), Postives = 310/524 (59.16%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFL-SESGTGGGVIYNTCSEATFVALLAAR-----------------------------------NKAIEFRRKENLDEDQY----------TIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIK-----RKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGN-NEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQM 1676
            MD+++ R  GK+M+DFVA+Y + I + K  P V+PGY++ ++ A  P  PE+W  I +D+ +V++ G THWHHPHF AYFP A SY ++  DILSGGI  IGFTW S P+ TELE+  +DW+  ++ LP+ F  S +G G G+I +T S++T +A++AAR                                   NK +  R    +D++            T+  + V Y SDQAHSSVE+  +LS ++MR++K+ +       +    LQ  IKED   G+ PF  +AT+GTT SC  D +DE+GP+C    ++LHVDAAYAG+  +C+E+++L+ G+E+  SF FN HK  +VNFDCS +WFK+   V   F VD VYL H+ +    D+RH  + LGRRFRSLKIWFVLR  GVD I++Y+R    LA  F KL+L + +FE      +GL CFRLK + N  N++L + I  D RIH+V S      T +LR  VC Q  T D + YA   I ++  ++
Sbjct:    1 MDSQKLRTEGKKMLDFVADYWDGIRDRKPLPDVKPGYINDLVPAQAPATPEDWAKIFDDLENVVVNGATHWHHPHFFAYFPTALSYQSIMADILSGGIAGIGFTWKSCPSMTELEMSSLDWVVDLMGLPEHFKNSHNGPGCGIIQSTASDSTMIAIMAARATHVERIKSEPTFMKWVSETGVGKTLKNIFDRVKVNKTLVARASVTVDDEASGMITPYFHDPTVFERFVMYCSDQAHSSVEKGAMLSAVRMRKLKATRGFLGNYGVSRETLQNAIKEDRARGYIPFMFLATVGTTCSCGVDQVDELGPVCVEEGLYLHVDAAYAGTFALCEEFKYLIRGMEHVDSFNFNLHKAGMVNFDCSPMWFKNGTHVSRYFNVDAVYLAHEYQTTASDYRHLQVALGRRFRSLKIWFVLRNMGVDKIREYLRRTELLAAEFSKLILENGKFEHFVPQHLGLTCFRLKNSTNADNEKLCNAINDDRRIHLVPSTVH--GTYFLRMVVCSQLTTLDDIIYARDVIFELAEKL 522          
BLAST of aadc vs. Ensembl Fly
Match: Ddc (gene:FBgn0000422 transcript:FBtr0081167)

HSP 1 Score: 548.51 bits (1412), Expect = 0.000e+0
Identity = 277/502 (55.18%), Postives = 352/502 (70.12%), Query Frame = 3
Query:  189 NVFDNKESLRKSGRKISHDVYTPK----MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSESGTGGG-VIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQMD 1679
            N    K++       IS D   PK    M+A EF+   K M+DF+A YLENI E +V P V+PGYL  +I    P KPE+W ++M D+  VIMPG+THWH P FHAYFP ANSY A+  D+LSG I CIGFTW +SPACTELEVVMMDWL KML+LP +FL+ SG  GG VI  T SE+T VALL A+ K ++  ++ + + D++TI+ KLVGY SDQAHSSVERAGLL  +K+R V+S   +MRG+ L++ I++D+  G  PFY V TLGTT SCAFD LDE GP+   H +W+HVDAAYAGSA IC EYRHL+ GIE A SF FNPHKWMLVNFDCSA+W KD  +VV  F VDP+YLKH  +G  PD+RHW I LGRRFR+LK+WFVLRLYGV+ +Q +IR H   A  F  L + D RFE+  E+ MGLVCFRLKG+NE N+ L  RI G G IH+V ++    D  +LR A+C +F   + ++Y++  +    ++M+
Sbjct:    8 NTIPTKQTDGNGKANISPDKLDPKVSIDMEAPEFKDFAKTMVDFIAEYLENIRERRVLPEVKPGYLKPLIPDAAPEKPEKWQDVMQDIERVIMPGVTHWHSPKFHAYFPTANSYPAIVADMLSGAIACIGFTWIASPACTELEVVMMDWLGKMLELPAEFLACSGGKGGGVIQGTASESTLVALLGAKAKKLKEVKELHPEWDEHTILGKLVGYCSDQAHSSVERAGLLGGVKLRSVQSENHRMRGAALEKAIEQDVAEGLIPFYAVVTLGTTNSCAFDYLDECGPVGNKHNLWIHVDAAYAGSAFICPEYRHLMKGIESADSFNFNPHKWMLVNFDCSAMWLKDPSWVVNAFNVDPLYLKHDMQGSAPDYRHWQIPLGRRFRALKLWFVLRLYGVENLQAHIRRHCNFAKQFGDLCVADSRFELAAEINMGLVCFRLKGSNERNEALLKRINGRGHIHLVPAKIK--DVYFLRMAICSRFTQSEDMEYSWKEVSAAADEME 507          
BLAST of aadc vs. Ensembl Fly
Match: Ddc (gene:FBgn0000422 transcript:FBtr0290291)

HSP 1 Score: 543.117 bits (1398), Expect = 0.000e+0
Identity = 270/474 (56.96%), Postives = 343/474 (72.36%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSESGTGGG-VIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQMD 1679
            M+A EF+   K M+DF+A YLENI E +V P V+PGYL  +I    P KPE+W ++M D+  VIMPG+THWH P FHAYFP ANSY A+  D+LSG I CIGFTW +SPACTELEVVMMDWL KML+LP +FL+ SG  GG VI  T SE+T VALL A+ K ++  ++ + + D++TI+ KLVGY SDQAHSSVERAGLL  +K+R V+S   +MRG+ L++ I++D+  G  PFY V TLGTT SCAFD LDE GP+   H +W+HVDAAYAGSA IC EYRHL+ GIE A SF FNPHKWMLVNFDCSA+W KD  +VV  F VDP+YLKH  +G  PD+RHW I LGRRFR+LK+WFVLRLYGV+ +Q +IR H   A  F  L + D RFE+  E+ MGLVCFRLKG+NE N+ L  RI G G IH+V ++    D  +LR A+C +F   + ++Y++  +    ++M+
Sbjct:    1 MEAPEFKDFAKTMVDFIAEYLENIRERRVLPEVKPGYLKPLIPDAAPEKPEKWQDVMQDIERVIMPGVTHWHSPKFHAYFPTANSYPAIVADMLSGAIACIGFTWIASPACTELEVVMMDWLGKMLELPAEFLACSGGKGGGVIQGTASESTLVALLGAKAKKLKEVKELHPEWDEHTILGKLVGYCSDQAHSSVERAGLLGGVKLRSVQSENHRMRGAALEKAIEQDVAEGLIPFYAVVTLGTTNSCAFDYLDECGPVGNKHNLWIHVDAAYAGSAFICPEYRHLMKGIESADSFNFNPHKWMLVNFDCSAMWLKDPSWVVNAFNVDPLYLKHDMQGSAPDYRHWQIPLGRRFRALKLWFVLRLYGVENLQAHIRRHCNFAKQFGDLCVADSRFELAAEINMGLVCFRLKGSNERNEALLKRINGRGHIHLVPAKIK--DVYFLRMAICSRFTQSEDMEYSWKEVSAAADEME 472          
BLAST of aadc vs. Ensembl Fly
Match: Ddc (gene:FBgn0000422 transcript:FBtr0081166)

HSP 1 Score: 543.117 bits (1398), Expect = 0.000e+0
Identity = 270/474 (56.96%), Postives = 343/474 (72.36%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSESGTGGG-VIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQMD 1679
            M+A EF+   K M+DF+A YLENI E +V P V+PGYL  +I    P KPE+W ++M D+  VIMPG+THWH P FHAYFP ANSY A+  D+LSG I CIGFTW +SPACTELEVVMMDWL KML+LP +FL+ SG  GG VI  T SE+T VALL A+ K ++  ++ + + D++TI+ KLVGY SDQAHSSVERAGLL  +K+R V+S   +MRG+ L++ I++D+  G  PFY V TLGTT SCAFD LDE GP+   H +W+HVDAAYAGSA IC EYRHL+ GIE A SF FNPHKWMLVNFDCSA+W KD  +VV  F VDP+YLKH  +G  PD+RHW I LGRRFR+LK+WFVLRLYGV+ +Q +IR H   A  F  L + D RFE+  E+ MGLVCFRLKG+NE N+ L  RI G G IH+V ++    D  +LR A+C +F   + ++Y++  +    ++M+
Sbjct:    1 MEAPEFKDFAKTMVDFIAEYLENIRERRVLPEVKPGYLKPLIPDAAPEKPEKWQDVMQDIERVIMPGVTHWHSPKFHAYFPTANSYPAIVADMLSGAIACIGFTWIASPACTELEVVMMDWLGKMLELPAEFLACSGGKGGGVIQGTASESTLVALLGAKAKKLKEVKELHPEWDEHTILGKLVGYCSDQAHSSVERAGLLGGVKLRSVQSENHRMRGAALEKAIEQDVAEGLIPFYAVVTLGTTNSCAFDYLDECGPVGNKHNLWIHVDAAYAGSAFICPEYRHLMKGIESADSFNFNPHKWMLVNFDCSAMWLKDPSWVVNAFNVDPLYLKHDMQGSAPDYRHWQIPLGRRFRALKLWFVLRLYGVENLQAHIRRHCNFAKQFGDLCVADSRFELAAEINMGLVCFRLKGSNERNEALLKRINGRGHIHLVPAKIK--DVYFLRMAICSRFTQSEDMEYSWKEVSAAADEME 472          
BLAST of aadc vs. Ensembl Fly
Match: Hdc (gene:FBgn0005619 transcript:FBtr0331924)

HSP 1 Score: 471.47 bits (1212), Expect = 8.455e-160
Identity = 231/461 (50.11%), Postives = 318/461 (68.98%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFL--SESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKR-KMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHV 1634
            MD +E+R+RGKEM+D++A+YLENI E +VFP V PGY+ +++    PI+ E W  I +DV  ++MPGITHW  PH HAYFPA NS  ++ GD+L+  I C+GFTWASSPACTELE+++M+WL KM+ LP  FL  S    GGGV+  T SEAT V LLA R +AI+   + +       I ++LV Y SDQAHSSVE+A L+ +++MR +++     MRG +L+E I++D++ G  PF+  ATLGTTGSC+FD+L+EIG +C  H +WLHVDAAYAGSA IC E+R  L GIE A S  FNP KW++V+FD +A+W +DS  V  TF V+P+YL+H+  G   DF HW I L RRFR+LK+WFVLR YG+ G+Q++IR  ++LA  FE L+L D RFE+  +  +GLV FR++G+NEI ++L  R+   G +H + S         +RF +     T D +
Sbjct:    1 MDFKEYRQRGKEMVDYIADYLENIRERRVFPDVSPGYMRQLLPESAPIEGEPWPKIFSDVERIVMPGITHWQSPHMHAYFPALNSMPSLLGDMLADAINCLGFTWASSPACTELEIIVMNWLGKMIGLPDAFLHLSSQSQGGGVLQTTASEATLVCLLAGRTRAIQRFHERHPGYQDAEINARLVAYCSDQAHSSVEKAALIGLVRMRYIEADDDLAMRGKLLREAIEDDIKQGLVPFWVCATLGTTGSCSFDNLEEIGIVCAEHHLWLHVDAAYAGSAFICPEFRTWLRGIERADSIAFNPSKWLMVHFDATALWVRDSTAVHRTFNVEPLYLQHENSGVAVDFMHWQIPLSRRFRALKVWFVLRSYGIKGLQRHIREGVRLAQKFEALVLADHRFELPAKRHLGLVVFRIRGDNEITEKLLKRLNHRGNLHCIPSSLK--GQYVIRFTITSTHTTLDDI 459          
BLAST of aadc vs. Ensembl Fly
Match: Tdc2 (gene:FBgn0050446 transcript:FBtr0086142)

HSP 1 Score: 470.315 bits (1209), Expect = 4.212e-159
Identity = 237/476 (49.79%), Postives = 327/476 (68.70%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLS--ESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIK-RKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQ-IWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQM 1676
            MD+ EFRKRG EM++++ NYLE ++E +V P VEPGYL  ++  + P +PE+WD IM DV   IMPG+THW HP FHAYFPA NS+ ++ GD+L  GIGCIGF+WA+SPACTELE +++DWL K + LP  FL+  E  TGGGVI  + SE   V +LAAR +A++  + ++   ++  ++SKL+ Y S +AHS VE+A ++  +K+R ++      +RG  + E ++ED   G  PF+   TLGTTGSCAFD+L EIG   +    +WLHVDAAYAG++ IC E + LL GIEYA SF  NP+KW+L NFDCS +W +D   +     VDP+YLKH       D+RHW + L RRFRSLK+WFVLR YG+ G+Q YIR+HIKLA  FE+L+L D RFEI  +V +GLVCFRLKG++++N++L S I   G++H+V +  S  D   +RF    Q AT + + YA+  I+D  N++
Sbjct:    1 MDSTEFRKRGMEMVEYICNYLETLNERRVTPSVEPGYLRHLLPPEAPQEPEDWDQIMRDVEDKIMPGVTHWQHPRFHAYFPAGNSFPSILGDMLGDGIGCIGFSWAASPACTELETIVLDWLGKAIGLPDHFLALKEGSTGGGVIQTSASECVLVTMLAARAQALKRLKAQHPFVEEGHLLSKLMAYCSKEAHSCVEKAAMICFVKLRILEPDDDASLRGQTIYEAMEEDELQGLVPFFVSTTLGTTGSCAFDNLPEIGKQLQRFPGVWLHVDAAYAGNSFICPELKPLLKGIEYADSFNTNPNKWLLTNFDCSTLWVRDRIRLTSALVVDPLYLKHGYSDAAIDYRHWGVPLSRRFRSLKLWFVLRSYGISGLQHYIRHHIKLAKRFEELVLKDKRFEICNQVKLGLVCFRLKGSDKLNEKLLSIINESGKLHMVPA--SVGDRYIIRFCAVAQNATAEDIDYAWDIIVDFANEL 474          
BLAST of aadc vs. Ensembl Zebrafish
Match: ddc (dopa decarboxylase [Source:ZFIN;Acc:ZDB-GENE-040426-2656])

HSP 1 Score: 511.146 bits (1315), Expect = 3.291e-177
Identity = 255/476 (53.57%), Postives = 346/476 (72.69%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSES-GTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKS-IKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLK--HKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQM 1676
            MDA EFR+RG+EM+D+VA+Y+ENI++ +V+P VEPGYL  +I  + P +PE +++++ D+  VIMPG+THWH P+F+AYFP A+SY AM  DIL G IGCIGF+WA+SPACTELE VM+DWL KML+LP+DFL+ + G GGGVI +T SEAT + LLAAR+K +   + ++ D  +  I+SKLV Y SDQAHSSVERAGL+  ++M+++ +  K  +RG  L+ ++KED   G  PF+  ATLGTT SCAFD + E+GPIC A ++W+H+DAAYAGSA IC E+R LL+GIE+A SF FNPHKW+L+NFDCSA+W K    ++  F ++P+YLK  H++ G   D+RHW I LGRRFRSLK+WFV R+YG+  +Q YIR H+ LA  FE  +  D RFEI  +V MGLVCFRLKG NE+++ L  RI    +IH+V    +      LRFAVC +     HV+ A+  I  + +++
Sbjct:    1 MDAAEFRRRGREMVDYVADYIENIEKRQVYPDVEPGYLRSLIPEEAPEEPESYEDVVKDIERVIMPGVTHWHSPYFYAYFPTAHSYPAMLADILCGAIGCIGFSWAASPACTELETVMLDWLGKMLKLPEDFLAGTKGKGGGVIQSTASEATLITLLAARSKIVRLIQADHPDRSETDIISKLVAYSSDQAHSSVERAGLIGGVRMKKIPTDSKFSVRGDALERILKEDKAAGLIPFFFCATLGTTASCAFDCITELGPICNAEKMWMHIDAAYAGSAFICPEFRPLLNGIEFADSFNFNPHKWLLINFDCSAMWVKKRADIIGAFKMEPLYLKHDHQESGLVTDYRHWQIPLGRRFRSLKMWFVFRMYGLKALQAYIRKHVGLAKEFEAFVRADQRFEISADVVMGLVCFRLKGPNELSENLLKRINSARKIHLVPCHLA--GLFVLRFAVCARATESRHVQEAWCHIRQLASEL 474          
BLAST of aadc vs. Ensembl Zebrafish
Match: hdc (histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-080102-5])

HSP 1 Score: 447.203 bits (1149), Expect = 5.462e-152
Identity = 223/470 (47.45%), Postives = 315/470 (67.02%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSE--SGTGGGVIYNTCSEATFVALLAARNKAIEFRRKE--NLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKR-KMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTI 1655
            M  +E+  RGKEM++++  YL  I E +V P V+PG++  ++ +  P +PE+W  IM DV ++IMPG+ HW  PH HAYFPA NS+ ++ GD+L+  I C+GFTWASSPACTELE+ ++DWL K L LP  +L      TGGG++ +T SE T VALLAAR   I   + E  + D D+  + S+LV Y SDQAHSSVE+AGL+S++K+R +++     +RG  LQ  ++ED  +G  P    ATLG+TG C+FD LDE+GP+C    +WLHVDAAYAGSAL+C E R+ LDGI++A SFVFNP KWMLV+FDC+A W K+   + +TFTVDP+YL+H       DF HW I L RRFRSLK+WFV+R +G+  +Q++IR+ +++A LFE L+  D  F+I  +  +GLV F L+  N   +EL  ++   GR+ ++ +     + L LRF+V  Q  TE  ++  +  I
Sbjct:    1 MQPQEYMLRGKEMVEYIHQYLTGIRERRVVPDVQPGFMRPLLPSSAPYEPEDWSTIMQDVENIIMPGVVHWQSPHMHAYFPALNSWPSLLGDMLADAINCLGFTWASSPACTELEMCVLDWLCKALGLPDHYLHHHPQSTGGGILQSTVSECTLVALLAARKDRILQMKSEATHTDTDESVLNSRLVAYASDQAHSSVEKAGLISLVKIRFLQTDAVFSLRGETLQRAVEEDRRSGLIPVMVCATLGSTGVCSFDRLDELGPVCVREGLWLHVDAAYAGSALLCPELRYFLDGIQFADSFVFNPSKWMLVHFDCTAFWVKNKMKLQQTFTVDPLYLRHDNSNAT-DFMHWQIPLSRRFRSLKLWFVIRSFGLKKLQEHIRHGVEMAKLFESLVRNDTHFQIPAQRHLGLVVFCLRAGNAATQELLRKLTRSGRMFLIPAAVG--NQLILRFSVTSQLTTEQDIRRDWSLI 467          
BLAST of aadc vs. Ensembl Zebrafish
Match: hdc (histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-080102-5])

HSP 1 Score: 415.231 bits (1066), Expect = 6.070e-138
Identity = 215/470 (45.74%), Postives = 305/470 (64.89%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFL--SESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKE--NLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKR-KMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTI 1655
            M  +E+  RGKEM++++  YL  I E +V P V+PG++  ++ +  P +PE+W  IM DV ++IMPG+ HW  PH HAYFPA NS+ ++ GD+L+  I C+GFTWASSPACTELE+ ++DWL K L LP  +L      TGGG++ +T SE T VALLAAR   I   + E  + D D+  + S+LV Y SDQAHSSVE+AGL+S++K+R +++     +RG  LQ  ++ED  +G  P    ATLG+TG            + E   +WLHVDAAYAGSAL+C E R+ LDGI++A SFVFNP KWMLV+FDC+A W K+   + +TFTVDP+YL+H       DF HW I L RRFRSLK+WFV+R +G+  +Q++IR+ +++A LFE L+  D  F+I  +  +GLV F L+  N   +EL  ++   GR+ ++ +     + L LRF+V  Q  TE  ++  +  I
Sbjct:    1 MQPQEYMLRGKEMVEYIHQYLTGIRERRVVPDVQPGFMRPLLPSSAPYEPEDWSTIMQDVENIIMPGVVHWQSPHMHAYFPALNSWPSLLGDMLADAINCLGFTWASSPACTELEMCVLDWLCKALGLPDHYLHHHPQSTGGGILQSTVSECTLVALLAARKDRILQMKSEATHTDTDESVLNSRLVAYASDQAHSSVEKAGLISLVKIRFLQTDAVFSLRGETLQRAVEEDRRSGLIPVMVCATLGSTG------------VREG--LWLHVDAAYAGSALLCPELRYFLDGIQFADSFVFNPSKWMLVHFDCTAFWVKNKMKLQQTFTVDPLYLRHDNSNAT-DFMHWQIPLSRRFRSLKLWFVIRSFGLKKLQEHIRHGVEMAKLFESLVRNDTHFQIPAQRHLGLVVFCLRAGNAATQELLRKLTRSGRMFLIPAAVG--NQLILRFSVTSQLTTEQDIRRDWSLI 453          
BLAST of aadc vs. Ensembl Zebrafish
Match: csad (cysteine sulfinic acid decarboxylase [Source:ZFIN;Acc:ZDB-GENE-041114-36])

HSP 1 Score: 120.553 bits (301), Expect = 1.080e-28
Identity = 91/333 (27.33%), Postives = 148/333 (44.44%), Query Frame = 3
Query:  516 YAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKRKMRGSVLQEMIKEDLENGFY--------PFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKD-SRFVVETFTVDPVYL--KHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCF 1481
            Y A+ G +++  +    +T+  +P    +E  ++  L  ++   +        G G+     S +   A+  AR  A    + + L         ++  + S Q+H SV++      I    V  ++    GS    MI EDLE            PF+  AT GTT   AFD L  I  ICE + +W+HVDAA+ GS L  +++RHL+ GIE A S  +NPHK +L    CS + F+D +  ++   +    YL  + K      D     IQ GR+   LK+W + +  G  G+ + +     L     + M   + F++V +     VCF
Sbjct:   88 YHALTGRLITETLNTSQYTYEVAPVFVLMEEEVISKLRSLVGWSE--------GDGIFCPGGSMSNMYAINVARYWAFPQVKTKGL-----WAAPRMAIFTSQQSHYSVKKGAAFLGIGTENVFIVQVDESGS----MIPEDLEAKIVQAKSQDAVPFFVNATAGTTVQGAFDPLKRIADICERNGMWMHVDAAWGGSVLFSKKHRHLVAGIERANSVTWNPHKMLLTGLQCSVILFRDTTNLLMHCHSAKATYLFQQDKFYDTSLDTGDKSIQCGRKVDCLKLWLMWKAIGASGLSQRVDKAFALTRYLVEEMEKRENFQLVCKGPFVNVCF 403          
BLAST of aadc vs. Ensembl Zebrafish
Match: csad (cysteine sulfinic acid decarboxylase [Source:ZFIN;Acc:ZDB-GENE-041114-36])

HSP 1 Score: 120.939 bits (302), Expect = 1.734e-28
Identity = 91/333 (27.33%), Postives = 148/333 (44.44%), Query Frame = 3
Query:  516 YAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKRKMRGSVLQEMIKEDLENGFY--------PFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKD-SRFVVETFTVDPVYL--KHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCF 1481
            Y A+ G +++  +    +T+  +P    +E  ++  L  ++   +        G G+     S +   A+  AR  A    + + L         ++  + S Q+H SV++      I    V  ++    GS    MI EDLE            PF+  AT GTT   AFD L  I  ICE + +W+HVDAA+ GS L  +++RHL+ GIE A S  +NPHK +L    CS + F+D +  ++   +    YL  + K      D     IQ GR+   LK+W + +  G  G+ + +     L     + M   + F++V +     VCF
Sbjct:  150 YHALTGRLITETLNTSQYTYEVAPVFVLMEEEVISKLRSLVGWSE--------GDGIFCPGGSMSNMYAINVARYWAFPQVKTKGL-----WAAPRMAIFTSQQSHYSVKKGAAFLGIGTENVFIVQVDESGS----MIPEDLEAKIVQAKSQDAVPFFVNATAGTTVQGAFDPLKRIADICERNGMWMHVDAAWGGSVLFSKKHRHLVAGIERANSVTWNPHKMLLTGLQCSVILFRDTTNLLMHCHSAKATYLFQQDKFYDTSLDTGDKSIQCGRKVDCLKLWLMWKAIGASGLSQRVDKAFALTRYLVEEMEKRENFQLVCKGPFVNVCF 465          
BLAST of aadc vs. Ensembl Xenopus
Match: ddc (dopa decarboxylase [Source:NCBI gene;Acc:496742])

HSP 1 Score: 510.76 bits (1314), Expect = 9.126e-177
Identity = 256/476 (53.78%), Postives = 337/476 (70.80%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLS-ESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKRKM-RGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKE--GKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQM 1676
            M+A EFRKRGK+M+D+VA+YLE I+  +VFP VEPGYL  +I    P + E ++ I+ DV  VIMPG+THWH P+F AYFP  +SY A+  D+L G IGCIGF+WASSPACTELE VM+DWL KM+ LP+ FL+   G GGGVI  T SEAT +ALLAAR K     + EN    +  I+S++V Y SDQAHSSVERAGL+S ++M+++ S +  + RG  L++ ++ED   G  P +  ATLGTT SCAFD+L E+GP+C A  IW+H+DAAYAGSA IC E+R+L+ GIE+A SF FNPHKW+LVNFDCS  W K    ++  F +DPVYL++ ++  G   D+RHW I LGRRFRSLK+WFV R+YGV G+Q +IR H+ LAH F + +  DD+FEI   V +GLVCFRLKG+NE+NK L  +I    +IHIV       DT  LRFAVC +     H+++A+  I ++T ++
Sbjct:    1 MNASEFRKRGKDMVDYVADYLEQIESRQVFPDVEPGYLRPLIPDSAPEEGETYEEIIKDVERVIMPGVTHWHSPYFFAYFPTGSSYPALLADMLCGAIGCIGFSWASSPACTELETVMLDWLGKMIGLPEQFLAGNKGEGGGVIQGTASEATLMALLAARTKVTRRLQAENPKLTEAEIVSRMVAYSSDQAHSSVERAGLISGVRMKKIPSDENFVARGQALKKALEEDKAEGLIPIFFCATLGTTNSCAFDNLLELGPVCNAENIWMHIDAAYAGSAFICPEFRYLMKGIEFADSFNFNPHKWLLVNFDCSTFWVKKRSDLIGAFKMDPVYLQYDQQESGLVTDYRHWQIPLGRRFRSLKLWFVFRIYGVKGLQVHIRKHVGLAHEFLECVKKDDQFEICAPVILGLVCFRLKGSNELNKALLQKINNSKKIHIVPCCLG--DTFVLRFAVCARTVESSHIQFAWKHIKELTTEL 474          
BLAST of aadc vs. Ensembl Xenopus
Match: ddc (dopa decarboxylase [Source:NCBI gene;Acc:496742])

HSP 1 Score: 510.375 bits (1313), Expect = 1.307e-176
Identity = 256/476 (53.78%), Postives = 337/476 (70.80%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLS-ESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKRKM-RGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKE--GKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQM 1676
            M+A EFRKRGK+M+D+VA+YLE I+  +VFP VEPGYL  +I    P + E ++ I+ DV  VIMPG+THWH P+F AYFP  +SY A+  D+L G IGCIGF+WASSPACTELE VM+DWL KM+ LP+ FL+   G GGGVI  T SEAT +ALLAAR K     + EN    +  I+S++V Y SDQAHSSVERAGL+S ++M+++ S +  + RG  L++ ++ED   G  P +  ATLGTT SCAFD+L E+GP+C A  IW+H+DAAYAGSA IC E+R+L+ GIE+A SF FNPHKW+LVNFDCS  W K    ++  F +DPVYL++ ++  G   D+RHW I LGRRFRSLK+WFV R+YGV G+Q +IR H+ LAH F + +  DD+FEI   V +GLVCFRLKG+NE+NK L  +I    +IHIV       DT  LRFAVC +     H+++A+  I ++T ++
Sbjct:    1 MNASEFRKRGKDMVDYVADYLEQIESRQVFPDVEPGYLRPLIPDSAPEEGETYEEIIKDVERVIMPGVTHWHSPYFFAYFPTGSSYPALLADMLCGAIGCIGFSWASSPACTELETVMLDWLGKMIGLPEQFLAGNKGEGGGVIQGTASEATLMALLAARTKVTRRLQAENPKLTEAEIVSRMVAYSSDQAHSSVERAGLISGVRMKKIPSDENFVARGQALKKALEEDKAEGLIPIFFCATLGTTNSCAFDNLLELGPVCNAENIWMHIDAAYAGSAFICPEFRYLMKGIEFADSFNFNPHKWLLVNFDCSTFWVKKRSDLIGAFKMDPVYLQYDQQESGLVTDYRHWQIPLGRRFRSLKLWFVFRIYGVKGLQVHIRKHVGLAHEFLECVKKDDQFEICAPVILGLVCFRLKGSNELNKALLQKINNSKKIHIVPCCLG--DTFVLRFAVCARTVESSHIQFAWKHIKELTTEL 474          
BLAST of aadc vs. Ensembl Xenopus
Match: ddc (dopa decarboxylase [Source:NCBI gene;Acc:496742])

HSP 1 Score: 509.99 bits (1312), Expect = 1.550e-176
Identity = 256/476 (53.78%), Postives = 337/476 (70.80%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLS-ESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKRKM-RGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKE--GKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQM 1676
            M+A EFRKRGK+M+D+VA+YLE I+  +VFP VEPGYL  +I    P + E ++ I+ DV  VIMPG+THWH P+F AYFP  +SY A+  D+L G IGCIGF+WASSPACTELE VM+DWL KM+ LP+ FL+   G GGGVI  T SEAT +ALLAAR K     + EN    +  I+S++V Y SDQAHSSVERAGL+S ++M+++ S +  + RG  L++ ++ED   G  P +  ATLGTT SCAFD+L E+GP+C A  IW+H+DAAYAGSA IC E+R+L+ GIE+A SF FNPHKW+LVNFDCS  W K    ++  F +DPVYL++ ++  G   D+RHW I LGRRFRSLK+WFV R+YGV G+Q +IR H+ LAH F + +  DD+FEI   V +GLVCFRLKG+NE+NK L  +I    +IHIV       DT  LRFAVC +     H+++A+  I ++T ++
Sbjct:    1 MNASEFRKRGKDMVDYVADYLEQIESRQVFPDVEPGYLRPLIPDSAPEEGETYEEIIKDVERVIMPGVTHWHSPYFFAYFPTGSSYPALLADMLCGAIGCIGFSWASSPACTELETVMLDWLGKMIGLPEQFLAGNKGEGGGVIQGTASEATLMALLAARTKVTRRLQAENPKLTEAEIVSRMVAYSSDQAHSSVERAGLISGVRMKKIPSDENFVARGQALKKALEEDKAEGLIPIFFCATLGTTNSCAFDNLLELGPVCNAENIWMHIDAAYAGSAFICPEFRYLMKGIEFADSFNFNPHKWLLVNFDCSTFWVKKRSDLIGAFKMDPVYLQYDQQESGLVTDYRHWQIPLGRRFRSLKLWFVFRIYGVKGLQVHIRKHVGLAHEFLECVKKDDQFEICAPVILGLVCFRLKGSNELNKALLQKINNSKKIHIVPCCLG--DTFVLRFAVCARTVESSHIQFAWKHIKELTTEL 474          
BLAST of aadc vs. Ensembl Xenopus
Match: ddc (dopa decarboxylase [Source:NCBI gene;Acc:496742])

HSP 1 Score: 493.041 bits (1268), Expect = 8.478e-170
Identity = 252/479 (52.61%), Postives = 330/479 (68.89%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLS-ESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKRKM-RGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDF-----RHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQM 1676
            M+A EFRKRGK+M+D+VA+YLE I+  +VFP VEPGYL  +I    P + E ++ I+ DV  VIMPG+THWH P+F AYFP  +SY A+  D+L G IGCIGF+WASSPACTELE VM+DWL KM+ LP+ FL+   G GGGVI  T SEAT +ALLAAR K     + EN    +  I+S++V Y SDQAHSSVERAGL+S ++M+++ S +  + RG  L++ ++ED   G  P +  ATLGTT SCAFD+L E+GP+C A  IW+H+DAAYAGSA IC E+R+L+ GIE+A SF FNPHKW+LVNFDCS  W K    ++  F +DP+Y           F     +HW I LGRRFRSLK+WFV R+YGV G+Q +IR H+ LAH F + +  DD+FEI   V +GLVCFRLKG+NE+NK L  +I    +IHIV       DT  LRFAVC +     H+++A+  I ++T ++
Sbjct:    1 MNASEFRKRGKDMVDYVADYLEQIESRQVFPDVEPGYLRPLIPDSAPEEGETYEEIIKDVERVIMPGVTHWHSPYFFAYFPTGSSYPALLADMLCGAIGCIGFSWASSPACTELETVMLDWLGKMIGLPEQFLAGNKGEGGGVIQGTASEATLMALLAARTKVTRRLQAENPKLTEAEIVSRMVAYSSDQAHSSVERAGLISGVRMKKIPSDENFVARGQALKKALEEDKAEGLIPIFFCATLGTTNSCAFDNLLELGPVCNAENIWMHIDAAYAGSAFICPEFRYLMKGIEFADSFNFNPHKWLLVNFDCSTFWVKKRSDLIGAFKMDPLYYMVCTSYSSLFFIFFNCQHWQIPLGRRFRSLKLWFVFRIYGVKGLQVHIRKHVGLAHEFLECVKKDDQFEICAPVILGLVCFRLKGSNELNKALLQKINNSKKIHIVPCCLG--DTFVLRFAVCARTVESSHIQFAWKHIKELTTEL 477          
BLAST of aadc vs. Ensembl Xenopus
Match: ddc (dopa decarboxylase [Source:NCBI gene;Acc:496742])

HSP 1 Score: 464.922 bits (1195), Expect = 2.529e-159
Identity = 233/476 (48.95%), Postives = 308/476 (64.71%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLS-ESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKRKM-RGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKE--GKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQM 1676
            M+A EFRKRGK+M+D+VA+YLE I+  +VFP VEPGYL  +I    P + E ++ I+ DV  VIMPG                                      ASSPACTELE VM+DWL KM+ LP+ FL+   G GGGVI  T SEAT +ALLAAR K     + EN    +  I+S++V Y SDQAHSSVERAGL+S ++M+++ S +  + RG  L++ ++ED   G  P +  ATLGTT SCAFD+L E+GP+C A  IW+H+DAAYAGSA IC E+R+L+ GIE+A SF FNPHKW+LVNFDCS  W K    ++  F +DPVYL++ ++  G   D+RHW I LGRRFRSLK+WFV R+YGV G+Q +IR H+ LAH F + +  DD+FEI   V +GLVCFRLKG+NE+NK L  +I    +IHIV       DT  LRFAVC +     H+++A+  I ++T ++
Sbjct:    1 MNASEFRKRGKDMVDYVADYLEQIESRQVFPDVEPGYLRPLIPDSAPEEGETYEEIIKDVERVIMPG--------------------------------------ASSPACTELETVMLDWLGKMIGLPEQFLAGNKGEGGGVIQGTASEATLMALLAARTKVTRRLQAENPKLTEAEIVSRMVAYSSDQAHSSVERAGLISGVRMKKIPSDENFVARGQALKKALEEDKAEGLIPIFFCATLGTTNSCAFDNLLELGPVCNAENIWMHIDAAYAGSAFICPEFRYLMKGIEFADSFNFNPHKWLLVNFDCSTFWVKKRSDLIGAFKMDPVYLQYDQQESGLVTDYRHWQIPLGRRFRSLKLWFVFRIYGVKGLQVHIRKHVGLAHEFLECVKKDDQFEICAPVILGLVCFRLKGSNELNKALLQKINNSKKIHIVPCCLG--DTFVLRFAVCARTVESSHIQFAWKHIKELTTEL 436          
BLAST of aadc vs. Ensembl Mouse
Match: Ddc (dopa decarboxylase [Source:MGI Symbol;Acc:MGI:94876])

HSP 1 Score: 515.383 bits (1326), Expect = 1.001e-178
Identity = 265/476 (55.67%), Postives = 338/476 (71.01%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLS-ESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKR-KMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKE--GKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQM 1676
            MD+ EFR+RGKEM+D++A+YL+ I+   V+P VEPGYL  +I A  P +PE +++I+ D+  +IMPG+THWH P+F AYFP A+SY AM  D+L G IGCIGF+WA+SPACTELE VMMDWL KML+LP+ FL+  +G GGGVI  + SEAT VALLAAR K I   +  + +  Q  IM KLV Y SDQAHSSVERAGL+  IK++ V S     MR S L+E ++ D   G  PF+ VATLGTT  C+FD+L E+GPIC    +WLH+DAAYAGSA IC E+R+LL+G+E+A SF FNPHKW+LVNFDCSA+W K    +   F +DPVYLKH  +  G   D+RHW I LGRRFRSLK+WFV R+YGV G+Q YIR H++L+H FE L+  D RFEI  EV +GLVCFRLKG+NE+N+ L  RI    +IH+V       D   LRFAVC +     HV+ A+  I D+ + +
Sbjct:    1 MDSREFRRRGKEMVDYIADYLDGIEGRPVYPDVEPGYLRPLIPATAPQEPETYEDIIKDIEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPEAFLAGRAGEGGGVIQGSASEATLVALLAARTKVIRQLQAASPEFTQAAIMEKLVAYTSDQAHSSVERAGLIGGIKLKAVPSDGNFSMRASALREALERDKAAGLIPFFVVATLGTTSCCSFDNLLEVGPICNQEGVWLHIDAAYAGSAFICPEFRYLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKRRTDLTGAFNMDPVYLKHSHQDSGFITDYRHWQIPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVELSHEFESLVRQDPRFEICTEVILGLVCFRLKGSNELNETLLQRINSAKKIHLVPCRLR--DKFVLRFAVCARTVESAHVQLAWEHISDLASSV 474          
BLAST of aadc vs. Ensembl Mouse
Match: Ddc (dopa decarboxylase [Source:MGI Symbol;Acc:MGI:94876])

HSP 1 Score: 515.383 bits (1326), Expect = 1.001e-178
Identity = 265/476 (55.67%), Postives = 338/476 (71.01%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLS-ESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKR-KMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKE--GKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQM 1676
            MD+ EFR+RGKEM+D++A+YL+ I+   V+P VEPGYL  +I A  P +PE +++I+ D+  +IMPG+THWH P+F AYFP A+SY AM  D+L G IGCIGF+WA+SPACTELE VMMDWL KML+LP+ FL+  +G GGGVI  + SEAT VALLAAR K I   +  + +  Q  IM KLV Y SDQAHSSVERAGL+  IK++ V S     MR S L+E ++ D   G  PF+ VATLGTT  C+FD+L E+GPIC    +WLH+DAAYAGSA IC E+R+LL+G+E+A SF FNPHKW+LVNFDCSA+W K    +   F +DPVYLKH  +  G   D+RHW I LGRRFRSLK+WFV R+YGV G+Q YIR H++L+H FE L+  D RFEI  EV +GLVCFRLKG+NE+N+ L  RI    +IH+V       D   LRFAVC +     HV+ A+  I D+ + +
Sbjct:    1 MDSREFRRRGKEMVDYIADYLDGIEGRPVYPDVEPGYLRPLIPATAPQEPETYEDIIKDIEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPEAFLAGRAGEGGGVIQGSASEATLVALLAARTKVIRQLQAASPEFTQAAIMEKLVAYTSDQAHSSVERAGLIGGIKLKAVPSDGNFSMRASALREALERDKAAGLIPFFVVATLGTTSCCSFDNLLEVGPICNQEGVWLHIDAAYAGSAFICPEFRYLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKRRTDLTGAFNMDPVYLKHSHQDSGFITDYRHWQIPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVELSHEFESLVRQDPRFEICTEVILGLVCFRLKGSNELNETLLQRINSAKKIHLVPCRLR--DKFVLRFAVCARTVESAHVQLAWEHISDLASSV 474          
BLAST of aadc vs. Ensembl Mouse
Match: Ddc (dopa decarboxylase [Source:MGI Symbol;Acc:MGI:94876])

HSP 1 Score: 515.383 bits (1326), Expect = 1.001e-178
Identity = 265/476 (55.67%), Postives = 338/476 (71.01%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLS-ESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKR-KMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKE--GKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQM 1676
            MD+ EFR+RGKEM+D++A+YL+ I+   V+P VEPGYL  +I A  P +PE +++I+ D+  +IMPG+THWH P+F AYFP A+SY AM  D+L G IGCIGF+WA+SPACTELE VMMDWL KML+LP+ FL+  +G GGGVI  + SEAT VALLAAR K I   +  + +  Q  IM KLV Y SDQAHSSVERAGL+  IK++ V S     MR S L+E ++ D   G  PF+ VATLGTT  C+FD+L E+GPIC    +WLH+DAAYAGSA IC E+R+LL+G+E+A SF FNPHKW+LVNFDCSA+W K    +   F +DPVYLKH  +  G   D+RHW I LGRRFRSLK+WFV R+YGV G+Q YIR H++L+H FE L+  D RFEI  EV +GLVCFRLKG+NE+N+ L  RI    +IH+V       D   LRFAVC +     HV+ A+  I D+ + +
Sbjct:    1 MDSREFRRRGKEMVDYIADYLDGIEGRPVYPDVEPGYLRPLIPATAPQEPETYEDIIKDIEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPEAFLAGRAGEGGGVIQGSASEATLVALLAARTKVIRQLQAASPEFTQAAIMEKLVAYTSDQAHSSVERAGLIGGIKLKAVPSDGNFSMRASALREALERDKAAGLIPFFVVATLGTTSCCSFDNLLEVGPICNQEGVWLHIDAAYAGSAFICPEFRYLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKRRTDLTGAFNMDPVYLKHSHQDSGFITDYRHWQIPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVELSHEFESLVRQDPRFEICTEVILGLVCFRLKGSNELNETLLQRINSAKKIHLVPCRLR--DKFVLRFAVCARTVESAHVQLAWEHISDLASSV 474          
BLAST of aadc vs. Ensembl Mouse
Match: Hdc (histidine decarboxylase [Source:MGI Symbol;Acc:MGI:96062])

HSP 1 Score: 449.899 bits (1156), Expect = 1.614e-150
Identity = 222/465 (47.74%), Postives = 310/465 (66.67%), Query Frame = 3
Query:  285 RGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLS--ESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKR-KMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITN 1670
            RGKEM+D+++ YL  + E +V P+V+PGYL   + A  P +P+ WD+I  D+  VIMPG+ HW  PH HAY+PA  S+ ++ GD+L+  I C+GFTWASSPACTELE+ +MDWLAKML LP+ FL    S  GGGV+ +T SE+T +ALLAAR   I   +    D ++ ++ ++LV Y SDQAHSSVE+AGL+S++K+R +       +RG  LQ+ I+ED + G  P +  ATLGTTG CAFD L E+GPIC +  +WLHVDAAYAG+A +C E R  L+GIEYA SF FNP KWM+V+FDC+  W KD   + +TF+V+P+YL+H   G   DF HW I L RRFRS+K+WFV+R +GV  +Q ++R+  ++A  FE L+  D  FEI  +  +GLV FRLKG N + + +   I   G++ ++ +     D L +RF V  QF T++ +   +  I +  N
Sbjct:   17 RGKEMVDYISQYLSTVRERQVTPNVQPGYLRAQLPASAPEEPDSWDSIFGDIERVIMPGVVHWQSPHMHAYYPALTSWPSLLGDMLADAINCLGFTWASSPACTELEMNIMDWLAKMLGLPEYFLHHHPSSRGGGVLQSTVSESTLIALLAARKNKILAMKACEPDANESSLNARLVAYTSDQAHSSVEKAGLISLVKIRFLPVDDNFSLRGEALQKAIEEDKQQGLVPVFVCATLGTTGVCAFDRLSELGPICASEGLWLHVDAAYAGTAFLCPELRGFLEGIEYADSFTFNPSKWMMVHFDCTGFWVKDKYKLQQTFSVNPIYLRHANSGAATDFMHWQIPLSRRFRSIKLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRSDPSFEIPAKRHLGLVVFRLKGPNCLTESVLKEIAKAGQLFLIPATIQ--DKLIIRFTVTSQFTTKEDILRDWHLIQEAAN 479          
BLAST of aadc vs. Ensembl Mouse
Match: Ddc (dopa decarboxylase [Source:MGI Symbol;Acc:MGI:94876])

HSP 1 Score: 257.299 bits (656), Expect = 2.225e-81
Identity = 143/253 (56.52%), Postives = 183/253 (72.33%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLS-ESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKR-KMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDS 1013
            MD+ EFR+RGKEM+D++A+YL+ I+   V+P VEPGYL  +I A  P +PE +++I+ D+  +IMPG+THWH P+F AYFP A+SY AM  D+L G IGCIGF+WA+SPACTELE VMMDWL KML+LP+ FL+  +G GGGVI  + SEAT VALLAAR K I   +  + +  Q  IM KLV Y SDQAHSSVERAGL+  IK++ V S     MR S L+E ++ D   G  PF+ VATLGTT  C+FD+
Sbjct:    1 MDSREFRRRGKEMVDYIADYLDGIEGRPVYPDVEPGYLRPLIPATAPQEPETYEDIIKDIEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPEAFLAGRAGEGGGVIQGSASEATLVALLAARTKVIRQLQAASPEFTQAAIMEKLVAYTSDQAHSSVERAGLIGGIKLKAVPSDGNFSMRASALREALERDKAAGLIPFFVVATLGTTSCCSFDN 253          
BLAST of aadc vs. UniProt/SwissProt
Match: sp|P05031|DDC_DROME (Aromatic-L-amino-acid decarboxylase OS=Drosophila melanogaster OX=7227 GN=Ddc PE=1 SV=4)

HSP 1 Score: 548.51 bits (1412), Expect = 0.000e+0
Identity = 277/502 (55.18%), Postives = 352/502 (70.12%), Query Frame = 3
Query:  189 NVFDNKESLRKSGRKISHDVYTPK----MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSESGTGGG-VIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQMD 1679
            N    K++       IS D   PK    M+A EF+   K M+DF+A YLENI E +V P V+PGYL  +I    P KPE+W ++M D+  VIMPG+THWH P FHAYFP ANSY A+  D+LSG I CIGFTW +SPACTELEVVMMDWL KML+LP +FL+ SG  GG VI  T SE+T VALL A+ K ++  ++ + + D++TI+ KLVGY SDQAHSSVERAGLL  +K+R V+S   +MRG+ L++ I++D+  G  PFY V TLGTT SCAFD LDE GP+   H +W+HVDAAYAGSA IC EYRHL+ GIE A SF FNPHKWMLVNFDCSA+W KD  +VV  F VDP+YLKH  +G  PD+RHW I LGRRFR+LK+WFVLRLYGV+ +Q +IR H   A  F  L + D RFE+  E+ MGLVCFRLKG+NE N+ L  RI G G IH+V ++    D  +LR A+C +F   + ++Y++  +    ++M+
Sbjct:    8 NTIPTKQTDGNGKANISPDKLDPKVSIDMEAPEFKDFAKTMVDFIAEYLENIRERRVLPEVKPGYLKPLIPDAAPEKPEKWQDVMQDIERVIMPGVTHWHSPKFHAYFPTANSYPAIVADMLSGAIACIGFTWIASPACTELEVVMMDWLGKMLELPAEFLACSGGKGGGVIQGTASESTLVALLGAKAKKLKEVKELHPEWDEHTILGKLVGYCSDQAHSSVERAGLLGGVKLRSVQSENHRMRGAALEKAIEQDVAEGLIPFYAVVTLGTTNSCAFDYLDECGPVGNKHNLWIHVDAAYAGSAFICPEYRHLMKGIESADSFNFNPHKWMLVNFDCSAMWLKDPSWVVNAFNVDPLYLKHDMQGSAPDYRHWQIPLGRRFRALKLWFVLRLYGVENLQAHIRRHCNFAKQFGDLCVADSRFELAAEINMGLVCFRLKGSNERNEALLKRINGRGHIHLVPAKIK--DVYFLRMAICSRFTQSEDMEYSWKEVSAAADEME 507          
BLAST of aadc vs. UniProt/SwissProt
Match: sp|O96567|DDC_DROSI (Aromatic-L-amino-acid decarboxylase OS=Drosophila simulans OX=7240 GN=Ddc PE=3 SV=2)

HSP 1 Score: 546.199 bits (1406), Expect = 0.000e+0
Identity = 277/502 (55.18%), Postives = 351/502 (69.92%), Query Frame = 3
Query:  189 NVFDNKESLRKSGRKISHDVYTPK----MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSESGTGGG-VIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQMD 1679
            N    K++       IS D   PK    M+A EF+   K M+DF+A YLENI + +V P V+PGYL  +I    P KPE+W ++M D+  VIMPG+THWH P FHAYFP ANSY A+  D+LSG I CIGFTW +SPACTELEVVMMDWL KML+LP +FL  SG  GG VI  T SE+T VALL A+ K ++  ++ + + D++TI+ KLVGY SDQAHSSVERAGLL  +K+R V+S   +MRG+ L++ I++DL  G  PFY V TLGTT SCAFD LDE GP+   H +W+HVDAAYAGSA IC EYRHL+ GIE A SF FNPHKWMLVNFDCSA+W KD  +VV  F VDP+YLKH  +G  PD+RHW I LGRRFR+LK+WFVLRLYGV+ +Q +IR H   A  F  L + D RFE+  E+ MGLVCFRLKG+NE N+ L  RI G G IH+V ++    D  +LR A+C +F   + ++Y++  +    ++M+
Sbjct:    8 NTIPPKQTDGNGKANISPDKLDPKVSIDMEAPEFKDFAKTMVDFIAEYLENIRDRRVLPEVKPGYLKPLIPDAAPEKPEKWQDVMQDIERVIMPGVTHWHSPKFHAYFPTANSYPAIVADMLSGAIACIGFTWIASPACTELEVVMMDWLGKMLELPAEFLVCSGGKGGGVIQGTASESTLVALLGAKAKKLKEVKELHPEWDEHTILGKLVGYCSDQAHSSVERAGLLGGVKLRSVQSENHRMRGAALEKAIEQDLAEGLIPFYAVVTLGTTNSCAFDYLDECGPVGNKHNLWIHVDAAYAGSAFICPEYRHLMKGIESADSFNFNPHKWMLVNFDCSAMWLKDPSWVVNAFNVDPLYLKHDMQGSAPDYRHWQIPLGRRFRALKLWFVLRLYGVENLQAHIRRHCNFAKQFGDLCVADSRFELAAEINMGLVCFRLKGSNERNEALLKRINGRGHIHLVPAKIK--DVYFLRMAICSRFTQSEDMEYSWKEVSAAADEME 507          
BLAST of aadc vs. UniProt/SwissProt
Match: sp|P48861|DDC_MANSE (Aromatic-L-amino-acid decarboxylase OS=Manduca sexta OX=7130 GN=Ddc PE=2 SV=1)

HSP 1 Score: 543.117 bits (1398), Expect = 0.000e+0
Identity = 270/469 (57.57%), Postives = 342/469 (72.92%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSESGTGGG-VIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKS-IKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIID 1661
            M+  +F+   K M D++  YLENI + +V P V+PGYL  ++    P + E W  +M D+  V+M G+THW  P FHAYFP ANSY ++  D+LSG I CIGFTW +SPACTELEVVM+DWL +ML LP  FL+ SG  GG VI  T SEATFVALL A+++ +   ++++ +  +  I+ KLVGY + QAHSSVERAGLL  +K+R +K   KR++RG  L+E I ED+ NG  PFY VATLGTT SCAFD+LDEIG +C A  IWLHVDAAYAGSA IC EYRH + G+E A SF FNPHKWMLVNFDCSA+W K  R++V+ F VDP+YLKH+++G  PD+RHW I LGRRFRSLK+WFVLRLYGV+ +QKYIR  I  AHLFE+L+  D+RFE+ EEVTMGLVCFRLKG+NEIN+EL  RI G G+IH+V S+    D  +LR A+C +F  E  +  ++  I D
Sbjct:    1 MNPGDFKDFAKAMTDYITEYLENIRDRQVVPSVKPGYLRPLVPEQAPQQAEPWTAVMADIERVVMSGVTHWQSPRFHAYFPTANSYPSIVADMLSGAIACIGFTWIASPACTELEVVMLDWLGQMLGLPDQFLARSGGEGGGVIQGTASEATFVALLGAKSRMMHRVKEQHPEWTETDILGKLVGYCNQQAHSSVERAGLLGGVKLRSLKPDSKRRLRGDTLREAIDEDIRNGLIPFYVVATLGTTSSCAFDALDEIGDVCNASDIWLHVDAAYAGSAFICPEYRHFMKGVEKADSFNFNPHKWMLVNFDCSAMWLKQPRWIVDAFNVDPLYLKHEQQGSAPDYRHWQIPLGRRFRSLKLWFVLRLYGVENLQKYIRKQIGFAHLFERLLTSDERFELFEEVTMGLVCFRLKGSNEINEELLRRINGRGKIHLVPSKVD--DVYFLRLAICSRFTEESDMHVSWEEIKD 467          
BLAST of aadc vs. UniProt/SwissProt
Match: sp|P20711|DDC_HUMAN (Aromatic-L-amino-acid decarboxylase OS=Homo sapiens OX=9606 GN=DDC PE=1 SV=2)

HSP 1 Score: 531.176 bits (1367), Expect = 0.000e+0
Identity = 267/473 (56.45%), Postives = 338/473 (71.46%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSE-SGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKR-KMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKE--GKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDIT 1667
            M+A EFR+RGKEM+D++ANY+E I+  +V+P VEPGYL  +I A  P +P+ +++I+NDV  +IMPG+THWH P+F AYFP A+SY AM  D+L G IGCIGF+WA+SPACTELE VMMDWL KML+LPK FL+E +G GGGVI  + SEAT VALLAAR K I   +  + +  Q  IM KLV Y SDQAHSSVERAGL+  +K++ + S     MR S LQE ++ D   G  PF+ VATLGTT  C+FD+L E+GPIC    IWLHVDAAYAGSA IC E+RHLL+G+E+A SF FNPHKW+LVNFDCSA+W K    +   F +DP YLKH  +  G   D+RHW I LGRRFRSLK+WFV R+YGV G+Q YIR H++L+H FE L+  D RFEI  EV +GLVCFRLKG+N++N+ L  RI    +IH+V       D   LRFA+C +     HV+ A+  I ++ 
Sbjct:    1 MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDVEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIMEKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFMVATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQIPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVNEALLQRINSAKKIHLVPCHLR--DKFVLRFAICSRTVESAHVQRAWEHIKELA 471          
BLAST of aadc vs. UniProt/SwissProt
Match: sp|P22781|DDC_CAVPO (Aromatic-L-amino-acid decarboxylase OS=Cavia porcellus OX=10141 GN=DDC PE=2 SV=1)

HSP 1 Score: 530.02 bits (1364), Expect = 0.000e+0
Identity = 262/476 (55.04%), Postives = 338/476 (71.01%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLS-ESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKR-KMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLK--HKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQM 1676
            M+A EFR+RGKEM+D+VANYLE I+   V+P VEPGYL  +I +  P +PE +++I+ D+  +IMPG+THW+ P+F AYFP ANSY +M  D+L G I CIGF+WA+SPACTELE VM+DWL KML+LP  FL+  +G GGGVI  + SEAT VALLAAR K I   +  + +  Q  IM KLV Y SDQAHSSVERAGL+  ++M+ + S     MR S L+E ++ D   G  PF+ VATLGTT  C+FDSL E+GPIC   ++WLH+DAAYAGSA IC E+RHLLDG+E+A SF FNPHKW+LVNFDCSA+W K    ++  F +DPVYLK  H+  G   D+RHW I LGRRFRSLK+WFV R+YG+ G+Q +IR H++LAH FE L+  D RFEI  EVT+GLVCFRLKG+N++N+ L  RI    +IH+V       D   LRF +C +    DHV+ A+  I  + + +
Sbjct:    1 MNASEFRRRGKEMVDYVANYLEGIESRLVYPDVEPGYLRPLIPSSAPEEPETYEDIIGDIERIIMPGVTHWNSPYFFAYFPTANSYPSMLADMLCGAISCIGFSWAASPACTELETVMLDWLGKMLRLPDAFLAGNAGMGGGVIQGSASEATLVALLAARTKVIRRLQAASPELTQAAIMEKLVAYASDQAHSSVERAGLIGGVRMKLIPSDSNFAMRASALREALERDKAAGLIPFFVVATLGTTNCCSFDSLLEVGPICNQEEMWLHIDAAYAGSAFICPEFRHLLDGVEFADSFNFNPHKWLLVNFDCSAMWVKQRTDLIGAFKLDPVYLKHGHQDSGLITDYRHWQIPLGRRFRSLKMWFVFRMYGIKGLQAHIRKHVQLAHEFESLVRQDPRFEICMEVTLGLVCFRLKGSNQLNETLLKRINSARKIHLVPCHLR--DKFVLRFRICSRQVESDHVQQAWQHIRQLASSV 474          
BLAST of aadc vs. TrEMBL
Match: S5VQ16 (Aadc OS=Schmidtea mediterranea OX=79327 GN=aadcb PE=2 SV=1)

HSP 1 Score: 1022.31 bits (2642), Expect = 0.000e+0
Identity = 506/507 (99.80%), Postives = 506/507 (99.80%), Query Frame = 3
Query:  186 MNVFDNKESLRKSGRKISHDVYTPKMDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQMDLCSDLFLEK 1706
            MNVFDNKESLRKSGRKISHDVYTPKMDAEEFRKRGKEMIDFVANYLENIDELKVFP VEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITHWHHPHFHAYFPAANSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQMDLCSDLFLEK
Sbjct:    1 MNVFDNKESLRKSGRKISHDVYTPKMDAEEFRKRGKEMIDFVANYLENIDELKVFPQVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITHWHHPHFHAYFPAANSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQMDLCSDLFLEK 507          
BLAST of aadc vs. TrEMBL
Match: A6P658 (Aromatic amino acid decarboxylase OS=Dugesia japonica OX=6161 GN=DjAADCB PE=2 SV=1)

HSP 1 Score: 760.755 bits (1963), Expect = 0.000e+0
Identity = 365/475 (76.84%), Postives = 414/475 (87.16%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQMDLC 1685
            MD EEFRKRGKEMIDFVANYL+NI++LKVFP +EPGYLHKMI  D P  PE+W++IMNDVN++IMPGITHW HPHF+AYFP  NS  ++CGDILSGGIGC+GF+W +SPACTELEV+MMDWLAKML+LP +FLSESG GGGVIYN+C EAT VAL AARNK I+ + KEN  E+Q+ +MSKLVGYYSDQAHS+VERAGLLSMIKMR VKSIKRKMR SVL+EMI+ED+ NG YPFYCVATLGTTGSCAFD+L+EIGPIC+ + IWLHVDAAYAGSA+IC EYRHLL+GIE+AMSFVFNPHKWMLVN DC AVWFKDSRFVV+ F V P YL ++ E K PDFRHW IQ  RRFRSLKIWFVLRLYGV GIQKYIRNHI+L HLFE+L+  DDRFEIVEEVTMGLVCFRLKG NE    LY RIE DGRI+++TS F DTD +YLRF VCYQFATEDH+K+AY TII ITN+M+LC
Sbjct:  158 MDVEEFRKRGKEMIDFVANYLDNIEDLKVFPQIEPGYLHKMIPTDAPKNPEDWNSIMNDVNNIIMPGITHWRHPHFYAYFPTVNSNTSLCGDILSGGIGCVGFSWETSPACTELEVMMMDWLAKMLKLPNEFLSESGIGGGVIYNSCGEATLVALFAARNKTIDEKCKENPKENQFIVMSKLVGYYSDQAHSTVERAGLLSMIKMRPVKSIKRKMRDSVLEEMIQEDIANGCYPFYCVATLGTTGSCAFDNLEEIGPICKKYNIWLHVDAAYAGSAMICPEYRHLLNGIEFAMSFVFNPHKWMLVNLDCCAVWFKDSRFVVDAFAVFPPYLGNQHENKYPDFRHWGIQFSRRFRSLKIWFVLRLYGVKGIQKYIRNHIELGHLFERLISRDDRFEIVEEVTMGLVCFRLKGKNENTNNLYKRIEADGRIYMITSVFCDTDIVYLRFIVCYQFATEDHIKFAYDTIIHITNEMNLC 632          
BLAST of aadc vs. TrEMBL
Match: A0A4S2LK43 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008313 PE=3 SV=1)

HSP 1 Score: 585.874 bits (1509), Expect = 0.000e+0
Identity = 291/505 (57.62%), Postives = 374/505 (74.06%), Query Frame = 3
Query:  171 HLK-FQMNVFDNKESLRKSGRKISHDVYTPKMDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKS-IKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLY-LRFAVCYQFATEDHVKYAYGTIIDITNQM 1676
            HL+   +NV   +    +  +   H +  PK    EFR++G  M++++ +YLEN D+L+VFP VEPGYL  +I  + P + E W  IM DV  VIMPGITHW HP FHAYFP+ +S  +MC DIL+ G  CIGFTWASSPA TELE+VMMDWLAK+LQLP+ FLS    GG VI  +CSEAT V+L  ARN+AI   +KE+     Y   SKLVGYYSDQAH SVER+GL+SM+++R +++ + R++  S L+  IKED+ NGF PF+CVA LGTTG CAFD++ EIGPICE + IWLHVDAAYAGS  IC E+R LLDGIEYAMSFVFNPHKW+L NFDCS VWFK + ++V++F V+P YL++K EG+ PD RHW I  GR+FRSLK+WFV+R +GV G+Q+YIRNHI LAH FE+LML D RFEIV +VTMGLVCFR+K +NE+ ++LY  IE DGRIH+  SEF   + +Y +RFAVC+  A E H+ YA+  + ++T+Q+
Sbjct:   15 HLRDISVNVKATQNGRCEDPKSEMHSLLAPK----EFREQGCRMVNYIVDYLENADKLRVFPTVEPGYLASLIPKEAPEETEPWSKIMEDVERVIMPGITHWQHPRFHAYFPSGSSCPSMCADILTNGFACIGFTWASSPAYTELEIVMMDWLAKLLQLPEYFLSGGDGGG-VIQGSCSEATLVSLCGARNRAINRYQKEHPGATVYEAASKLVGYYSDQAHCSVERSGLISMLRLRPIRTTVSRQLNASDLEASIKEDVSNGFVPFFCVAALGTTGCCAFDNMKEIGPICEKYDIWLHVDAAYAGSVFICPEFRPLLDGIEYAMSFVFNPHKWLLTNFDCSCVWFKKTEWIVKSFCVNPTYLRYKDEGRMPDLRHWQIPFGRKFRSLKLWFVMRRFGVHGLQQYIRNHIDLAHKFERLMLSDQRFEIVHKVTMGLVCFRIKEDNELTRKLYHDIEADGRIHLTPSEFHHPEEVYFIRFAVCHPVAEEAHINYAFQVVQEMTDQL 514          
BLAST of aadc vs. TrEMBL
Match: A0A4V3SDJ2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008313 PE=3 SV=1)

HSP 1 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 287/481 (59.67%), Postives = 365/481 (75.88%), Query Frame = 3
Query:  240 HDVYTPKMDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKS-IKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLY-LRFAVCYQFATEDHVKYAYGTIIDITNQM 1676
            H +  PK    EFR++G  M++++ +YLEN D+L+VFP VEPGYL  +I  + P + E W  IM DV  VIMPGITHW HP FHAYFP+ +S  +MC DIL+ G  CIGFTWASSPA TELE+VMMDWLAK+LQLP+ FLS    GG VI  +CSEAT V+L  ARN+AI   +KE+     Y   SKLVGYYSDQAH SVER+GL+SM+++R +++ + R++  S L+  IKED+ NGF PF+CVA LGTTG CAFD++ EIGPICE + IWLHVDAAYAGS  IC E+R LLDGIEYAMSFVFNPHKW+L NFDCS VWFK + ++V++F V+P YL++K EG+ PD RHW I  GR+FRSLK+WFV+R +GV G+Q+YIRNHI LAH FE+LML D RFEIV +VTMGLVCFR+K +NE+ ++LY  IE DGRIH+  SEF   + +Y +RFAVC+  A E H+ YA+  + ++T+Q+
Sbjct:    2 HSLLAPK----EFREQGCRMVNYIVDYLENADKLRVFPTVEPGYLASLIPKEAPEETEPWSKIMEDVERVIMPGITHWQHPRFHAYFPSGSSCPSMCADILTNGFACIGFTWASSPAYTELEIVMMDWLAKLLQLPEYFLSGGDGGG-VIQGSCSEATLVSLCGARNRAINRYQKEHPGATVYEAASKLVGYYSDQAHCSVERSGLISMLRLRPIRTTVSRQLNASDLEASIKEDVSNGFVPFFCVAALGTTGCCAFDNMKEIGPICEKYDIWLHVDAAYAGSVFICPEFRPLLDGIEYAMSFVFNPHKWLLTNFDCSCVWFKKTEWIVKSFCVNPTYLRYKDEGRMPDLRHWQIPFGRKFRSLKLWFVMRRFGVHGLQQYIRNHIDLAHKFERLMLSDQRFEIVHKVTMGLVCFRIKEDNELTRKLYHDIEADGRIHLTPSEFHHPEEVYFIRFAVCHPVAEEAHINYAFQVVQEMTDQL 477          
BLAST of aadc vs. TrEMBL
Match: G4LVM4 (Aromatic-L-amino-acid decarboxylase,putative OS=Schistosoma mansoni OX=6183 GN=Smp_171580 PE=3 SV=1)

HSP 1 Score: 580.096 bits (1494), Expect = 0.000e+0
Identity = 285/484 (58.88%), Postives = 365/484 (75.41%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKR-KMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLY-LRFAVCYQFATEDHVKYAYGTIIDITNQMDLCSDLFLEK 1706
            ++  EFR+ G +MI +VA+YLENIDE +VFP V PGYL K++  + P +PE W+ IMNDV ++IMPG+THW HPHFHAYFP   SY ++C DIL+ GI  IGFTW S+PACTELE+VM+DW+AK+L LP+ FL    +GG VI  +CSE+T VALLAARNKAI   +  + +   Y  +SKLVGYYSDQAHSSVERAGL+ M+ +R +KS +R +M  S+L++ I++D+ NG +PF+C ATLGTT +C FD L +IGPIC+ + IWLH+DAAYAGS+ IC EYR+L+DGIEYAMSFVFNPHKW+L+NFDCS VW+++  +V  +F VDP YLKHK +    DFRH  I LGR+FRSLK+WF LR YGV  +Q YIRNHI+LAH FE+L+  DDRFEIV EV MGLVCFR+K NNE+ KELY  IE DGRIH+V+SE      LY +RFA+CY    + H+ YAY  I ++  ++ L S+L   K
Sbjct:   29 LNHNEFRQYGTKMIQYVADYLENIDERRVFPEVHPGYLAKLLPNEAPNEPESWEEIMNDVENMIMPGVTHWQHPHFHAYFPCGCSYTSICADILADGISSIGFTWVSNPACTELELVMIDWMAKILSLPEHFLFGENSGG-VIQGSCSESTLVALLAARNKAIRQYQSIHPNASTYEALSKLVGYYSDQAHSSVERAGLIGMLHLRAIKSNERYEMNTSILKQTIEDDVNNGLFPFFCCATLGTTSTCGFDKLKDIGPICDKYNIWLHIDAAYAGSSFICPEYRYLMDGIEYAMSFVFNPHKWLLINFDCSIVWYREVNWVKNSFHVDPPYLKHKHQQTTIDFRHMQIPLGRKFRSLKLWFTLRRYGVKNLQAYIRNHIELAHYFEELIRADDRFEIVAEVLMGLVCFRIKDNNELTKELYHNIEADGRIHLVSSELHLPKPLYFIRFAICYHSPNKHHIDYAYYVISELCKKLLLQSNLIKNK 511          
BLAST of aadc vs. Ensembl Cavefish
Match: ddc (dopa decarboxylase [Source:ZFIN;Acc:ZDB-GENE-040426-2656])

HSP 1 Score: 471.47 bits (1212), Expect = 3.528e-162
Identity = 239/476 (50.21%), Postives = 324/476 (68.07%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSES-GTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKS-IKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLK--HKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQM 1676
            MD  EFR+RGKEM+D+VA+YLENI+  +V+P V+PGYL  +I  D P +PE +++++ D+  VIMPG+THWH P+F AYFP ANS+ A+  D+LSG IGCIGF+WA+SPACTELE VM+DWL KML+LP++FL+ + G GGGVI  T SEAT VALLAAR++ ++    ++ ++ +  I+S+LV Y SDQAHSSVERA L+  +KM+++ +  K  +RG   Q++++ED   G  PFY  ATLGTT SCAFD + EIGPIC A Q+WLH+DAAYAGSA IC E+R LLDG+E+A SF FNPHKWMLVNFDCS +W K+   ++  F +DP+YLK  H++ G   D+RHW I LGRRFRSLK+WFV R+YG+ G+Q++IR                                  KG+NE+N+ L  +I     IH+V  + +      LRFAVC +     HV+ A+  I  +  ++
Sbjct:    1 MDTAEFRRRGKEMVDYVADYLENIESRQVYPDVQPGYLRTLIPEDAPQEPETYEDVVKDIERVIMPGVTHWHSPYFFAYFPTANSFPALLADMLSGAIGCIGFSWAASPACTELETVMLDWLGKMLKLPEEFLAGTEGKGGGVIQGTASEATLVALLAARSRILKRILNDDPEKQEANIISRLVAYSSDQAHSSVERAALIGGVKMKKIPTDCKFAVRGEAFQKILEEDKAAGLIPFYFCATLGTTPSCAFDRITEIGPICNAEQLWLHIDAAYAGSAFICPEFRPLLDGVEFADSFNFNPHKWMLVNFDCSTMWVKNRSDIIGAFKMDPLYLKHDHQESGLVTDYRHWQIPLGRRFRSLKMWFVFRMYGLRGLQEHIR----------------------------------KGSNELNEALLKKINSARTIHLVPCQLA--GRFVLRFAVCSRTTESRHVQEAWAHISKLATEL 440          
BLAST of aadc vs. Ensembl Cavefish
Match: ddc (dopa decarboxylase [Source:ZFIN;Acc:ZDB-GENE-040426-2656])

HSP 1 Score: 465.692 bits (1197), Expect = 9.415e-160
Identity = 237/475 (49.89%), Postives = 324/475 (68.21%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSES-GTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKS-IKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCF-RLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQM 1676
            MD  EFR+RGKEM+D+VA+YLENI+  +V+P V+PGYL  +I  D P +PE +++++ D+  VIMPG+THWH P+F AYFP ANS+ A+  D+LSG IGCIGF+WA+SPACTELE VM+DWL KML+LP++FL+ + G GGGVI  T SEAT VALLAAR++ ++    ++ ++ +  I+S+LV Y SDQAHSSVERA L+  +KM+++ +  K  +RG   Q++++ED   G  PFY  ATLGTT SCAFD + EIGPIC A Q+WLH+DAAYAGSA IC E+R LLDG+E+A SF FNPHKWMLVNFDCS +W K+   ++  F +DP+YLKH  +       HW I LGRRFRSLK+WFV R+YG+ G+Q++IR                       +V + L+     +G+NE+N+ L  +I     IH+V  + +      LRFAVC +     HV+ A+  I  +  ++
Sbjct:    1 MDTAEFRRRGKEMVDYVADYLENIESRQVYPDVQPGYLRTLIPEDAPQEPETYEDVVKDIERVIMPGVTHWHSPYFFAYFPTANSFPALLADMLSGAIGCIGFSWAASPACTELETVMLDWLGKMLKLPEEFLAGTEGKGGGVIQGTASEATLVALLAARSRILKRILNDDPEKQEANIISRLVAYSSDQAHSSVERAALIGGVKMKKIPTDCKFAVRGEAFQKILEEDKAAGLIPFYFCATLGTTPSCAFDRITEIGPICNAEQLWLHIDAAYAGSAFICPEFRPLLDGVEFADSFNFNPHKWMLVNFDCSTMWVKNRSDIIGAFKMDPLYLKHDHQESG---THWQIPLGRRFRSLKMWFVFRMYGLRGLQEHIR-----------------------KVPLALIVLVSSQGSNELNEALLKKINSARTIHLVPCQLA--GRFVLRFAVCSRTTESRHVQEAWAHISKLATEL 447          
BLAST of aadc vs. Ensembl Cavefish
Match: hdc (histidine decarboxylase [Source:NCBI gene;Acc:103025570])

HSP 1 Score: 457.988 bits (1177), Expect = 1.298e-154
Identity = 229/468 (48.93%), Postives = 316/468 (67.52%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLS--ESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKR-KMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTI 1655
            M AEE+ +RGKEM+D+++NYL  I   +V P V+PG+L  ++ +D P +PE W+NI+ DV ++IMPG+ HW  PH HAYFPA NS+ ++ GD+L+  I C+GFTWASSPACTELE+ +MDWL K L LP  FL       GGG++ +T SE T VALLAAR   I   + +N+DE    + S+L+ Y SDQAHSSVE+AGL+S++K+R +++ +R  +RG  LQ  I+ED   G  P    ATLG+TG C+FD LDE+GPIC    +WLHVDAAYAGSAL+C E R+ + G+E+A SFVFNP KWM+V+FDC+A W KD   + +TF+VDP+YL+H   G   DF HW I L RRFRSLK+WFV+R +G+  +Q +IR+ +++A LFE L+  D  F+I  E  +GLV F L G N + +EL  R+   G + ++ +       L +RF V  QF     ++  +  I
Sbjct:    2 MQAEEYTRRGKEMVDYISNYLTEIRTRRVVPDVQPGFLRPLLPSDAPCEPEPWENILQDVENIIMPGVVHWQSPHMHAYFPALNSWPSLLGDMLADAINCLGFTWASSPACTELEMCVMDWLCKALGLPDHFLHHHPESRGGGILQSTVSECTLVALLAARKDKI--LQMKNMDES--ILNSRLIAYASDQAHSSVEKAGLISLVKIRFLETDERFSLRGETLQRAIQEDRRRGLLPIMLCATLGSTGVCSFDCLDELGPICAREGLWLHVDAAYAGSALLCPELRYFMSGMEFADSFVFNPSKWMMVHFDCTAFWVKDKFKLQQTFSVDPLYLRHDNSGAT-DFMHWQIPLSRRFRSLKLWFVMRSFGLKNLQAHIRHGVEMAKLFESLVRSDSNFQIPAERNLGLVVFCLVGGNALTQELLRRLTQSGTMFLIPAAVG--TKLIIRFTVTSQFTQPQDIQRDWSII 462          
BLAST of aadc vs. Ensembl Cavefish
Match: hdc (histidine decarboxylase [Source:NCBI gene;Acc:103025570])

HSP 1 Score: 454.907 bits (1169), Expect = 6.431e-153
Identity = 229/483 (47.41%), Postives = 315/483 (65.22%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLS--ESGTGGGVIYNTCSEATFVALLAARNKAI---------------EFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKR-KMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTI 1655
            M AEE+ +RGKEM+D+++NYL  I   +V P V+PG+L  ++ +D P +PE W+NI+ DV ++IMPG+ HW  PH HAYFPA NS+ ++ GD+L+  I C+GFTWASSPACTELE+ +MDWL K L LP  FL       GGG++ +T SE T VALLAAR   I                F    + D D+  + S+L+ Y SDQAHSSVE+AGL+S++K+R +++ +R  +RG  LQ  I+ED   G  P    ATLG+TG C+FD LDE+GPIC    +WLHVDAAYAGSAL+C E R+ + G+E+A SFVFNP KWM+V+FDC+A W KD   + +TF+VDP+YL+H   G   DF HW I L RRFRSLK+WFV+R +G+  +Q +IR+ +++A LFE L+  D  F+I  E  +GLV F L G N + +EL  R+   G + ++ +       L +RF V  QF     ++  +  I
Sbjct:    1 MQAEEYTRRGKEMVDYISNYLTEIRTRRVVPDVQPGFLRPLLPSDAPCEPEPWENILQDVENIIMPGVVHWQSPHMHAYFPALNSWPSLLGDMLADAINCLGFTWASSPACTELEMCVMDWLCKALGLPDHFLHHHPESRGGGILQSTVSECTLVALLAARKDKILQMKSTDPAAETHTDAFINDTHSDMDESILNSRLIAYASDQAHSSVEKAGLISLVKIRFLETDERFSLRGETLQRAIQEDRRRGLLPIMLCATLGSTGVCSFDCLDELGPICAREGLWLHVDAAYAGSALLCPELRYFMSGMEFADSFVFNPSKWMMVHFDCTAFWVKDKFKLQQTFSVDPLYLRHDNSGAT-DFMHWQIPLSRRFRSLKLWFVMRSFGLKNLQAHIRHGVEMAKLFESLVRSDSNFQIPAERNLGLVVFCLVGGNALTQELLRRLTQSGTMFLIPAAVG--TKLIIRFTVTSQFTQPQDIQRDWSII 480          
BLAST of aadc vs. Ensembl Cavefish
Match: hdc (histidine decarboxylase [Source:NCBI gene;Acc:103025570])

HSP 1 Score: 454.907 bits (1169), Expect = 6.431e-153
Identity = 229/483 (47.41%), Postives = 315/483 (65.22%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLS--ESGTGGGVIYNTCSEATFVALLAARNKAI---------------EFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKR-KMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTI 1655
            M AEE+ +RGKEM+D+++NYL  I   +V P V+PG+L  ++ +D P +PE W+NI+ DV ++IMPG+ HW  PH HAYFPA NS+ ++ GD+L+  I C+GFTWASSPACTELE+ +MDWL K L LP  FL       GGG++ +T SE T VALLAAR   I                F    + D D+  + S+L+ Y SDQAHSSVE+AGL+S++K+R +++ +R  +RG  LQ  I+ED   G  P    ATLG+TG C+FD LDE+GPIC    +WLHVDAAYAGSAL+C E R+ + G+E+A SFVFNP KWM+V+FDC+A W KD   + +TF+VDP+YL+H   G   DF HW I L RRFRSLK+WFV+R +G+  +Q +IR+ +++A LFE L+  D  F+I  E  +GLV F L G N + +EL  R+   G + ++ +       L +RF V  QF     ++  +  I
Sbjct:    1 MQAEEYTRRGKEMVDYISNYLTEIRTRRVVPDVQPGFLRPLLPSDAPCEPEPWENILQDVENIIMPGVVHWQSPHMHAYFPALNSWPSLLGDMLADAINCLGFTWASSPACTELEMCVMDWLCKALGLPDHFLHHHPESRGGGILQSTVSECTLVALLAARKDKILQMKSTDPAAETHTDAFINDTHSDMDESILNSRLIAYASDQAHSSVEKAGLISLVKIRFLETDERFSLRGETLQRAIQEDRRRGLLPIMLCATLGSTGVCSFDCLDELGPICAREGLWLHVDAAYAGSALLCPELRYFMSGMEFADSFVFNPSKWMMVHFDCTAFWVKDKFKLQQTFSVDPLYLRHDNSGAT-DFMHWQIPLSRRFRSLKLWFVMRSFGLKNLQAHIRHGVEMAKLFESLVRSDSNFQIPAERNLGLVVFCLVGGNALTQELLRRLTQSGTMFLIPAAVG--TKLIIRFTVTSQFTQPQDIQRDWSII 480          
BLAST of aadc vs. Ensembl Sea Lamprey
Match: hdc (histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-080102-5])

HSP 1 Score: 409.838 bits (1052), Expect = 2.726e-138
Identity = 213/454 (46.92%), Postives = 293/454 (64.54%), Query Frame = 3
Query:  288 GKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSE--SGTGGGVIYNTCSEATFVALLAARNKAI-EFRRKENLDEDQYTIM-SKLVGYYSDQAHSSVERAGLLSMIKMREVKS-IKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHV 1634
            GK M+D++A YL  + +  V P V PGYL  ++   PP + E W+ I  D+  +IMPGI HW  PH H YFPA NSY ++ GD+L+ GI C+GFTWAS+PA TEL++VM DWL  ML LP  F  +   G GGGVI ++ SE T +ALLAAR +A+ + R   + D     ++ S+LVGY SDQAHSSV +  L+S++++R + + ++  +RG  L+  ++ED   G  PF+  ATLGTTG C FD++ E+GPIC    +WLHVDAAYAG+A +C E R  L G+E+A SFV NP KWM+VN DC+  W  D R +  TF V+P YL+H+  G   DF HW I L  RFRSLK+WFV+R +G+DG+Q+++R   KLA  FE L+  D  FEI  +  +GLV FRL+G NE+ + L  R+    ++ +V +     D   +RF +  QF TE  V
Sbjct:    1 GKAMVDYIAAYLTGLRDRPVNPSVRPGYLRPLLPPGPPQQGEAWERIFEDMEQLIMPGIAHWQSPHMHGYFPALNSYPSLLGDMLATGINCVGFTWASNPASTELQIVMTDWLVDMLSLPATFRHDHPDGCGGGVIQSSVSECTMLALLAARTRALTQLRGDVSQDVGNDALLNSRLVGYTSDQAHSSVLKVSLMSLVRLRSLPTDLEFSLRGETLRRAVEEDRAQGLVPFFVCATLGTTGVCTFDNMAELGPICRQEGLWLHVDAAYAGTAFLCPELRDPLRGVEFADSFVVNPGKWMMVNLDCAVFWVADKRSLQSTFCVEPHYLQHEHSGSVTDFMHWQIPLTVRFRSLKLWFVIRSFGLDGLQEHVRRTNKLARYFESLVREDPHFEIPAKSNLGLVVFRLQGPNELTETLLRRLNQSQQLFVVPAMAG--DKFIIRFVITSQFTTEADV 452          
BLAST of aadc vs. Ensembl Sea Lamprey
Match: hdc (histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-080102-5])

HSP 1 Score: 384.8 bits (987), Expect = 7.706e-130
Identity = 190/380 (50.00%), Postives = 257/380 (67.63%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSE--SGTGGGVIYNTCSEATFVALLAARNKAI-EFRRKENLDEDQYTIM-SKLVGYYSDQAHSSVERAGLLSMIKMREVKS-IKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIR 1385
            MD +E+R RGKEM+D++A YL  + E  V P V PGYL  ++ A PP + E W+ I  DV  +IMPG+ HW  PH H Y+P  NSY ++ GD+L+ G+  +GFTWAS+PA TELE+V+ DWLA ML LP  F  +  SG GGGV+  T SE+  +ALLAAR +A+   R    +D  Q  ++ ++LV Y SDQAHSSV +A L+S++++R + + ++  +RG  L+  ++ED   G  PF+  ATLG+TG CAFD+L E+GPIC    +WLHVDAAYAG+A +C E R  L GIE A SFV NP KWM+VN DC+  W  D R +  TF V+P YLKH+  G   D  HW I L  RFRSLK+WFV+R +G+DG+Q+++R
Sbjct:    1 MDNDEYRNRGKEMVDYIAMYLRGLRERSVNPSVLPGYLRPLLPAGPPQQGESWERIFKDVERLIMPGVVHWQSPHMHGYYPGLNSYPSLLGDMLATGMNSVGFTWASNPASTELEMVVTDWLATMLSLPDTFRHDHPSGRGGGVMQTTVSESNLLALLAARTRALARLRGDARVDVGQDALLNARLVAYTSDQAHSSVLKASLVSLVRLRSLSTDLEFSLRGETLRRAVEEDRAQGLVPFFVCATLGSTGVCAFDNLSELGPICRQEGLWLHVDAAYAGTAFLCPELRDPLHGIEIADSFVVNPGKWMMVNLDCTVFWVADKRSLQSTFCVEPHYLKHEHSGSVTDLMHWQIPLTVRFRSLKLWFVIRSFGLDGLQEHVR 380          
BLAST of aadc vs. Ensembl Sea Lamprey
Match: hdc (histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-080102-5])

HSP 1 Score: 350.903 bits (899), Expect = 3.295e-116
Identity = 190/415 (45.78%), Postives = 266/415 (64.10%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSE--SGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDE--DQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKS-IKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLK 1490
            MDAEE++ RGK M+D++A YL  + +  V P V PGYL  ++   PP + E W+ I  DV  +IMPGI HW  PH H YFPA NSY ++ GD+L+ G+ C+ FTWAS+PA TEL++VM DWL  ML LP  F  +   G GGGVI ++ SE+T +ALLAAR +A+   R +   +  +   + S+LVGY SDQAHSSV +A L+S++++R + + ++  +RG  L+  + ED   G  PF+  ATLGTTG CAFD++ E+GPIC    +WLHVDAAYAG+A +C E R  L G+E+A SFV NP KWM+VN DC+  W  D R +  TF V+P YL+H+  G   DF          F ++K   ++++ G+  +  +I+ + KLA  FE L+  D  FEI  +  +GLV FRL+
Sbjct:    2 MDAEEYKVRGKAMVDYIAAYLTGLRDRPVKPSVRPGYLRPLLPPGPPQQGEPWERIFEDVEQLIMPGIVHWQSPHMHGYFPALNSYPSLLGDMLATGMNCVSFTWASNPASTELQIVMTDWLVDMLSLPDTFRHDHPDGCGGGVIQSSVSESTMLALLAARTRALTQLRGDVSQDFGNDALLNSRLVGYTSDQAHSSVLKASLMSLVRVRSLPTDLEFSLRGETLRRAVDEDRAQGLVPFFVCATLGTTGVCAFDNMAELGPICRQEGLWLHVDAAYAGTAFLCPELRDPLRGVEFADSFVVNPGKWMMVNLDCAVFWVADKRSLQSTFCVEPHYLQHEHSGSVTDFMVGEFAALHMFYNIKKHHLVKIRGISMLYVFIQTN-KLARYFESLVREDPHFEIPAKSNLGLVVFRLQ 415          
BLAST of aadc vs. Ensembl Sea Lamprey
Match: hdc (histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-080102-5])

HSP 1 Score: 299.671 bits (766), Expect = 9.208e-98
Identity = 153/311 (49.20%), Postives = 205/311 (65.92%), Query Frame = 3
Query:  282 KRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSE--SGTGGGVIYNTCSEATFVALLAARNKAI-EFRRKENLDEDQYTIM-SKLVGYYSDQAHSSVERAGLLSMIKMREVKS-IKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVW 1199
            + GKE++D++  YL  + E  V P V PGYL  ++ A PP + E W+ I  DV  +IMPGI HW  PH H Y+P  NSY ++ GD+L+  I  IGFTWASSPA TELE+VM DWLA ML LP  F  +   G GGGV+  T SE+  +ALLAAR +A+   R    +D  Q  ++ ++LV Y SDQAHSSV +A L+S++++R + + ++  +RG  L+  ++ED   G  PF+   TLGTTG CAFD+L E+GPIC    +WLHVDAAYAG+A +C E R  L G+E+A SFV NP KWM+VN D +  W
Sbjct:    3 RAGKELVDYITTYLRGVRERPVNPSVRPGYLRPLLPAGPPQQGEPWERIFEDVERLIMPGIVHWQSPHMHGYYPGLNSYPSLLGDMLANAINSIGFTWASSPASTELELVMTDWLATMLSLPDTFRHDHPEGRGGGVMQTTVSESNLLALLAARTRALARLRGDACVDVGQDALLNARLVAYTSDQAHSSVLKASLVSLVRLRSLSTDLEFSLRGETLRRAVEEDRAQGLVPFFVSVTLGTTGLCAFDNLAELGPICRQEGLWLHVDAAYAGTAFLCPELRDPLRGVEFADSFVVNPSKWMMVNLDSAVFW 313          
BLAST of aadc vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005196.1 (pep scaffold:Pmarinus_7.0:GL479731:26751:28782:1 gene:ENSPMAG00000004726.1 transcript:ENSPMAT00000005196.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.887 bits (346), Expect = 1.855e-38
Identity = 69/152 (45.39%), Postives = 101/152 (66.45%), Query Frame = 3
Query:  510 NSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSE--SGTGGGVIYNTCSEATFVALLAARNKAI-EFRRKENLDEDQYTIM-SKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKRKMRGSVLQEMIKEDLENG 953
            NSY ++ GD+L+  I C+GFTWAS+PA TEL++VM DWL  ML LP  F  +   G GGGVI ++ SE+T +ALLAAR +A+ + R   + D     ++ S+LVGY SDQAHSSV +  L+S++++R + + +  +RG  L+  + ED   G
Sbjct:    7 NSYPSLLGDMLATRINCVGFTWASNPASTELQIVMTDWLVDMLSLPATFRHDHPDGCGGGVIQSSVSESTMLALLAARTRALTQLRGDVSQDVGNDALLNSRLVGYTSDQAHSSVLKVSLMSLVRLRSLPTDEFSLRGETLRRAVDEDRAQG 158          
BLAST of aadc vs. Ensembl Nematostella
Match: EDO43392 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYV7])

HSP 1 Score: 426.787 bits (1096), Expect = 1.963e-144
Identity = 225/472 (47.67%), Postives = 317/472 (67.16%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSE-----SGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIK--RKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTI 1655
            MD+++FR++GK+++DF+A+Y ENI   +V P V PG+L K +  + P K EE+ N+  D    IMPGI HW  P+FHAY+P  +S+ A+ GD+LSGG+G I F+WAS+PA TELEVV+MDWL KM++LP+DFL E        GGG I NT SE+  V +LAAR  A++  R    D+D   IMS+L+ Y SDQ HS +++A +L+ +K+R++ +    + M    L++ +K D   G +PFY  A+LGTT +CAFD L +IGPIC+   IW+H+DAAY+G A +C E+R LLDG+E+A SF FNPHK ML NFDCSA+W K    + +   VDP+YL  +K     + + W I LGR  R+LK+WFVLR YG++GIQK++RNH+K+A LFE L+  D RFE V +V +GLVCF+LKG    +K L   I  +G IH+V  E +      +RF VC ++  E+ + +A+  I
Sbjct:    1 MDSKQFREQGKQIVDFIADYFENIRSQRVIPDVRPGFLQKHLPTEAPSKGEEFVNVKEDFEKFIMPGIVHWQSPNFHAYYPCGHSFPAVLGDLLSGGLGSIMFSWASNPAGTELEVVVMDWLGKMVKLPEDFLFEFTKDKPHVGGGCIQNTASESILVTMLAARRAALDRLRNRYPDDDDDVIMSRLIVYSSDQVHSCLDKAAMLAAVKLRKIPTNDEDQSMNVVALEKAVKVDEAMGLHPFYLCASLGTTSTCAFDDLKKIGPICQRESIWMHIDAAYSGPAFMCPEFRPLLDGVEFAESFNFNPHKLMLTNFDCSALWVKHRDMLKKAMHVDPIYL--RKRSFMGESKDWEIPLGRSMRALKLWFVLRTYGLEGIQKHVRNHVKMAKLFESLLAQDSRFEQVAKVVLGLVCFKLKGTANKSKALLKAINNEGLIHMVPGELN--GAYMIRFVVCSEWVKEEDIHFAWSVI 468          
BLAST of aadc vs. Ensembl Nematostella
Match: EDO43411 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYR9])

HSP 1 Score: 392.119 bits (1006), Expect = 1.968e-131
Identity = 201/439 (45.79%), Postives = 287/439 (65.38%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLS-----ESGT-GGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKR-KMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIV 1556
            M++EEFRK GK MIDF+A++LE I++ +V P V+PG+L   +  + P + E +D I  D    ++PG+T W  PHFHA+FP++ SY  + G+++S  +  +GF W  +P+ TELE++++DWL KML LPK+FL+     E G  GGGVI  T SEAT VA+LAAR   +   + E+    +  +MSK+V Y S  AHSSVE+A  ++ +K+R V++     +RG    E +K D E G  PF+  ATLGTT  C++D+L E+GP+    ++WLHVDAAYAG A  C E R  + GIE A SF  N HK M+ NFDC+ +W KD   ++  FT++ +Y      G   +FR+W I LGRRFRSLK+WFV+R YG++GIQK IR H++LA +FE+++  DD FE+V +   GLVCFR KG+ E NK L   +  +G+I + 
Sbjct:    1 MNSEEFRKHGKAMIDFIADFLETIEKRRVVPDVKPGFLLHQLPNEAPSQSENFDAIFEDFEKKVLPGVTLWGSPHFHAFFPSSISYPGILGELMSASLAGVGFNWLCNPSSTELEIMVLDWLGKMLDLPKEFLAMTPAREDGRRGGGVIQGTASEATLVAVLAARTATLTQLQNEHPGVAEGVLMSKMVAYTSKHAHSSVEKAARIAGVKLRSVETDDAGSLRGEQFLECLKADKEAGLIPFFLCATLGTTTLCSYDNLKELGPLAVKEKMWLHVDAAYAGPAFTCPEMRAPMQGIELADSFNCNAHKMMMTNFDCAPMWVKDRDALMRAFTLERIYYPDDDTGVVTEFRNWQIPLGRRFRSLKLWFVIRSYGIEGIQKEIREHVRLAKVFEEMVKQDDDFELVVDTNFGLVCFRYKGSEEDNKNLVDILNAEGKILVT 439          
BLAST of aadc vs. Ensembl Medaka
Match: ddc (dopa decarboxylase [Source:NCBI gene;Acc:100301599])

HSP 1 Score: 511.531 bits (1316), Expect = 2.597e-177
Identity = 259/478 (54.18%), Postives = 341/478 (71.34%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSES-GTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLD--EDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKR-KMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKE--GKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQM 1676
            MDA EFR+RGKEM+D VA+YLE I+E  V+P VEPGYL  +I  + P++P+ +++IM DV  VIMPGITHWH P+F AYFPAA+SY AM  D+L   IGCIGF+WA+SPACTELE VM+DWL KMLQLP+ FL+ + G GGGVI  T SEAT V+LLAAR KAI  RR ++LD  + +  I+SKLV Y S+QAHSSVERA L+  + M++V +     +RG +L+++++ED   G  PFY  ATLGTT SCAFD + ++GP+C    +W+H+DAAYAGSA IC E+R LL+G+EYA SF FNPHKWML+NFDCSA+W K    ++  F ++P+YLKH+ +  G   D+RHW I LGRRFRSLK+WFV R+YG+ G+Q +IR  + LA  FE L+  D RFEI   V MGLVCFRLKG NE+N+ L  +I     IH+V  + S   +  LR A+C +     H++ A+  I  +  ++
Sbjct:    1 MDAAEFRRRGKEMVDHVADYLEKIEERPVYPDVEPGYLRSLIPTEAPVEPDSYEDIMKDVERVIMPGITHWHSPNFFAYFPAASSYPAMLADMLCAAIGCIGFSWAASPACTELETVMLDWLGKMLQLPECFLAGTHGHGGGVIQGTASEATLVSLLAARCKAI--RRVQSLDPKKSEAEILSKLVAYTSEQAHSSVERAALIGAVMMKKVPTDNLYAVRGEMLKKILEEDKAAGLIPFYFCATLGTTPSCAFDHIADLGPLCNQENMWMHIDAAYAGSAFICPEFRPLLNGVEYADSFNFNPHKWMLINFDCSAMWVKKRTDIIGAFKMEPLYLKHENQESGLVTDYRHWQIPLGRRFRSLKMWFVFRMYGLQGLQAHIRKQVGLAKEFESLVRADKRFEICAPVVMGLVCFRLKGTNELNQSLLKKITKSREIHLVPCQLS--GSFVLRLAICSRSTESRHIQQAWQHITQLAFEL 474          
BLAST of aadc vs. Ensembl Medaka
Match: ddc (dopa decarboxylase [Source:NCBI gene;Acc:100301599])

HSP 1 Score: 503.827 bits (1296), Expect = 2.453e-174
Identity = 257/482 (53.32%), Postives = 339/482 (70.33%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSES-GTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLD--EDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKR-KMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPD------FRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQM 1676
            MDA EFR+RGKEM+D VA+YLE I+E  V+P VEPGYL  +I  + P++P+ +++IM DV  VIMPGITHWH P+F AYFPAA+SY AM  D+L   IGCIGF+WA+SPACTELE VM+DWL KMLQLP+ FL+ + G GGGVI  T SEAT V+LLAAR KAI  RR ++LD  + +  I+SKLV Y S+QAHSSVERA L+  + M++V +     +RG +L+++++ED   G  PFY  ATLGTT SCAFD + ++GP+C    +W+H+DAAYAGSA IC E+R LL+G+EYA SF FNPHKWML+NFDCSA+W K    ++  F ++P+YLKH+ + K          +HW I LGRRFRSLK+WFV R+YG+ G+Q +IR  + LA  FE L+  D RFEI   V MGLVCFRLKG NE+N+ L  +I     IH+V  + S   +  LR A+C +     H++ A+  I  +  ++
Sbjct:    1 MDAAEFRRRGKEMVDHVADYLEKIEERPVYPDVEPGYLRSLIPTEAPVEPDSYEDIMKDVERVIMPGITHWHSPNFFAYFPAASSYPAMLADMLCAAIGCIGFSWAASPACTELETVMLDWLGKMLQLPECFLAGTHGHGGGVIQGTASEATLVSLLAARCKAI--RRVQSLDPKKSEAEILSKLVAYTSEQAHSSVERAALIGAVMMKKVPTDNLYAVRGEMLKKILEEDKAAGLIPFYFCATLGTTPSCAFDHIADLGPLCNQENMWMHIDAAYAGSAFICPEFRPLLNGVEYADSFNFNPHKWMLINFDCSAMWVKKRTDIIGAFKMEPLYLKHENQEKNKTKPLSVILQHWQIPLGRRFRSLKMWFVFRMYGLQGLQAHIRKQVGLAKEFESLVRADKRFEICAPVVMGLVCFRLKGTNELNQSLLKKITKSREIHLVPCQLS--GSFVLRLAICSRSTESRHIQQAWQHITQLAFEL 478          
BLAST of aadc vs. Ensembl Medaka
Match: hdc (histidine decarboxylase [Source:NCBI gene;Acc:101172886])

HSP 1 Score: 459.914 bits (1182), Expect = 1.363e-154
Identity = 230/470 (48.94%), Postives = 317/470 (67.45%), Query Frame = 3
Query:  258 KMDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLS--ESGTGGGVIYNTCSEATFVALLAAR-NKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKR-KMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTI 1655
            KM AEE+ +RGKEM+D++  YL +I + +V P V+PG   K++    P +PE+W++I ND+  VIMPG+ HW  PH HAY+P+  S+ +M GD+L+  I C+GFTWASSPACTELE+ MMDWL K L LP  FL       GGGV+ +T SE+T VALLAAR +K ++ R + + D D   + S+LV Y SDQAHSSVE+AGL+S++K+R + +  +  +RG  L++ I+ED   G  PF   ATLGTTG CAFD L E+GP+CE   +WLHVDAAYAGSA +C E R  L+GIE+A SFVFNP KWM+V+FDC+A W +D   + +TF+VDPVYL+H+      DF HW I L RRFRSLK+WFVLR +G+  +Q +IR+ +++A L E L+  D  FE+  +  +GLV F LK  N + +EL  R+ G G ++++ +E        +RF V  QF T + +   +  I
Sbjct:    1 KMQAEEYNRRGKEMVDYITEYLSSIRDRRVIPDVKPGDTQKLLPDSAPTEPEDWESIFNDIERVIMPGVVHWQSPHMHAYYPSLTSWPSMLGDMLADAINCVGFTWASSPACTELEMKMMDWLCKALGLPYFFLHHHPDSRGGGVLQSTVSESTLVALLAARKDKILQLRAELDQDVDDSVLNSRLVAYASDQAHSSVEKAGLISLVKIRFLPADDQLSLRGDALKQAIQEDRRRGLVPFMLCATLGTTGVCAFDKLSELGPVCEEEALWLHVDAAYAGSAYLCPELRWSLEGIEFAHSFVFNPSKWMMVHFDCTAFWVRDKYKLQQTFSVDPVYLRHENSQAATDFMHWQIPLSRRFRSLKLWFVLRSFGLKKLQAHIRHGVEMAKLLESLIKSDPNFEVPAQRHLGLVVFCLKDGNALTQELLRRLTGYGTMYLIPAEIHTKRI--IRFTVTSQFTTAEDILKDWAII 468          
BLAST of aadc vs. Ensembl Medaka
Match: gad2 (glutamate decarboxylase 2 [Source:NCBI gene;Acc:101169246])

HSP 1 Score: 125.946 bits (315), Expect = 3.960e-30
Identity = 106/395 (26.84%), Postives = 179/395 (45.32%), Query Frame = 3
Query:  291 KEMIDFVANYL-ENID-ELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKR----KMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYL--KHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIV 1451
            +E++D +  Y+ E+ D E KV     P  L ++ + +   +P   D+I+    + +   I   H  +F+      +    +  D L+       FT+  +P    LE V +  + +++  P+      G G G+     + +   A+L AR     F+    + E   + + +LV + S+ +H S+++      I    V  IK     KM  + L+  I E  + GF PF+  AT GTT   AFD L  I  IC+ + IW+HVD A+ GS L+ + +R  LDG+E A S  +NPHK M V   CSA+  ++   +     +   YL  + K+     D     +Q GR     K+W + R  G  G +  I   ++L+      +   D +E+V
Sbjct:  113 QEVVDILLAYIVESFDRETKVIDFHYPNELLQLNNWELQHEPATLDDILISCRATLKYAIKTAHPRYFNQLSTGLD-MVGLAADWLTSTANTNMFTYEVAPVFVLLEYVTLKKMREIIGWPE------GRGDGIFSPGGAISNMYAMLLAR-----FKMFPEVKEKGMSSVPRLVAFTSEHSHFSIKKGAAALGIGTESVICIKADECGKMIPADLERRILEAKQKGFVPFFVSATAGTTVYGAFDPLIAISDICKKYNIWMHVDGAWGGSLLMSRRHRWKLDGVERANSVTWNPHKMMSVPLQCSALLVREEGLMQNCNQMHACYLFQQDKQYDLSYDTGDKALQCGRHVDIFKLWLMWRAKGTIGFEAQIDRCLELSEYLYNKIKDRDGYEMV 495          
BLAST of aadc vs. Ensembl Medaka
Match: GADL1 (glutamate decarboxylase like 1 [Source:NCBI gene;Acc:101172521])

HSP 1 Score: 124.02 bits (310), Expect = 9.258e-30
Identity = 85/327 (25.99%), Postives = 151/327 (46.18%), Query Frame = 3
Query:  522 AMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKRKMRGSVLQEMIKEDLE----NGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVE---TFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCF 1481
            +M    ++  +    +T+  +P  T +E  +   L KM++L    +     G G+     S +   A+  AR     +R   ++ E       +LV + S + H S+ +A  L  +  + V ++    RG ++   ++E +E     G  PF+  AT GTT   AFD +DEI  ICE H +WLHVDA + G+AL+  +++HLL GI  A S  +NPHK ++    CSA   KD   +++   +     ++ + K      D     +Q  R+  + K W + +  G   +++ +   + +A    +     + F ++ E     VCF
Sbjct:  124 SMVASFITEAVKTSLYTYEVAPVFTLMEDAV---LKKMMEL----IGWDEGGDGIFNPGGSMSNMYAVNLAR-----YRFCPDIKEVGLYNAPRLVMFTSQEGHYSISKAAALLGLGTKNVYAVPSDDRGKMIPSALEEKIELARSEGAVPFFVNATAGTTVFGAFDPVDEIADICERHSLWLHVDACWGGAALVSNQHKHLLKGIHRADSVAWNPHKMLMACLQCSAFLIKDKTSLLQRCHSAKASYLFQQDKFYDVSYDTGDKSVQCSRKPDAFKFWLMWKALGSSELERRVDRALAMARYLAQTFKKREGFHLLMEPEYSNVCF 438          
BLAST of aadc vs. Planmine SMEST
Match: SMESG000066844.1 (SMESG000066844.1)

HSP 1 Score: 1020.76 bits (2638), Expect = 0.000e+0
Identity = 505/507 (99.61%), Postives = 506/507 (99.80%), Query Frame = 3
Query:  186 MNVFDNKESLRKSGRKISHDVYTPKMDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQMDLCSDLFLEK 1706
            MNVFDNKESLRKSGRKISHDVYTPKMDAEEFRKRGKEMIDFVANYLENIDELKVFP VEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITHWHHPHFHAYFPAANSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENL+EDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQMDLCSDLFLEK
Sbjct:    1 MNVFDNKESLRKSGRKISHDVYTPKMDAEEFRKRGKEMIDFVANYLENIDELKVFPQVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITHWHHPHFHAYFPAANSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLNEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQMDLCSDLFLEK 507          
BLAST of aadc vs. Planmine SMEST
Match: SMESG000019737.1 (SMESG000019737.1)

HSP 1 Score: 467.618 bits (1202), Expect = 4.321e-157
Identity = 241/487 (49.49%), Postives = 335/487 (68.79%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFL-SESGTGGGVIYNTCSEATFVALLAARNKAIE------FRRKENLDEDQY---TIMSKLVGYYSDQAHSSVERAGLLSMIKMREVK-SIKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGN-----------NEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTI 1655
            MD E+FR  GKE++D++  YL  I++ +V P+V PGYL K++  +PP  PE+W NI++DV+ +IMPGITHW HP FHAYFP+ N + ++ GD++S  IGCIGF+WA+SPACTELE++M+DWLAKM+ LPK+F+ SE   GGGVI  + S+   V +L+AR+ AI+      F + E++++ +     I+++LVGY S  AH+ VE+AG++S +K+ ++    +  +RG+ L+E I+ D E G  PF  VATLGTTG C+FD+L+EI  +C+ + IWLHVDAAYAGS+ IC E++H L GIE   S  FN +K++LVNFDCS +W +    + ++  VDPVYL+HK   K  DFRHW I L RRFRSLK+WF +R YGV+G+QKYIRNH++LA  FE L+  +DRFEIV  V +GLVCFRLK N           N IN+ L   I   G++H+  S     D   LRF VC + A+ + V YA+G I
Sbjct:    7 MDLEDFRINGKELVDYICTYLATIEQRRVIPNVSPGYLSKLMPNEPPKSPEQWANILHDVDKLIMPGITHWQHPRFHAYFPSGNCFPSIMGDMVSDAIGCIGFSWAASPACTELEMIMLDWLAKMMNLPKEFMHSEGLGGGGVIQGSASDCILVCMLSARHYAIKEAKTKLFHKSESIEKTRSFEGAILTRLVGYCSSLAHACVEKAGMISFVKIHQLDVDDEYSLRGATLEEAIERDKELGLIPFMVVATLGTTGCCSFDNLEEISLVCKKYNIWLHVDAAYAGSSFICPEFQHYLKGIENVDSISFNTNKFLLVNFDCSILWIRKCSQITDSMIVDPVYLQHKHSSKAVDFRHWGIPLSRRFRSLKLWFTIRAYGVEGLQKYIRNHVRLASEFEALVRKNDRFEIVGTVVLGLVCFRLKSNASEYFFSKNELNSINQCLIRTINESGKLHMTPSVVK--DKYILRFCVCSEHASSEDVTYAWGVI 491          
BLAST of aadc vs. Planmine SMEST
Match: SMESG000019737.1 (SMESG000019737.1)

HSP 1 Score: 467.233 bits (1201), Expect = 1.421e-156
Identity = 241/487 (49.49%), Postives = 335/487 (68.79%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFL-SESGTGGGVIYNTCSEATFVALLAARNKAIE------FRRKENLDEDQY---TIMSKLVGYYSDQAHSSVERAGLLSMIKMREVK-SIKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGN-----------NEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTI 1655
            MD E+FR  GKE++D++  YL  I++ +V P+V PGYL K++  +PP  PE+W NI++DV+ +IMPGITHW HP FHAYFP+ N + ++ GD++S  IGCIGF+WA+SPACTELE++M+DWLAKM+ LPK+F+ SE   GGGVI  + S+   V +L+AR+ AI+      F + E++++ +     I+++LVGY S  AH+ VE+AG++S +K+ ++    +  +RG+ L+E I+ D E G  PF  VATLGTTG C+FD+L+EI  +C+ + IWLHVDAAYAGS+ IC E++H L GIE   S  FN +K++LVNFDCS +W +    + ++  VDPVYL+HK   K  DFRHW I L RRFRSLK+WF +R YGV+G+QKYIRNH++LA  FE L+  +DRFEIV  V +GLVCFRLK N           N IN+ L   I   G++H+  S     D   LRF VC + A+ + V YA+G I
Sbjct:   39 MDLEDFRINGKELVDYICTYLATIEQRRVIPNVSPGYLSKLMPNEPPKSPEQWANILHDVDKLIMPGITHWQHPRFHAYFPSGNCFPSIMGDMVSDAIGCIGFSWAASPACTELEMIMLDWLAKMMNLPKEFMHSEGLGGGGVIQGSASDCILVCMLSARHYAIKEAKTKLFHKSESIEKTRSFEGAILTRLVGYCSSLAHACVEKAGMISFVKIHQLDVDDEYSLRGATLEEAIERDKELGLIPFMVVATLGTTGCCSFDNLEEISLVCKKYNIWLHVDAAYAGSSFICPEFQHYLKGIENVDSISFNTNKFLLVNFDCSILWIRKCSQITDSMIVDPVYLQHKHSSKAVDFRHWGIPLSRRFRSLKLWFTIRAYGVEGLQKYIRNHVRLASEFEALVRKNDRFEIVGTVVLGLVCFRLKSNASEYFFSKNELNSINQCLIRTINESGKLHMTPSVVK--DKYILRFCVCSEHASSEDVTYAWGVI 523          
BLAST of aadc vs. Planmine SMEST
Match: SMESG000019737.1 (SMESG000019737.1)

HSP 1 Score: 466.848 bits (1200), Expect = 1.685e-156
Identity = 241/487 (49.49%), Postives = 335/487 (68.79%), Query Frame = 3
Query:  261 MDAEEFRKRGKEMIDFVANYLENIDELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITXXXXXXXXXXXXXXNSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFL-SESGTGGGVIYNTCSEATFVALLAARNKAIE------FRRKENLDEDQY---TIMSKLVGYYSDQAHSSVERAGLLSMIKMREVK-SIKRKMRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGN-----------NEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTI 1655
            MD E+FR  GKE++D++  YL  I++ +V P+V PGYL K++  +PP  PE+W NI++DV+ +IMPGITHW HP FHAYFP+ N + ++ GD++S  IGCIGF+WA+SPACTELE++M+DWLAKM+ LPK+F+ SE   GGGVI  + S+   V +L+AR+ AI+      F + E++++ +     I+++LVGY S  AH+ VE+AG++S +K+ ++    +  +RG+ L+E I+ D E G  PF  VATLGTTG C+FD+L+EI  +C+ + IWLHVDAAYAGS+ IC E++H L GIE   S  FN +K++LVNFDCS +W +    + ++  VDPVYL+HK   K  DFRHW I L RRFRSLK+WF +R YGV+G+QKYIRNH++LA  FE L+  +DRFEIV  V +GLVCFRLK N           N IN+ L   I   G++H+  S     D   LRF VC + A+ + V YA+G I
Sbjct:   36 MDLEDFRINGKELVDYICTYLATIEQRRVIPNVSPGYLSKLMPNEPPKSPEQWANILHDVDKLIMPGITHWQHPRFHAYFPSGNCFPSIMGDMVSDAIGCIGFSWAASPACTELEMIMLDWLAKMMNLPKEFMHSEGLGGGGVIQGSASDCILVCMLSARHYAIKEAKTKLFHKSESIEKTRSFEGAILTRLVGYCSSLAHACVEKAGMISFVKIHQLDVDDEYSLRGATLEEAIERDKELGLIPFMVVATLGTTGCCSFDNLEEISLVCKKYNIWLHVDAAYAGSSFICPEFQHYLKGIENVDSISFNTNKFLLVNFDCSILWIRKCSQITDSMIVDPVYLQHKHSSKAVDFRHWGIPLSRRFRSLKLWFTIRAYGVEGLQKYIRNHVRLASEFEALVRKNDRFEIVGTVVLGLVCFRLKSNASEYFFSKNELNSINQCLIRTINESGKLHMTPSVVK--DKYILRFCVCSEHASSEDVTYAWGVI 520          
BLAST of aadc vs. Planmine SMEST
Match: SMESG000058665.1 (SMESG000058665.1)

HSP 1 Score: 188.348 bits (477), Expect = 1.128e-55
Identity = 90/199 (45.23%), Postives = 126/199 (63.32%), Query Frame = 3
Query: 1059 HVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTI 1655
            HVDAAYAGS LIC E+++L  G+EY  SF FNPHK +  +FDCS +W  +    V   +++P+YL H  EG   + RHW I LGRRFR+LK+WFVL ++G+  +Q+ IR H+KLA +F   +   + FE+V  V  GLVCF++K  NE  +EL++ ++ D  I +  S F   +  +LRF VC  FATE  V   +  I
Sbjct:   22 HVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAVSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKI 219          
The following BLAST results are available for this feature:
BLAST of aadc vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDC0.000e+056.45dopa decarboxylase [Source:HGNC Symbol;Acc:HGNC:27... [more]
DDC0.000e+056.45dopa decarboxylase [Source:HGNC Symbol;Acc:HGNC:27... [more]
DDC7.306e-16751.16dopa decarboxylase [Source:HGNC Symbol;Acc:HGNC:27... [more]
DDC6.391e-16151.91dopa decarboxylase [Source:HGNC Symbol;Acc:HGNC:27... [more]
HDC7.700e-15448.41histidine decarboxylase [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of aadc vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tdc-11.709e-16649.89Tyrosine decarboxylase [Source:UniProtKB/Swiss-Pr... [more]
tdc-11.709e-16649.89Tyrosine decarboxylase [Source:UniProtKB/Swiss-Pr... [more]
tdc-19.358e-16649.89Tyrosine decarboxylase [Source:UniProtKB/Swiss-Pr... [more]
bas-11.194e-12542.33Biogenic Amine Synthesis related [Source:UniProtK... [more]
bas-15.874e-12541.41Biogenic Amine Synthesis related [Source:UniProtK... [more]
back to top
BLAST of aadc vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddc0.000e+055.18gene:FBgn0000422 transcript:FBtr0081167[more]
Ddc0.000e+056.96gene:FBgn0000422 transcript:FBtr0290291[more]
Ddc0.000e+056.96gene:FBgn0000422 transcript:FBtr0081166[more]
Hdc8.455e-16050.11gene:FBgn0005619 transcript:FBtr0331924[more]
Tdc24.212e-15949.79gene:FBgn0050446 transcript:FBtr0086142[more]
back to top
BLAST of aadc vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddc3.291e-17753.57dopa decarboxylase [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
hdc5.462e-15247.45histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-... [more]
hdc6.070e-13845.74histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-... [more]
csad1.080e-2827.33cysteine sulfinic acid decarboxylase [Source:ZFIN;... [more]
csad1.734e-2827.33cysteine sulfinic acid decarboxylase [Source:ZFIN;... [more]
back to top
BLAST of aadc vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddc9.126e-17753.78dopa decarboxylase [Source:NCBI gene;Acc:496742][more]
ddc1.307e-17653.78dopa decarboxylase [Source:NCBI gene;Acc:496742][more]
ddc1.550e-17653.78dopa decarboxylase [Source:NCBI gene;Acc:496742][more]
ddc8.478e-17052.61dopa decarboxylase [Source:NCBI gene;Acc:496742][more]
ddc2.529e-15948.95dopa decarboxylase [Source:NCBI gene;Acc:496742][more]
back to top
BLAST of aadc vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddc1.001e-17855.67dopa decarboxylase [Source:MGI Symbol;Acc:MGI:9487... [more]
Ddc1.001e-17855.67dopa decarboxylase [Source:MGI Symbol;Acc:MGI:9487... [more]
Ddc1.001e-17855.67dopa decarboxylase [Source:MGI Symbol;Acc:MGI:9487... [more]
Hdc1.614e-15047.74histidine decarboxylase [Source:MGI Symbol;Acc:MGI... [more]
Ddc2.225e-8156.52dopa decarboxylase [Source:MGI Symbol;Acc:MGI:9487... [more]
back to top
BLAST of aadc vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P05031|DDC_DROME0.000e+055.18Aromatic-L-amino-acid decarboxylase OS=Drosophila ... [more]
sp|O96567|DDC_DROSI0.000e+055.18Aromatic-L-amino-acid decarboxylase OS=Drosophila ... [more]
sp|P48861|DDC_MANSE0.000e+057.57Aromatic-L-amino-acid decarboxylase OS=Manduca sex... [more]
sp|P20711|DDC_HUMAN0.000e+056.45Aromatic-L-amino-acid decarboxylase OS=Homo sapien... [more]
sp|P22781|DDC_CAVPO0.000e+055.04Aromatic-L-amino-acid decarboxylase OS=Cavia porce... [more]
back to top
BLAST of aadc vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
S5VQ160.000e+099.80Aadc OS=Schmidtea mediterranea OX=79327 GN=aadcb P... [more]
A6P6580.000e+076.84Aromatic amino acid decarboxylase OS=Dugesia japon... [more]
A0A4S2LK430.000e+057.62Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4V3SDJ20.000e+059.67Uncharacterized protein OS=Opisthorchis felineus O... [more]
G4LVM40.000e+058.88Aromatic-L-amino-acid decarboxylase,putative OS=Sc... [more]
back to top
BLAST of aadc vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddc3.528e-16250.21dopa decarboxylase [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
ddc9.415e-16049.89dopa decarboxylase [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
hdc1.298e-15448.93histidine decarboxylase [Source:NCBI gene;Acc:1030... [more]
hdc6.431e-15347.41histidine decarboxylase [Source:NCBI gene;Acc:1030... [more]
hdc6.431e-15347.41histidine decarboxylase [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of aadc vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hdc2.726e-13846.92histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-... [more]
hdc7.706e-13050.00histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-... [more]
hdc3.295e-11645.78histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-... [more]
hdc9.208e-9849.20histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000005196.11.855e-3845.39pep scaffold:Pmarinus_7.0:GL479731:26751:28782:1 g... [more]
back to top
BLAST of aadc vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of aadc vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO433921.963e-14447.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434111.968e-13145.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of aadc vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddc2.597e-17754.18dopa decarboxylase [Source:NCBI gene;Acc:100301599... [more]
ddc2.453e-17453.32dopa decarboxylase [Source:NCBI gene;Acc:100301599... [more]
hdc1.363e-15448.94histidine decarboxylase [Source:NCBI gene;Acc:1011... [more]
gad23.960e-3026.84glutamate decarboxylase 2 [Source:NCBI gene;Acc:10... [more]
GADL19.258e-3025.99glutamate decarboxylase like 1 [Source:NCBI gene;A... [more]
back to top
BLAST of aadc vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066844.10.000e+099.61SMESG000066844.1[more]
SMESG000019737.14.321e-15749.49SMESG000019737.1[more]
SMESG000019737.11.421e-15649.49SMESG000019737.1[more]
SMESG000019737.11.685e-15649.49SMESG000019737.1[more]
SMESG000058665.11.128e-5545.23SMESG000058665.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30020439
GenBankAGS83412.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020439 ID=SMED30020439|Name=aadc|organism=Schmidtea mediterranea sexual|type=transcript|length=1797bp
TGTTAATTTTATTCTACGTTGTTTATATAGATCTGATAAAATATTTACAT
TAAAAACAAAAACCTCATCCAATATAATAATTTTTACCAACAAATTTGCT
GACATATCTAGGTCAAAGGTCAGAATCCTTTATATTTTCTTTAGAATATA
TTGCAGAATATTTGGTAAAACATTTGAAATTTCAAATGAATGTTTTTGAT
AACAAAGAAAGTTTAAGGAAGTCTGGCAGGAAAATCAGTCACGATGTTTA
TACTCCAAAAATGGATGCCGAAGAGTTCAGAAAACGAGGCAAGGAAATGA
TAGATTTCGTTGCAAACTATTTGGAAAATATAGATGAATTAAAGGTGTTT
CCTCATGTTGAACCCGGCTATCTTCATAAAATGATTTCCGCCGATCCTCC
GATAAAGCCGGAAGAATGGGACAACATCATGAATGACGTGAACAGTGTCA
TAATGCCCGGGATCACTCATTGGCATCATCCTCATTTTCATGCGTACTTT
CCTGCAGCAAATTCGTACGCCGCCATGTGTGGAGATATCCTTTCGGGCGG
AATCGGATGTATCGGATTTACATGGGCCTCAAGCCCAGCCTGCACTGAGC
TGGAAGTGGTTATGATGGACTGGCTAGCAAAGATGTTACAATTGCCTAAA
GATTTCTTATCGGAATCAGGGACGGGAGGGGGAGTTATTTATAATACATG
TAGCGAAGCAACATTTGTTGCTCTTTTGGCTGCCAGAAACAAAGCTATTG
AATTTCGACGTAAAGAGAATCTCGACGAAGATCAGTATACTATTATGAGT
AAACTCGTTGGATATTATTCTGATCAGGCTCATTCATCTGTTGAAAGAGC
TGGATTATTGAGTATGATCAAAATGAGAGAGGTTAAATCTATAAAGCGAA
AAATGCGAGGTTCAGTTCTTCAAGAAATGATTAAAGAAGACTTAGAAAAT
GGATTTTACCCATTCTATTGCGTTGCGACTCTTGGGACTACCGGATCATG
TGCTTTTGATAGTCTTGATGAAATAGGCCCGATTTGTGAAGCTCACCAAA
TTTGGCTCCATGTCGATGCTGCATACGCAGGTTCGGCACTGATATGCCAA
GAATATAGGCATTTACTGGATGGGATAGAGTATGCAATGTCATTTGTTTT
CAATCCTCACAAATGGATGCTTGTAAATTTTGATTGTTCTGCTGTTTGGT
TTAAAGACAGCAGATTTGTTGTGGAAACATTTACAGTTGATCCGGTTTAT
TTAAAACACAAAAAAGAAGGCAAATGCCCTGATTTTCGACACTGGCATAT
TCAACTTGGACGCAGATTTCGTTCCTTGAAAATCTGGTTTGTGCTACGTC
TTTATGGAGTTGACGGAATTCAGAAGTATATCAGAAACCATATAAAATTA
GCACATTTATTTGAAAAGTTAATGTTAGGAGATGATCGGTTTGAAATTGT
TGAAGAGGTAACGATGGGGTTGGTTTGTTTCCGGTTAAAGGGAAACAATG
AAATCAACAAAGAATTATATTCGAGAATTGAAGGTGATGGTCGAATACAT
ATTGTTACATCTGAGTTTTCTGATACTGATACCTTATACCTCCGATTTGC
AGTTTGCTATCAGTTCGCAACAGAAGACCATGTTAAGTATGCTTATGGGA
CTATTATAGACATTACCAACCAAATGGATCTGTGTTCTGACCTTTTCCTA
GAAAAGTGAACATCCATCACCAAACTTTGATATAAATTAGGCTCATTTTT
CATTTCACATAAAATAATTTTTAAAAATAAATCTTGAATATTTTCAA
back to top

protein sequence of SMED30020439-orf-1

>SMED30020439-orf-1 ID=SMED30020439-orf-1|Name=SMED30020439-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=508bp
MNVFDNKESLRKSGRKISHDVYTPKMDAEEFRKRGKEMIDFVANYLENID
ELKVFPHVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITHWHHPH
FHAYFPAANSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKM
LQLPKDFLSESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLDEDQ
YTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKRKMRGSVLQEMIK
EDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGS
ALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFT
VDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIR
NHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEG
DGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTIIDITNQMDLC
SDLFLEK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004058aromatic-L-amino-acid decarboxylase activity
GO:0016829lyase activity
GO:0016831carboxy-lyase activity
GO:0030170pyridoxal phosphate binding
GO:0003824catalytic activity
GO:0005509calcium ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000026gut
PLANA:0000036eye
PLANA:0000105secretory cell
PLANA:0000143ventral region of the whole animal
PLANA:0000419prepharyngeal region
PLANA:0000420parapharyngeal region
PLANA:0000481serotonergic neuron
Vocabulary: INTERPRO
TermDefinition
IPR010977Aromatic_deC
IPR002129PyrdxlP-dep_de-COase
IPR015422PyrdxlP-dep_Trfase_dom1
IPR015421PyrdxlP-dep_Trfase_major
IPR021115Pyridoxal-P_BS
IPR015424PyrdxlP-dep_Trfase
Vocabulary: biological process
TermDefinition
GO:0006520cellular amino acid metabolic process
GO:0019752carboxylic acid metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 507..507
NoneNo IPR availableGENE3DG3DSA:1.20.1340.10coord: 22..106
e-value: 2.0E-36
score: 126.4
NoneNo IPR availablePANTHERPTHR11999:SF144MIP05841Pcoord: 26..496
NoneNo IPR availablePANTHERPTHR11999GROUP II PYRIDOXAL-5-PHOSPHATE DECARBOXYLASEcoord: 26..496
NoneNo IPR availableCDDcd06450DOPA_deC_likecoord: 101..493
e-value: 5.60193E-117
score: 346.498
IPR010977Aromatic-L-amino-acid decarboxylasePRINTSPR00800YHDCRBOXLASEcoord: 31..50
score: 51.14
coord: 72..91
score: 43.0
coord: 164..184
score: 61.09
coord: 373..388
score: 74.46
coord: 119..137
score: 67.07
coord: 54..71
score: 44.76
coord: 138..157
score: 68.29
coord: 416..435
score: 64.29
coord: 98..117
score: 53.57
IPR015422Pyridoxal phosphate-dependent transferase domain 1GENE3DG3DSA:3.90.1150.10coord: 401..500
e-value: 1.8E-30
score: 106.8
IPR002129Pyridoxal phosphate-dependent decarboxylasePFAMPF00282Pyridoxal_deCcoord: 60..435
e-value: 5.5E-150
score: 499.2
IPR015421Pyridoxal phosphate-dependent transferase, major domainGENE3DG3DSA:3.40.640.10coord: 107..400
e-value: 1.8E-112
score: 377.0
IPR021115Pyridoxal-phosphate binding sitePROSITEPS00392DDC_GAD_HDC_YDCcoord: 319..340
IPR015424Pyridoxal phosphate-dependent transferaseSUPERFAMILYSSF53383PLP-dependent transferasescoord: 26..495