Nuclear distribution protein nudE-like 1

Overview
NameNuclear distribution protein nudE-like 1
Smed IDSMED30020436
Length (bp)1429
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nuclear distribution protein nudE-like 1 (SMED30020436) t-SNE clustered cells

Violin plots show distribution of expression levels for Nuclear distribution protein nudE-like 1 (SMED30020436) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nuclear distribution protein nudE-like 1 (SMED30020436) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nuclear distribution protein nudE-like 1 (SMED30020436) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020436

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30020436SMESG000016071.1 HO006501.1ncbi_smed_estsPMID:22411224
Cowles et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30020436SMESG000016071.1 HO006501.1ncbi_smed_estsPMID:22411224
Cowles et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30020436SMESG000016071.1 HO006501.1ncbi_smed_estsPMID:22411224
Cowles et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30020436SMESG000016071.1 HO006501.1ncbi_smed_estsPMID:22411224
Cowles et al., 2012
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymaSMED30020436SMESG000016071.1 HO006501.1ncbi_smed_estsPMID:22411224
Cowles et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30020436SMESG000016071.1 dd_Smed_v4_1670_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020436SMESG000016071.1 dd_Smed_v4_1670_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Human
Match: NDE1 (nudE neurodevelopment protein 1 [Source:HGNC Symbol;Acc:HGNC:17619])

HSP 1 Score: 168.318 bits (425), Expect = 1.962e-47
Identity = 131/291 (45.02%), Postives = 181/291 (62.20%), Query Frame = 3
Query:   72 FQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSA 944
            F S EEE  YW++ A   ++   +TQEE + ++  SR+ E ELE QL   E+RN++L+  N++L +ELE +  +F    +   +QIS  +D++ + K  K  LQKYIRELEQ NDDLERAKR T+MSL+DFE++LN AIE+NA+LE+EL+EKE L+E+VQRLK+EARDLRQ+L V++        K ++    + +S+  ER D           Q   S+P   I   G S S+ N P S   G        ++      LTPAARISALN+V D+LRKVGA+E KL S 
Sbjct:    8 FSSEEEEANYWKDLAMTYKQRAENTQEELREFQEGSREYEAELETQLQQIETRNRDLLSENNRLRMELETIKEKFEVQHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQRLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQQ--------KQEKPRTPMPSSVEAERTD--------TAVQATGSVPSTPIAHRGPS-SSLNTPGSFRRGL-------DDSTGGTPLTPAARISALNIVGDLLRKVGALESKLASC 274          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Human
Match: NDE1 (nudE neurodevelopment protein 1 [Source:HGNC Symbol;Acc:HGNC:17619])

HSP 1 Score: 168.318 bits (425), Expect = 1.962e-47
Identity = 131/291 (45.02%), Postives = 181/291 (62.20%), Query Frame = 3
Query:   72 FQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSA 944
            F S EEE  YW++ A   ++   +TQEE + ++  SR+ E ELE QL   E+RN++L+  N++L +ELE +  +F    +   +QIS  +D++ + K  K  LQKYIRELEQ NDDLERAKR T+MSL+DFE++LN AIE+NA+LE+EL+EKE L+E+VQRLK+EARDLRQ+L V++        K ++    + +S+  ER D           Q   S+P   I   G S S+ N P S   G        ++      LTPAARISALN+V D+LRKVGA+E KL S 
Sbjct:    8 FSSEEEEANYWKDLAMTYKQRAENTQEELREFQEGSREYEAELETQLQQIETRNRDLLSENNRLRMELETIKEKFEVQHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQRLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQQ--------KQEKPRTPMPSSVEAERTD--------TAVQATGSVPSTPIAHRGPS-SSLNTPGSFRRGL-------DDSTGGTPLTPAARISALNIVGDLLRKVGALESKLASC 274          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Human
Match: NDE1 (nudE neurodevelopment protein 1 [Source:HGNC Symbol;Acc:HGNC:17619])

HSP 1 Score: 168.318 bits (425), Expect = 1.962e-47
Identity = 131/291 (45.02%), Postives = 181/291 (62.20%), Query Frame = 3
Query:   72 FQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSA 944
            F S EEE  YW++ A   ++   +TQEE + ++  SR+ E ELE QL   E+RN++L+  N++L +ELE +  +F    +   +QIS  +D++ + K  K  LQKYIRELEQ NDDLERAKR T+MSL+DFE++LN AIE+NA+LE+EL+EKE L+E+VQRLK+EARDLRQ+L V++        K ++    + +S+  ER D           Q   S+P   I   G S S+ N P S   G        ++      LTPAARISALN+V D+LRKVGA+E KL S 
Sbjct:    8 FSSEEEEANYWKDLAMTYKQRAENTQEELREFQEGSREYEAELETQLQQIETRNRDLLSENNRLRMELETIKEKFEVQHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQRLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQQ--------KQEKPRTPMPSSVEAERTD--------TAVQATGSVPSTPIAHRGPS-SSLNTPGSFRRGL-------DDSTGGTPLTPAARISALNIVGDLLRKVGALESKLASC 274          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Human
Match: NDE1 (nudE neurodevelopment protein 1 [Source:HGNC Symbol;Acc:HGNC:17619])

HSP 1 Score: 168.318 bits (425), Expect = 1.962e-47
Identity = 131/291 (45.02%), Postives = 181/291 (62.20%), Query Frame = 3
Query:   72 FQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSA 944
            F S EEE  YW++ A   ++   +TQEE + ++  SR+ E ELE QL   E+RN++L+  N++L +ELE +  +F    +   +QIS  +D++ + K  K  LQKYIRELEQ NDDLERAKR T+MSL+DFE++LN AIE+NA+LE+EL+EKE L+E+VQRLK+EARDLRQ+L V++        K ++    + +S+  ER D           Q   S+P   I   G S S+ N P S   G        ++      LTPAARISALN+V D+LRKVGA+E KL S 
Sbjct:    8 FSSEEEEANYWKDLAMTYKQRAENTQEELREFQEGSREYEAELETQLQQIETRNRDLLSENNRLRMELETIKEKFEVQHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQRLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQQ--------KQEKPRTPMPSSVEAERTD--------TAVQATGSVPSTPIAHRGPS-SSLNTPGSFRRGL-------DDSTGGTPLTPAARISALNIVGDLLRKVGALESKLASC 274          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Human
Match: NDEL1 (nudE neurodevelopment protein 1 like 1 [Source:HGNC Symbol;Acc:HGNC:17620])

HSP 1 Score: 151.754 bits (382), Expect = 2.514e-41
Identity = 122/307 (39.74%), Postives = 185/307 (60.26%), Query Frame = 3
Query:   69 DFQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSAAHRGLSESESSYPNY 989
            DF S++EE  YW+  +   ++   + ++E   ++  SR+LE ELE QL   E RN++L   N +L  E+E L  +     A   +Q+S  +D++++ +  K  L KY+RELEQ NDDLERAKR T++SL+DFE++LN AIE+NA+LE+EL+EKE+L+ +VQRLK+EARDLRQ+L V+E    Q+V +      A ++  ++       C K     Q  LS+P   +     +E+    P +  +G+               LTP+ARISALN+V D+LRKVGA+E KL  AA R  ++ ++S  +Y
Sbjct:    8 DFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQRLKYEVEALKEKLEHQYAQSYKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVRER--QQEVTRKS----APSSPTLD-------CEKMDSAVQASLSLPATPVGKG--TENTFPSPKAIPNGF-----------GTSPLTPSARISALNIVGDLLRKVGALESKL--AACRNFAKDQASRKSY 286          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Fly
Match: nudE (gene:FBgn0036059 transcript:FBtr0113158)

HSP 1 Score: 101.293 bits (251), Expect = 1.792e-23
Identity = 106/339 (31.27%), Postives = 178/339 (52.51%), Query Frame = 3
Query:   72 FQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNL-ELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEM---SLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGY----LNYS-------------ARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSAAHRGLSESESSYPNYGSRTPSRHRMSE 1025
            F S+E+E  YW+ ++K   +E  D ++E+  +   SR++E E++  L+  +S  K+L     KL + E EN S++    +  ++  +S+ + ++  +K D+ T++ Y+R+LEQ NDDLERA R+   S+++FE+ L+ A EKNA LE E++EK  L E +QRL +E RDL+Q+L VK      +N     +  D   + +SM                  +  S+P + I++NG    + N   +R++      LN S                 N ++ +S+ P++R +ALN+V+DMLRK+ A+E KL             +Y   G   P RHR S+
Sbjct:    7 FNSVEDECRYWKERSKQYHKEWTDVKQEYDEFVEQSREMEIEMDATLDQKQSIIKDLTA---KLTMFERENESLKLKLESHGID--MSNMEKQLETVKKDRDTMKVYLRQLEQKNDDLERAHRILNESIENFEKMLDQAYEKNALLELEVDEKGLLQEKLQRLMDETRDLKQELNVKSRFTPVVNGTSVPTANDTNTVNSSM-----------------NSSASLP-NGIVANGELVKHDNAVATRATSVSVNALNGSLVNRNEYNQQHSLKNPENQINGNSMNPSSRTTALNIVADMLRKLNAMETKL------------KTYRENGQPMPQRHRSSQ 310          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Fly
Match: nudE (gene:FBgn0036059 transcript:FBtr0345695)

HSP 1 Score: 101.293 bits (251), Expect = 1.792e-23
Identity = 106/339 (31.27%), Postives = 178/339 (52.51%), Query Frame = 3
Query:   72 FQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNL-ELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEM---SLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGY----LNYS-------------ARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSAAHRGLSESESSYPNYGSRTPSRHRMSE 1025
            F S+E+E  YW+ ++K   +E  D ++E+  +   SR++E E++  L+  +S  K+L     KL + E EN S++    +  ++  +S+ + ++  +K D+ T++ Y+R+LEQ NDDLERA R+   S+++FE+ L+ A EKNA LE E++EK  L E +QRL +E RDL+Q+L VK      +N     +  D   + +SM                  +  S+P + I++NG    + N   +R++      LN S                 N ++ +S+ P++R +ALN+V+DMLRK+ A+E KL             +Y   G   P RHR S+
Sbjct:    7 FNSVEDECRYWKERSKQYHKEWTDVKQEYDEFVEQSREMEIEMDATLDQKQSIIKDLTA---KLTMFERENESLKLKLESHGID--MSNMEKQLETVKKDRDTMKVYLRQLEQKNDDLERAHRILNESIENFEKMLDQAYEKNALLELEVDEKGLLQEKLQRLMDETRDLKQELNVKSRFTPVVNGTSVPTANDTNTVNSSM-----------------NSSASLP-NGIVANGELVKHDNAVATRATSVSVNALNGSLVNRNEYNQQHSLKNPENQINGNSMNPSSRTTALNIVADMLRKLNAMETKL------------KTYRENGQPMPQRHRSSQ 310          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Fly
Match: nudE (gene:FBgn0036059 transcript:FBtr0113159)

HSP 1 Score: 89.7373 bits (221), Expect = 3.784e-19
Identity = 95/302 (31.46%), Postives = 164/302 (54.30%), Query Frame = 3
Query:   72 FQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNL-ELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEM---SLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGY----LNYS-------------ARSNNFVSNHSLTPAARISALNLVSDMLRKV 914
            F S+E+E  YW+ ++K   +E  D ++E+  +   SR++E E++  L+  +S  K+L     KL + E EN S++    +  ++  +S+ + ++  +K D+ T++ Y+R+LEQ NDDLERA R+   S+++FE+ L+ A EKNA LE E++EK  L E +QRL +E RDL+Q+L VK      +N     +  D   + +SM                  +  S+P + I++NG    + N   +R++      LN S                 N ++ +S+ P++R +ALN+V+DMLRK+
Sbjct:    7 FNSVEDECRYWKERSKQYHKEWTDVKQEYDEFVEQSREMEIEMDATLDQKQSIIKDLTA---KLTMFERENESLKLKLESHGID--MSNMEKQLETVKKDRDTMKVYLRQLEQKNDDLERAHRILNESIENFEKMLDQAYEKNALLELEVDEKGLLQEKLQRLMDETRDLKQELNVKSRFTPVVNGTSVPTANDTNTVNSSM-----------------NSSASLP-NGIVANGELVKHDNAVATRATSVSVNALNGSLVNRNEYNQQHSLKNPENQINGNSMNPSSRTTALNIVADMLRKL 285          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Fly
Match: nudE (gene:FBgn0036059 transcript:FBtr0076344)

HSP 1 Score: 78.1814 bits (191), Expect = 1.300e-15
Identity = 68/177 (38.42%), Postives = 114/177 (64.41%), Query Frame = 3
Query:   72 FQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNL-ELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVK 599
            F S+E+E  YW+ ++K   +E  D ++E+  +   SR++E E++  L+  +S  K+L     KL + E EN S++    +  ++  +S+ + ++  +K D+ T++ Y+R+LEQ NDDLERA R+   S+++FE+ L+ A EKNA LE E++EK  L E +QRL +E RDL+Q+L VK
Sbjct:    7 FNSVEDECRYWKERSKQYHKEWTDVKQEYDEFVEQSREMEIEMDATLDQKQSIIKDLTA---KLTMFERENESLKLKLESHGID--MSNMEKQLETVKKDRDTMKVYLRQLEQKNDDLERAHRILNESIENFEKMLDQAYEKNALLELEVDEKGLLQEKLQRLMDETRDLKQELNVK 178          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Fly
Match: nudE (gene:FBgn0036059 transcript:FBtr0114600)

HSP 1 Score: 77.0258 bits (188), Expect = 2.021e-15
Identity = 68/177 (38.42%), Postives = 114/177 (64.41%), Query Frame = 3
Query:   72 FQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNL-ELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVK 599
            F S+E+E  YW+ ++K   +E  D ++E+  +   SR++E E++  L+  +S  K+L     KL + E EN S++    +  ++  +S+ + ++  +K D+ T++ Y+R+LEQ NDDLERA R+   S+++FE+ L+ A EKNA LE E++EK  L E +QRL +E RDL+Q+L VK
Sbjct:    7 FNSVEDECRYWKERSKQYHKEWTDVKQEYDEFVEQSREMEIEMDATLDQKQSIIKDLTA---KLTMFERENESLKLKLESHGID--MSNMEKQLETVKKDRDTMKVYLRQLEQKNDDLERAHRILNESIENFEKMLDQAYEKNALLELEVDEKGLLQEKLQRLMDETRDLKQELNVK 178          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Zebrafish
Match: ndel1b (nudE neurodevelopment protein 1-like 1b [Source:NCBI gene;Acc:333957])

HSP 1 Score: 151.754 bits (382), Expect = 2.622e-41
Identity = 134/355 (37.75%), Postives = 193/355 (54.37%), Query Frame = 3
Query:   72 FQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSAAHRGLSESESSYPNYGS---------RTPSRHRMSESVITNGYMRQNDNDAFESEICATPVASP 1109
            F S +EEI+YW+  +   ++   D QEE Q ++  SR+LE ELE QL   E R ++L   N +L  E++ L  +  +  A   +QIS  +D++ + +  K  L KY+RELEQ NDDLERAKR T+ SL+DFE++LN AIE+NA+LE+EL+EKE+L+ +VQRLK+EARDLRQ+L V+E       + SD       T M           K+    Q  LS+P   +           HP      ++   A +N   +   LTP+ARISALN+V D+LRKVGA+E KL  AA R  ++ +++  NY +          T   H +  +      M   D  A  + I +    SP
Sbjct:    9 FSSKDEEIDYWKCLSLKYKKSCHDAQEELQEFQEGSRELEAELEAQLGQAEHRIRDLQSENQRLKSEVDILKEKLEQQYAQSYKQISMLEDDLLQTRGIKEQLHKYVRELEQANDDLERAKRATITSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVRE-------RTSD------VTRMSAPSSPTLDIDKTDSAVQASLSLPATPV------GKTMEHP------FIGTKALTNGCGNGSPLTPSARISALNIVGDLLRKVGALESKL--AACRNFAKDQAARKNYTTGNGNLINSNATKFSHSLHTTYFDKTTMNGLDPGALSAAIASPRAVSP 336          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Zebrafish
Match: ndel1b (nudE neurodevelopment protein 1-like 1b [Source:NCBI gene;Acc:333957])

HSP 1 Score: 151.754 bits (382), Expect = 2.622e-41
Identity = 134/355 (37.75%), Postives = 193/355 (54.37%), Query Frame = 3
Query:   72 FQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSAAHRGLSESESSYPNYGS---------RTPSRHRMSESVITNGYMRQNDNDAFESEICATPVASP 1109
            F S +EEI+YW+  +   ++   D QEE Q ++  SR+LE ELE QL   E R ++L   N +L  E++ L  +  +  A   +QIS  +D++ + +  K  L KY+RELEQ NDDLERAKR T+ SL+DFE++LN AIE+NA+LE+EL+EKE+L+ +VQRLK+EARDLRQ+L V+E       + SD       T M           K+    Q  LS+P   +           HP      ++   A +N   +   LTP+ARISALN+V D+LRKVGA+E KL  AA R  ++ +++  NY +          T   H +  +      M   D  A  + I +    SP
Sbjct:    9 FSSKDEEIDYWKCLSLKYKKSCHDAQEELQEFQEGSRELEAELEAQLGQAEHRIRDLQSENQRLKSEVDILKEKLEQQYAQSYKQISMLEDDLLQTRGIKEQLHKYVRELEQANDDLERAKRATITSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVRE-------RTSD------VTRMSAPSSPTLDIDKTDSAVQASLSLPATPV------GKTMEHP------FIGTKALTNGCGNGSPLTPSARISALNIVGDLLRKVGALESKL--AACRNFAKDQAARKNYTTGNGNLINSNATKFSHSLHTTYFDKTTMNGLDPGALSAAIASPRAVSP 336          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Zebrafish
Match: ndel1b (nudE neurodevelopment protein 1-like 1b [Source:NCBI gene;Acc:333957])

HSP 1 Score: 151.754 bits (382), Expect = 2.622e-41
Identity = 134/355 (37.75%), Postives = 193/355 (54.37%), Query Frame = 3
Query:   72 FQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSAAHRGLSESESSYPNYGS---------RTPSRHRMSESVITNGYMRQNDNDAFESEICATPVASP 1109
            F S +EEI+YW+  +   ++   D QEE Q ++  SR+LE ELE QL   E R ++L   N +L  E++ L  +  +  A   +QIS  +D++ + +  K  L KY+RELEQ NDDLERAKR T+ SL+DFE++LN AIE+NA+LE+EL+EKE+L+ +VQRLK+EARDLRQ+L V+E       + SD       T M           K+    Q  LS+P   +           HP      ++   A +N   +   LTP+ARISALN+V D+LRKVGA+E KL  AA R  ++ +++  NY +          T   H +  +      M   D  A  + I +    SP
Sbjct:    9 FSSKDEEIDYWKCLSLKYKKSCHDAQEELQEFQEGSRELEAELEAQLGQAEHRIRDLQSENQRLKSEVDILKEKLEQQYAQSYKQISMLEDDLLQTRGIKEQLHKYVRELEQANDDLERAKRATITSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVRE-------RTSD------VTRMSAPSSPTLDIDKTDSAVQASLSLPATPV------GKTMEHP------FIGTKALTNGCGNGSPLTPSARISALNIVGDLLRKVGALESKL--AACRNFAKDQAARKNYTTGNGNLINSNATKFSHSLHTTYFDKTTMNGLDPGALSAAIASPRAVSP 336          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Zebrafish
Match: ndel1a (nudE neurodevelopment protein 1-like 1a [Source:NCBI gene;Acc:394244])

HSP 1 Score: 142.51 bits (358), Expect = 5.558e-38
Identity = 126/309 (40.78%), Postives = 180/309 (58.25%), Query Frame = 3
Query:   72 FQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSI---PLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSAAHRGLSESESSYPNY 989
            F + EEEI++W+  +   ++   + QEE   ++  SR+LE ELE QL   E R ++L   N +L  EL++L  +     A   +QIS  +D++++ +  K  L KY+RELEQ NDDLERAKR T+ SL+DFE++LN AIE+NA+LE+EL+EKE+L+ +VQRLK+EARDLRQ+L V+             D  +  T M           K+    Q  LS+   PL   L N F+          S   L       N  +N +LTP+ARISALN+V D+LRKVGA+E KL  AA R  ++ +++  NY
Sbjct:    9 FTTKEEEIDFWKALSLKYKKSYKEAQEELLEFQEGSRELETELETQLGQAEHRIRDLQADNQRLQHELDSLKEKLEYQYAQSYKQISVLEDDLSQTRGIKEQLHKYVRELEQANDDLERAKRATITSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVR-------------DTRSEVTRMSAPSSPTPDNDKTDSAVQASLSLPATPLSKNLDNAFT----------SQTVL------ANGSTNAALTPSARISALNIVGDLLRKVGALESKL--AACRNFAKDQAARKNY 286          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Zebrafish
Match: ndel1a (nudE neurodevelopment protein 1-like 1a [Source:NCBI gene;Acc:394244])

HSP 1 Score: 142.51 bits (358), Expect = 5.558e-38
Identity = 126/309 (40.78%), Postives = 180/309 (58.25%), Query Frame = 3
Query:   72 FQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSI---PLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSAAHRGLSESESSYPNY 989
            F + EEEI++W+  +   ++   + QEE   ++  SR+LE ELE QL   E R ++L   N +L  EL++L  +     A   +QIS  +D++++ +  K  L KY+RELEQ NDDLERAKR T+ SL+DFE++LN AIE+NA+LE+EL+EKE+L+ +VQRLK+EARDLRQ+L V+             D  +  T M           K+    Q  LS+   PL   L N F+          S   L       N  +N +LTP+ARISALN+V D+LRKVGA+E KL  AA R  ++ +++  NY
Sbjct:    9 FTTKEEEIDFWKALSLKYKKSYKEAQEELLEFQEGSRELETELETQLGQAEHRIRDLQADNQRLQHELDSLKEKLEYQYAQSYKQISVLEDDLSQTRGIKEQLHKYVRELEQANDDLERAKRATITSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVR-------------DTRSEVTRMSAPSSPTPDNDKTDSAVQASLSLPATPLSKNLDNAFT----------SQTVL------ANGSTNAALTPSARISALNIVGDLLRKVGALESKL--AACRNFAKDQAARKNY 286          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Xenopus
Match: nde1 (nudE neurodevelopment protein 1 [Source:NCBI gene;Acc:493358])

HSP 1 Score: 154.066 bits (388), Expect = 2.455e-42
Identity = 126/294 (42.86%), Postives = 179/294 (60.88%), Query Frame = 3
Query:   72 FQSIEEEIEYWRN---KAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSA 944
            F S+EEEI YW++   K K   EE    Q+E Q ++ +SR+ E ELE QL   E RN++L   N++L +EL+ +  ++ E  +    QI   + ++++ K  +  LQKYIRELEQ NDDLERAKR T+MSL+DFE++LN AIE+NA+LE+EL+EKE L+E+VQRLK+EARDLRQ+L V++     +      + E + TS+           K+S+      S PL  +   G + S    P       L++    ++  S   LTP ARISALN+V D+LRKVGA+E KL S 
Sbjct:    9 FNSVEEEIIYWKSVAMKYKTCSEE---AQQELQEFQEASREYEAELEAQLQQIEGRNRDLFSENNRLRMELDGIKEKYEEQHSENYVQICSLEGDLSQTKAVRDQLQKYIRELEQANDDLERAKRATIMSLEDFEQRLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQQKQEKPKSNMGSPETERMDTSV-----------KASVAIP---SAPLTPLSQRGCA-STLTSP-------LSFRTSLDDGYSGTPLTPCARISALNIVGDLLRKVGALESKLASC 277          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Xenopus
Match: nde1 (nudE neurodevelopment protein 1 [Source:NCBI gene;Acc:493358])

HSP 1 Score: 154.066 bits (388), Expect = 3.080e-42
Identity = 125/294 (42.52%), Postives = 179/294 (60.88%), Query Frame = 3
Query:   72 FQSIEEEIEYWRN---KAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSA 944
            F S+EEEI YW++   K K   EE    Q+E Q ++ +SR+ E ELE QL   E RN++L   N++L +EL+ +  ++ E  +    QI   + ++++ K  +  LQKYIRELEQ NDDLERAKR T+MSL+DFE++LN AIE+NA+LE+EL+EKE L+E+VQRLK+EARDLRQ+L V++     +      + E + TS+           K+S+      S PL  +   G +        S  +  L++    ++  S   LTP ARISALN+V D+LRKVGA+E KL S 
Sbjct:    9 FNSVEEEIIYWKSVAMKYKTCSEE---AQQELQEFQEASREYEAELEAQLQQIEGRNRDLFSENNRLRMELDGIKEKYEEQHSENYVQICSLEGDLSQTKAVRDQLQKYIRELEQANDDLERAKRATIMSLEDFEQRLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQQKQEKPKSNMGSPETERMDTSV-----------KASVAIP---SAPLTPLSQRGCA--------STLTSPLSFRTSLDDGYSGTPLTPCARISALNIVGDLLRKVGALESKLASC 277          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Xenopus
Match: cfap61 (cilia and flagella associated protein 61 [Source:Xenbase;Acc:XB-GENE-5796298])

HSP 1 Score: 153.295 bits (386), Expect = 5.573e-42
Identity = 120/290 (41.38%), Postives = 178/290 (61.38%), Query Frame = 3
Query:   69 DFQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLT 938
            +F S +EEI YWR  AK L++   + ++E   ++  SR+LE ELE QL   E RN++L+  N +L  E+E+L  +     A   +Q+S  +DE+ R ++ K  L KY+RELEQ NDDLERAKR T++SL+DFE++LN AIE+NA+LE+EL+EKE+L+ +VQRLK+EARDLRQ+L V+E       +++D   ++  +S   +      C K+    Q  LS+P   +     S+++   P    +G+               LTP+ARISALN+V D+LRKVG +  KL 
Sbjct:    8 EFLSPKEEIVYWRELAKRLKQSYQEARDELIEFQEGSRELEAELETQLVQAEQRNRDLLSDNQRLKCEVESLKEKLEHQYAQSYKQVSLLEDELARARSIKDQLHKYVRELEQANDDLERAKRATIVSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVRE-------RQTDGTRKSAPSSPTLD------CDKTDSAVQASLSLPATPV--GKVSDNSFTPPKGIPNGF-----------GTTPLTPSARISALNIVGDLLRKVGVLLKKLA 271          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Xenopus
Match: nde1 (nudE neurodevelopment protein 1 [Source:NCBI gene;Acc:493358])

HSP 1 Score: 153.68 bits (387), Expect = 6.772e-42
Identity = 127/297 (42.76%), Postives = 180/297 (60.61%), Query Frame = 3
Query:   72 FQSIEEEIEYWRN---KAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSS---GYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSA 944
            F S+EEEI YW++   K K   EE    Q+E Q ++ +SR+ E ELE QL   E RN++L   N++L +EL+ +  ++ E  +    QI   + ++++ K  +  LQKYIRELEQ NDDLERAKR T+MSL+DFE++LN AIE+NA+LE+EL+EKE L+E+VQRLK+EARDLRQ+L V++     +      + E + TS+           K+S+      S PL  +   G + + ++    R+S   GY           S   LTP ARISALN+V D+LRKVGA+E KL S 
Sbjct:    9 FNSVEEEIIYWKSVAMKYKTCSEE---AQQELQEFQEASREYEAELEAQLQQIEGRNRDLFSENNRLRMELDGIKEKYEEQHSENYVQICSLEGDLSQTKAVRDQLQKYIRELEQANDDLERAKRATIMSLEDFEQRLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQQKQEKPKSNMGSPETERMDTSV-----------KASVAIP---SAPLTPLSQRGCASTLTSPLSFRTSLDDGY-----------SGTPLTPCARISALNIVGDLLRKVGALESKLASC 277          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Xenopus
Match: cfap61 (cilia and flagella associated protein 61 [Source:Xenbase;Acc:XB-GENE-5796298])

HSP 1 Score: 153.295 bits (386), Expect = 8.168e-42
Identity = 123/308 (39.94%), Postives = 181/308 (58.77%), Query Frame = 3
Query:   69 DFQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSAAHRGLSESESSYPNYG 992
            +F S +EEI YWR  AK L++   + ++E   ++  SR+LE ELE QL   E RN++L+  N +L  E+E+L  +     A   +Q+S  +DE+ R ++ K  L KY+RELEQ NDDLERAKR T++SL+DFE++LN AIE+NA+LE+EL+EKE+L+ +VQRLK+EARDLRQ+L V+E       +++D   ++  +S   +      C K+    Q  LS+P   +     S+++   P    +G+               LTP+ARISALN+V D+LRKVG   +        G   S  SY   G
Sbjct:    8 EFLSPKEEIVYWRELAKRLKQSYQEARDELIEFQEGSRELEAELETQLVQAEQRNRDLLSDNQRLKCEVESLKEKLEHQYAQSYKQVSLLEDELARARSIKDQLHKYVRELEQANDDLERAKRATIVSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVRE-------RQTDGTRKSAPSSPTLD------CDKTDSAVQASLSLPATPV--GKVSDNSFTPPKGIPNGF-----------GTTPLTPSARISALNIVGDLLRKVGVSNYGACRKWATGDQASRKSYAPVG 289          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Mouse
Match: Nde1 (nudE neurodevelopment protein 1 [Source:MGI Symbol;Acc:MGI:1914453])

HSP 1 Score: 170.629 bits (431), Expect = 1.299e-48
Identity = 138/315 (43.81%), Postives = 191/315 (60.63%), Query Frame = 3
Query:   72 FQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSAAH--RGLSESESSYPNYGSRTPSR 1010
            F+S EEE  YWR+ A   ++   +TQEE + ++  SR+ E ELE QL   E+RN++L+  N++L +ELE++  +F    +   +QIS  +D++ + K  K  LQKYIRELEQ NDDLERAKR T+MSL+DFE++LN AIE+NA+LE+EL+EKE L+E+VQRLK+EARDLRQ+L V++        K D+    +  S   +R D+          Q   S+P   +   G S S  N P     G        ++  S   LTPAARISALN+V D+LRKVGA+E KL S  +     S S +S P  G  T +R
Sbjct:    8 FESEEEETNYWRDLAMTYKQRAENTQEELREFQEGSREYEAELEAQLQQIETRNRDLLSENNRLRMELESVKEKFEMQHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQRLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQQ--------KQDKPRTPMPGSGQAKRTDM--------AVQATGSVPSTPVAHRGPS-SGLNTPGMFRRGL-------DSSTSGTPLTPAARISALNIVGDLLRKVGALESKLASCRNFMYDQSPSRTSGPASGRGTKNR 298          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Mouse
Match: Nde1 (nudE neurodevelopment protein 1 [Source:MGI Symbol;Acc:MGI:1914453])

HSP 1 Score: 170.244 bits (430), Expect = 1.383e-48
Identity = 138/315 (43.81%), Postives = 191/315 (60.63%), Query Frame = 3
Query:   72 FQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSAAH--RGLSESESSYPNYGSRTPSR 1010
            F+S EEE  YWR+ A   ++   +TQEE + ++  SR+ E ELE QL   E+RN++L+  N++L +ELE++  +F    +   +QIS  +D++ + K  K  LQKYIRELEQ NDDLERAKR T+MSL+DFE++LN AIE+NA+LE+EL+EKE L+E+VQRLK+EARDLRQ+L V++        K D+    +  S   +R D+          Q   S+P   +   G S S  N P     G        ++  S   LTPAARISALN+V D+LRKVGA+E KL S  +     S S +S P  G  T +R
Sbjct:    8 FESEEEETNYWRDLAMTYKQRAENTQEELREFQEGSREYEAELEAQLQQIETRNRDLLSENNRLRMELESVKEKFEMQHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQRLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQQ--------KQDKPRTPMPGSGQAKRTDM--------AVQATGSVPSTPVAHRGPS-SGLNTPGMFRRGL-------DSSTSGTPLTPAARISALNIVGDLLRKVGALESKLASCRNFMYDQSPSRTSGPASGRGTKNR 298          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Mouse
Match: Nde1 (nudE neurodevelopment protein 1 [Source:MGI Symbol;Acc:MGI:1914453])

HSP 1 Score: 170.629 bits (431), Expect = 2.140e-48
Identity = 143/349 (40.97%), Postives = 200/349 (57.31%), Query Frame = 3
Query:   72 FQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSAAH--RGLSESESSYPNYGSRTPSRHRMSESVITNGYMRQNDNDAFESEICATPVASPV 1112
            F+S EEE  YWR+ A   ++   +TQEE + ++  SR+ E ELE QL   E+RN++L+  N++L +ELE++  +F    +   +QIS  +D++ + K  K  LQKYIRELEQ NDDLERAKR T+MSL+DFE++LN AIE+NA+LE+EL+EKE L+E+VQRLK+EARDLRQ+L V++        K D+    +  S   +R D+          Q   S+P   +   G S S  N P     G        ++  S   LTPAARISALN+V D+LRKVGA+E KL S  +     S S +S P  G  T +R  +     +     +      E    A+  ASP 
Sbjct:    8 FESEEEETNYWRDLAMTYKQRAENTQEELREFQEGSREYEAELEAQLQQIETRNRDLLSENNRLRMELESVKEKFEMQHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQRLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQQ--------KQDKPRTPMPGSGQAKRTDM--------AVQATGSVPSTPVAHRGPS-SGLNTPGMFRRGL-------DSSTSGTPLTPAARISALNIVGDLLRKVGALESKLASCRNFMYDQSPSRTSGPASGRGTKNRDGVDRRPGSTSVGDKGSGKRLEFGKPASEPASPA 332          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Mouse
Match: Ndel1 (nudE neurodevelopment protein 1 like 1 [Source:MGI Symbol;Acc:MGI:1932915])

HSP 1 Score: 152.91 bits (385), Expect = 9.730e-42
Identity = 125/307 (40.72%), Postives = 185/307 (60.26%), Query Frame = 3
Query:   69 DFQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSAAHRGLSESESSYPNY 989
            DF S++EE  YW+  +   ++   + ++E   ++  SR+LE ELE QL   E RN++L   N +L  E+E L  +     A   +Q+S  +D++++ +  K  L KY+RELEQ NDDLERAKR T++SL+DFE++LN AIE+NA+LE+EL+EKE+L+ +VQRLK+EARDLRQ+L V+E    Q+V +      A ++  ++       C K     Q  LS+P   +   G    NS         + +  A  N F     LTP+ARISALN+V D+LRKVGA+E KL  AA R  ++ ++S  +Y
Sbjct:    8 DFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQRLKYEVEALKEKLEHQYAQSYKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVRER--QQEVTRKS----APSSPTLD-------CEKMDSAVQASLSLPATPV---GKGTENS---------FPSPKAIPNGF-GTSPLTPSARISALNIVGDLLRKVGALESKL--AACRNFAKDQASRKSY 286          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Mouse
Match: Ndel1 (nudE neurodevelopment protein 1 like 1 [Source:MGI Symbol;Acc:MGI:1932915])

HSP 1 Score: 151.754 bits (382), Expect = 1.239e-41
Identity = 125/307 (40.72%), Postives = 185/307 (60.26%), Query Frame = 3
Query:   69 DFQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSAAHRGLSESESSYPNY 989
            DF S++EE  YW+  +   ++   + ++E   ++  SR+LE ELE QL   E RN++L   N +L  E+E L  +     A   +Q+S  +D++++ +  K  L KY+RELEQ NDDLERAKR T++SL+DFE++LN AIE+NA+LE+EL+EKE+L+ +VQRLK+EARDLRQ+L V+E    Q+V +      A ++  ++       C K     Q  LS+P   +   G    NS         + +  A  N F     LTP+ARISALN+V D+LRKVGA+E KL  AA R  ++ ++S  +Y
Sbjct:    8 DFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQRLKYEVEALKEKLEHQYAQSYKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVRER--QQEVTRKS----APSSPTLD-------CEKMDSAVQASLSLPATPV---GKGTENS---------FPSPKAIPNGF-GTSPLTPSARISALNIVGDLLRKVGALESKL--AACRNFAKDQASRKSY 286          
BLAST of Nuclear distribution protein nudE-like 1 vs. UniProt/SwissProt
Match: sp|Q9ES39|NDE1_RAT (Nuclear distribution protein nudE homolog 1 OS=Rattus norvegicus OX=10116 GN=Nde1 PE=1 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 8.981e-48
Identity = 140/315 (44.44%), Postives = 191/315 (60.63%), Query Frame = 3
Query:   72 FQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSAAHRGLSESES--SYPNYGSRTPSR 1010
            F S EEE  YWR+ A   ++   +TQEE + ++  SR+ E ELE QL   E+RN++L+  N++L +ELE++  +F    +   +QIS  +D++   K  K  LQKYIRELEQ NDDLERAKR T+MSL+DFE++LN AIE+NA+LE+EL+EKE L+E+VQRLK+EARDLRQ+L V++        K D+    + +S   +R D+ +        Q   S P   I   G S S  N P +   G  + S       S   LTPAARISALN+V D+LRKVGA+E KL S  +    +S S  S P  G  T +R
Sbjct:    8 FGSEEEETNYWRDLAMTYKQRAENTQEELREFQEGSREYEAELETQLQQAETRNRDLLSENNRLRMELESVKEKFEMQHSEGYRQISALEDDLAHTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQRLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQQ--------KQDKPRTPMPSSGETKRTDMAV--------QATGSAPSTPITHQG-SSSGLNTPETFRCGLGSPS-------SGTPLTPAARISALNIVGDLLRKVGALESKLASCKNFMYDQSPSRKSGPALGRGTKNR 298          
BLAST of Nuclear distribution protein nudE-like 1 vs. UniProt/SwissProt
Match: sp|Q9CZA6|NDE1_MOUSE (Nuclear distribution protein nudE homolog 1 OS=Mus musculus OX=10090 GN=Nde1 PE=1 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 1.497e-47
Identity = 143/349 (40.97%), Postives = 200/349 (57.31%), Query Frame = 3
Query:   72 FQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSAAH--RGLSESESSYPNYGSRTPSRHRMSESVITNGYMRQNDNDAFESEICATPVASPV 1112
            F+S EEE  YWR+ A   ++   +TQEE + ++  SR+ E ELE QL   E+RN++L+  N++L +ELE++  +F    +   +QIS  +D++ + K  K  LQKYIRELEQ NDDLERAKR T+MSL+DFE++LN AIE+NA+LE+EL+EKE L+E+VQRLK+EARDLRQ+L V++        K D+    +  S   +R D+          Q   S+P   +   G S S  N P     G        ++  S   LTPAARISALN+V D+LRKVGA+E KL S  +     S S +S P  G  T +R  +     +     +      E    A+  ASP 
Sbjct:    8 FESEEEETNYWRDLAMTYKQRAENTQEELREFQEGSREYEAELEAQLQQIETRNRDLLSENNRLRMELESVKEKFEMQHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQRLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQQ--------KQDKPRTPMPGSGQAKRTDM--------AVQATGSVPSTPVAHRGPS-SGLNTPGMFRRGL-------DSSTSGTPLTPAARISALNIVGDLLRKVGALESKLASCRNFMYDQSPSRTSGPASGRGTKNRDGVDRRPGSTSVGDKGSGKRLEFGKPASEPASPA 332          
BLAST of Nuclear distribution protein nudE-like 1 vs. UniProt/SwissProt
Match: sp|Q9NXR1|NDE1_HUMAN (Nuclear distribution protein nudE homolog 1 OS=Homo sapiens OX=9606 GN=NDE1 PE=1 SV=3)

HSP 1 Score: 168.318 bits (425), Expect = 9.423e-47
Identity = 131/291 (45.02%), Postives = 181/291 (62.20%), Query Frame = 3
Query:   72 FQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSA 944
            F S EEE  YW++ A   ++   +TQEE + ++  SR+ E ELE QL   E+RN++L+  N++L +ELE +  +F    +   +QIS  +D++ + K  K  LQKYIRELEQ NDDLERAKR T+MSL+DFE++LN AIE+NA+LE+EL+EKE L+E+VQRLK+EARDLRQ+L V++        K ++    + +S+  ER D           Q   S+P   I   G S S+ N P S   G        ++      LTPAARISALN+V D+LRKVGA+E KL S 
Sbjct:    8 FSSEEEEANYWKDLAMTYKQRAENTQEELREFQEGSREYEAELETQLQQIETRNRDLLSENNRLRMELETIKEKFEVQHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQRLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQQ--------KQEKPRTPMPSSVEAERTD--------TAVQATGSVPSTPIAHRGPS-SSLNTPGSFRRGL-------DDSTGGTPLTPAARISALNIVGDLLRKVGALESKLASC 274          
BLAST of Nuclear distribution protein nudE-like 1 vs. UniProt/SwissProt
Match: sp|Q5ZMC9|NDE1_CHICK (Nuclear distribution protein nudE homolog 1 OS=Gallus gallus OX=9031 GN=NDE1 PE=2 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 1.939e-45
Identity = 128/303 (42.24%), Postives = 182/303 (60.07%), Query Frame = 3
Query:   54 DMTEVDFQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDD------LQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSA 944
            D  E  F S+EEE  YW+  A   ++   + QEE   ++  SR+ E ELE QL   ESRN++L+  N++L +ELE++  +F    +   +Q+S  +D++ + K  K  LQKYIRELEQ NDDLERAKR  +MSL+DFE++LN AIE+NA+LE+EL+EKE L+E+VQRLK+EARDLRQ+L V++        K ++    + TS+  ER D      L +    S++   +++IP  +    GF +S    P                      LTPAARISALN++ D+LRKVGA+E KL S 
Sbjct:    3 DSEEHHFSSVEEETRYWKELAMKYKQCAENIQEELCEFQEGSREYEAELETQLQQTESRNRDLLSENNRLRIELESVKEKFEMQHSEWYRQVSALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKRAAIMSLEDFEQRLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQQ--------KQEKPKTPMRTSLETERTDTAVQASLSLPSTPSLHRAPNINIPTPATFRRGFEDSYCATP----------------------LTPAARISALNIMGDLLRKVGALESKLASC 275          
BLAST of Nuclear distribution protein nudE-like 1 vs. UniProt/SwissProt
Match: sp|Q66IZ7|NDL1B_XENLA (Nuclear distribution protein nudE-like 1-B OS=Xenopus laevis OX=8355 GN=ndel1-b PE=2 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.050e-44
Identity = 130/313 (41.53%), Postives = 194/313 (61.98%), Query Frame = 3
Query:   69 DFQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSAAHRGLSESESSYPNYGSRTPS 1007
            +F S +EEI YWR  AK L++   + ++E   ++  SR+LE ELE QL   E RN++L+  N +L  E+++L  +     A   +Q+S  +DE+ R ++ K  L KY+RELEQ NDDLERAKR T++SL+DFE++LN AIE+NA+LE+EL+EKE+L+ +VQRLK+EARDLRQ+L V+E   +  ++KS     A ++  ++       C K+    Q  LS+P   +     SE++   P    +G+               LTP+ARISALN+V D+LRKVGA+E KL  AA R  ++ ++S  +Y   TP+
Sbjct:    8 EFLSPKEEIVYWRELAKRLKQSYQEARDELIEFQEGSRELEAELETQLIQAEQRNRDLLGDNQRLKCEVDSLKEKLEHQYAQSYKQVSLLEDELVRARSIKDQLHKYVRELEQANDDLERAKRATIVSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVRERQTD-GIRKS-----APSSPTLD-------CEKTDSSVQASLSLPATPV--GKISENSFTSPKGIPNGF-----------GTTPLTPSARISALNIVGDLLRKVGALESKL--AACRNFAKDQASRKSY---TPA 289          
BLAST of Nuclear distribution protein nudE-like 1 vs. TrEMBL
Match: A0A1S3IXS5 (nuclear distribution protein nudE homolog 1 isoform X4 OS=Lingula unguis OX=7574 GN=LOC106168309 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 7.056e-48
Identity = 141/338 (41.72%), Postives = 205/338 (60.65%), Query Frame = 3
Query:   54 DMTEVDFQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFS-ESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSAAH-------RGLSESESSYP-----------NYGSRTPSR 1010
            D ++  F S +EEI +WR KA+  +  L DT+EE + ++ISSR+LE ELE QL   +++N+ L   N++L +EL+++  +  +T  + ++Q+++ QD++ ++K  K  LQKYIRELEQTNDDLERAKR TV+SL+DFE++LN+AIE+NA+LE+EL+EKE+L ETVQRLK+EARDLRQ+L V+     ++ + SD                     KS +  QT      D I SN  + ES  + P + +         +N   S+  LTP ARISALN+V D+LRKVGA+E KL S  +       +G +    S P           N GS TP++
Sbjct:    2 DDSDKKFSSPQEEIAHWRRKAEEFKLSLEDTREELEEFQISSRELEAELETQLEQSDNKNRELHAANERLQMELDSIKEKLEQTQETYHKQLTELQDDLAQVKAFKDELQKYIRELEQTNDDLERAKRATVVSLEDFEQRLNLAIERNAFLESELDEKESLAETVQRLKDEARDLRQELGVRTRQAPEEPQSSD-------------------TEKSDMVVQT------DRIDSNKLAEESAPSTPRTPAQTGKALPIGANG--SSTPLTPTARISALNIVGDLLRKVGALESKLASCRNYVKDQPTKGNTPKAGSAPSPVNTPRSKKLNRGSATPAQ 312          
BLAST of Nuclear distribution protein nudE-like 1 vs. TrEMBL
Match: A0A1S3IX51 (nuclear distribution protein nudE homolog 1 isoform X4 OS=Lingula unguis OX=7574 GN=LOC106168309 PE=4 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.814e-47
Identity = 133/297 (44.78%), Postives = 192/297 (64.65%), Query Frame = 3
Query:   54 DMTEVDFQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFS-ESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTS 941
            D ++  F S +EEI +WR KA+  +  L DT+EE + ++ISSR+LE ELE QL   +++N+ L   N++L +EL+++  +  +T  + ++Q+++ QD++ ++K  K  LQKYIRELEQTNDDLERAKR TV+SL+DFE++LN+AIE+NA+LE+EL+EKE+L ETVQRLK+EARDLRQ+L V+     ++ + SD                     KS +  QT      D I SN  + ES  + P + +         +N   S+  LTP ARISALN+V D+LRKVGA+E KL S
Sbjct:    2 DDSDKKFSSPQEEIAHWRRKAEEFKLSLEDTREELEEFQISSRELEAELETQLEQSDNKNRELHAANERLQMELDSIKEKLEQTQETYHKQLTELQDDLAQVKAFKDELQKYIRELEQTNDDLERAKRATVVSLEDFEQRLNLAIERNAFLESELDEKESLAETVQRLKDEARDLRQELGVRTRQAPEEPQSSD-------------------TEKSDMVVQT------DRIDSNKLAEESAPSTPRTPAQTGKALPIGANG--SSTPLTPTARISALNIVGDLLRKVGALESKLAS 271          
BLAST of Nuclear distribution protein nudE-like 1 vs. TrEMBL
Match: A0A1S3IZ05 (nuclear distribution protein nudE homolog 1 isoform X3 OS=Lingula unguis OX=7574 GN=LOC106168309 PE=4 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 2.415e-47
Identity = 133/297 (44.78%), Postives = 192/297 (64.65%), Query Frame = 3
Query:   54 DMTEVDFQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFS-ESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTS 941
            D ++  F S +EEI +WR KA+  +  L DT+EE + ++ISSR+LE ELE QL   +++N+ L   N++L +EL+++  +  +T  + ++Q+++ QD++ ++K  K  LQKYIRELEQTNDDLERAKR TV+SL+DFE++LN+AIE+NA+LE+EL+EKE+L ETVQRLK+EARDLRQ+L V+     ++ + SD                     KS +  QT      D I SN  + ES  + P + +         +N   S+  LTP ARISALN+V D+LRKVGA+E KL S
Sbjct:    2 DDSDKKFSSPQEEIAHWRRKAEEFKLSLEDTREELEEFQISSRELEAELETQLEQSDNKNRELHAANERLQMELDSIKEKLEQTQETYHKQLTELQDDLAQVKAFKDELQKYIRELEQTNDDLERAKRATVVSLEDFEQRLNLAIERNAFLESELDEKESLAETVQRLKDEARDLRQELGVRTRQAPEEPQSSD-------------------TEKSDMVVQT------DRIDSNKLAEESAPSTPRTPAQTGKALPIGANG--SSTPLTPTARISALNIVGDLLRKVGALESKLAS 271          
BLAST of Nuclear distribution protein nudE-like 1 vs. TrEMBL
Match: A0A1S3IXS2 (nuclear distribution protein nudE homolog 1 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106168309 PE=4 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 3.020e-47
Identity = 133/297 (44.78%), Postives = 192/297 (64.65%), Query Frame = 3
Query:   54 DMTEVDFQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFS-ESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTS 941
            D ++  F S +EEI +WR KA+  +  L DT+EE + ++ISSR+LE ELE QL   +++N+ L   N++L +EL+++  +  +T  + ++Q+++ QD++ ++K  K  LQKYIRELEQTNDDLERAKR TV+SL+DFE++LN+AIE+NA+LE+EL+EKE+L ETVQRLK+EARDLRQ+L V+     ++ + SD                     KS +  QT      D I SN  + ES  + P + +         +N   S+  LTP ARISALN+V D+LRKVGA+E KL S
Sbjct:    2 DDSDKKFSSPQEEIAHWRRKAEEFKLSLEDTREELEEFQISSRELEAELETQLEQSDNKNRELHAANERLQMELDSIKEKLEQTQETYHKQLTELQDDLAQVKAFKDELQKYIRELEQTNDDLERAKRATVVSLEDFEQRLNLAIERNAFLESELDEKESLAETVQRLKDEARDLRQELGVRTRQAPEEPQSSD-------------------TEKSDMVVQT------DRIDSNKLAEESAPSTPRTPAQTGKALPIGANG--SSTPLTPTARISALNIVGDLLRKVGALESKLAS 271          
BLAST of Nuclear distribution protein nudE-like 1 vs. TrEMBL
Match: A0A1S3IXM2 (nuclear distribution protein nudE homolog 1 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106168309 PE=4 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 3.848e-47
Identity = 133/297 (44.78%), Postives = 192/297 (64.65%), Query Frame = 3
Query:   54 DMTEVDFQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFS-ESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTS 941
            D ++  F S +EEI +WR KA+  +  L DT+EE + ++ISSR+LE ELE QL   +++N+ L   N++L +EL+++  +  +T  + ++Q+++ QD++ ++K  K  LQKYIRELEQTNDDLERAKR TV+SL+DFE++LN+AIE+NA+LE+EL+EKE+L ETVQRLK+EARDLRQ+L V+     ++ + SD                     KS +  QT      D I SN  + ES  + P + +         +N   S+  LTP ARISALN+V D+LRKVGA+E KL S
Sbjct:    2 DDSDKKFSSPQEEIAHWRRKAEEFKLSLEDTREELEEFQISSRELEAELETQLEQSDNKNRELHAANERLQMELDSIKEKLEQTQETYHKQLTELQDDLAQVKAFKDELQKYIRELEQTNDDLERAKRATVVSLEDFEQRLNLAIERNAFLESELDEKESLAETVQRLKDEARDLRQELGVRTRQAPEEPQSSD-------------------TEKSDMVVQT------DRIDSNKLAEESAPSTPRTPAQTGKALPIGANG--SSTPLTPTARISALNIVGDLLRKVGALESKLAS 271          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Cavefish
Match: ndel1b (nuclear distribution protein nudE-like 1-B [Source:NCBI gene;Acc:103042308])

HSP 1 Score: 154.451 bits (389), Expect = 1.793e-42
Identity = 127/308 (41.23%), Postives = 182/308 (59.09%), Query Frame = 3
Query:   72 FQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSAAHRGLSESESSYPNYGS 995
            F S +EEIEYW+N +   ++   D QEE Q ++  SR+LE ELE QL   E R ++L   N +L  E++NL  +  +  A   +QIS  +D++ + +  K  L KY+RELEQ NDDLERAKR T+ SL+DFE++LN AIE+NA+LE+EL+EKE+L+ +VQRLK+EARDLRQ+L V+E + +              T M           K     Q  LS+P   +           HP      +++    +N   S+  LTP+ARISALN+V D+LRKVGA+E KL  AA R  ++ +++  NY +
Sbjct:    9 FTSKDEEIEYWKNLSLKYKKSYHDAQEELQEFQEGSRELEAELEAQLGQAEHRIRDLQAENQRLKCEVDNLKEKLEQQYAQSYKQISVLEDDLGQTRCIKEQLHKYVRELEQANDDLERAKRATITSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVRERTTD-------------VTRMSAPSSPTLDTDKMDTAVQASLSLPATPV------GKTIEHP------FMSQKVLTNGCGSS-PLTPSARISALNIVGDLLRKVGALESKL--AACRNFAKDQAARKNYST 288          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Cavefish
Match: ndel1a (nuclear distribution protein nudE-like 1-A [Source:NCBI gene;Acc:103024498])

HSP 1 Score: 145.591 bits (366), Expect = 3.245e-39
Identity = 127/309 (41.10%), Postives = 181/309 (58.58%), Query Frame = 3
Query:   72 FQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSI---PLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSAAHRGLSESESSYPNY 989
            F S +EEI++W+  +   ++   + QEE   ++  SR+LE ELE QL   E R ++L   N +L  EL+ L  +  +  A   +QIS  +D++ + ++ K  L KY+RELEQ NDDLERAKR T+ SL+DFE++LN AIE+NA+LE+EL+EKE+L+ +VQRLK+EARDLRQ+L V+E              +   T M           K+    Q  LS+   PL   L N F+               N  A +N   +N +LTPAARISALN+V D+LRKVGA+E KL  AA R  ++ +++  NY
Sbjct:    9 FSSKDEEIDFWKALSLKYKKSSKEAQEELLEFQEGSRELEAELETQLGQAEHRLRDLQADNQRLQHELDTLKEKLEQQYAQSYKQISVLEDDLGQTRSIKEQLHKYVRELEQANDDLERAKRATITSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVRER-------------QPEVTRMSAPSSPTPDNEKTDSAVQASLSLPATPLSQSLDNAFN---------------NQKALANG-CNNSALTPAARISALNIVGDLLRKVGALESKL--AACRNFAKDQAARKNY 286          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Cavefish
Match: ndel1a (nuclear distribution protein nudE-like 1-A [Source:NCBI gene;Acc:103024498])

HSP 1 Score: 144.821 bits (364), Expect = 4.644e-39
Identity = 127/309 (41.10%), Postives = 181/309 (58.58%), Query Frame = 3
Query:   72 FQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSI---PLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSAAHRGLSESESSYPNY 989
            F S +EEI++W+  +   ++   + QEE   ++  SR+LE ELE QL   E R ++L   N +L  EL+ L  +  +  A   +QIS  +D++ + ++ K  L KY+RELEQ NDDLERAKR T+ SL+DFE++LN AIE+NA+LE+EL+EKE+L+ +VQRLK+EARDLRQ+L V+E              +   T M           K+    Q  LS+   PL   L N F+               N  A +N   +N +LTPAARISALN+V D+LRKVGA+E KL  AA R  ++ +++  NY
Sbjct:    9 FSSKDEEIDFWKALSLKYKKSSKEAQEELLEFQEGSRELEAELETQLGQAEHRLRDLQADNQRLQHELDTLKEKLEQQYAQSYKQISVLEDDLGQTRSIKEQLHKYVRELEQANDDLERAKRATITSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVRER-------------QPEVTRMSAPSSPTPDNEKTDSAVQASLSLPATPLSQSLDNAFN---------------NQKALANG-CNNSALTPAARISALNIVGDLLRKVGALESKL--AACRNFAKDQAARKNY 286          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Cavefish
Match: nde1 (nudE neurodevelopment protein 1 [Source:NCBI gene;Acc:103042936])

HSP 1 Score: 143.665 bits (361), Expect = 1.336e-38
Identity = 126/313 (40.26%), Postives = 185/313 (59.11%), Query Frame = 3
Query:   72 FQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSAAHRGLSESESSYPNYGSRTPSR 1010
            F  +EEE +YW+ +A   Q+   + QEE Q ++  SRD E ELE +L   E+RN++L+ +N++L +ELEN   ++    +   +QIS  + ++      K  LQKYIRELEQ NDDLERAKR T+MSL+DFE+++N  IE+NA+LE+EL+EKE L+E+VQRLK+EARDLRQ+L V+     Q+ +K      +L+ S+  E+ D       +    T    P  S  ++ F+   S++  SR  G           ++   LT +ARISALN+V ++LRKVG +E KL S     + +          RTPSR
Sbjct:    9 FSCVEEERDYWKEQAAKQQQRADEVQEELQEFQQMSRDYEVELETELKQCEARNRDLLTSNNRLRMELENYKEKYEVQHSEACRQISTLEGDLAETTAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQRMNHVIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQ-----QKERKP-----SLSLSVDGEKTDTTPSRTPAASLLTTPPRPPGS--ASTFNTPPSSY--SRIEG-----------LTGTPLTTSARISALNIVGELLRKVGNLESKLASCRELQVHD----------RTPSR 286          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Sea Lamprey
Match: nde1 (nudE neurodevelopment protein 1 [Source:ZFIN;Acc:ZDB-GENE-050913-61])

HSP 1 Score: 139.043 bits (349), Expect = 8.975e-38
Identity = 118/296 (39.86%), Postives = 172/296 (58.11%), Query Frame = 3
Query:   63 EVDFQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEA--LATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSA 944
            +V+F S+EEE+ YW+  A   +   I  QEE + + I SR+LE ELE QL   E R + L  TN +L  +LE L  +  +      QQIS  ++++ ++   K  L KY+RELEQ NDDLERAKR T +S+ DFE+++N  IE+NA+LE+E++EKE L+E+VQRLK+EARDLRQ+L V++    +QV++S  +  +  +A S              S+   +   +P D       +  +   P+    GY            +  LTP+ARISALN+V D+LRKV A+E KL S 
Sbjct:    6 QVEFSSVEEELCYWKQNALKYKASWIAAQEELEEFTIGSRELETELEAQLEQAEGRTRELHATNQRLINDLEILKEKLEQQHGQSYQQISSLEEQLAQITAIKDQLHKYVRELEQANDDLERAKRATFVSMDDFEQRMNEVIERNAFLESEVDEKENLLESVQRLKDEARDLRQELAVRQ----KQVRRSAPNSPSAEVAPSPAPLPSPSPAPAPMSVPSPSTPRVPGDIAFEMPVTPRSKGMPN----GY-----------GSSPLTPSARISALNIVGDLLRKVSALECKLASC 282          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Nematostella
Match: EDO34270 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPT5])

HSP 1 Score: 139.043 bits (349), Expect = 8.510e-38
Identity = 122/294 (41.50%), Postives = 174/294 (59.18%), Query Frame = 3
Query:   66 VDFQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDL--SIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTS 941
            ++F   +EE  YW+  A+  +++  + +EE   ++  SR+LE ELE QL   E+R + L+    +L  E E+L  +   +       ++  QDE  +LK  +  LQKY+RELEQ NDDLERAKR TV SL+DFE +LN AIE+NA LENEL+EKETL ETVQRLK+EARDLRQ+L V+++      KK  +D           +++ +   K S   +T+   S PL ++ +N  + S  +      +GY            +  LTP+ARISALN+V D+LRKVGA+E KL S
Sbjct:    9 LEFADPKEEAAYWKRLAEEYEQKWQEAREELDEFQEGSRELEAELEAQLEQAEARQRELLAAKARLEAENESLKEKLESSQNEAYLTVTALQDETAQLKAVREELQKYVRELEQANDDLERAKRATVCSLEDFEHRLNQAIERNAILENELDEKETLQETVQRLKDEARDLRQELAVRQLE-----KKKPEDF---------NKENKEPADKLSTPVKTEAIPSEPLANLHTNTIATSPLH------AGY-----------GSSPLTPSARISALNIVGDLLRKVGALESKLAS 271          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Medaka
Match: ndel1b (nuclear distribution protein nudE-like 1-B [Source:NCBI gene;Acc:101167121])

HSP 1 Score: 157.147 bits (396), Expect = 2.050e-43
Identity = 125/308 (40.58%), Postives = 190/308 (61.69%), Query Frame = 3
Query:   72 FQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSAAHRGLSESESSYPNYGS 995
            F S +EE++YW+++A   ++   D QEE Q ++  SR+LE ELE QL   E R ++L   N++L  E+ NL  +  +  A   +Q+S  +D++++ ++ K  L KY+RELEQ NDDLERAKR T++SL+DFE +LN AIE+NA+LE+EL+EKE+L+ +VQRLK+EARDLRQ+L V+E + ++    S   +E                +K+    Q  LS+P   +   G S  +S         ++N  A +N      +LTP+ARISALN+V D+LRKVGA+E KL  AA R  ++ +++   Y +
Sbjct:    9 FSSKDEEVDYWKSQALKYKKSCQDAQEELQEFQEGSRELEAELEAQLTQAEHRLRDLQTENERLKSEMSNLKEKLEQQYAQSYKQVSMLEDDLSQTRSIKEQLHKYVRELEQANDDLERAKRATIVSLEDFEARLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVRERTTDRMSAPSSPTLEH---------------NKTDSAMQASLSLPATPV---GKSVEHS---------FINPRALTNG-SGGSALTPSARISALNIVGDLLRKVGALESKL--AACRNFAKDQAARKTYST 286          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Medaka
Match: ndel1a (nuclear distribution protein nudE-like 1-B [Source:NCBI gene;Acc:101158643])

HSP 1 Score: 153.68 bits (387), Expect = 5.670e-42
Identity = 128/306 (41.83%), Postives = 191/306 (62.42%), Query Frame = 3
Query:   72 FQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSAAHRGLSESESSYPNY 989
            F S EEEI++W+  +   ++   + QEE   ++  SR+LE ELE QL+  E+R K+L   N +L  E+E L  +  +  +   +QI+  +D++ +++  K  L KY+RELEQ+NDDLERAKR T++SL++FE++LN  IE+NA+LE+EL+EKE+L+ +VQRLK+EARDLRQ+L V+E            D+  ++      +D+++M   S++  Q  LS+P  + LS G     +N P   SS Y           SN  LTP+ARISALN+VSD+LRKVGA+E KL  AA R  ++ + S   Y
Sbjct:   29 FSSKEEEIDFWKALSLKYKKGCEEAQEELLEFQEGSRELEAELEAQLSQAETRIKDLHSENQRLKNEVETLKEKLEQQYSQSYKQITLLEDDLGQMRGIKEQLHKYVRELEQSNDDLERAKRATIVSLENFEQRLNQTIERNAFLESELDEKESLMVSVQRLKDEARDLRQELAVRE---------RQSDVSRMSAPSSPTQDNMKM--DSAV--QASLSLPA-TPLSKGLDTVFTNPPTVLSSCY----------GSNSPLTPSARISALNIVSDLLRKVGALESKL--AACRNFAKDQKSRKTY 308          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Medaka
Match: ENSORLT00000000974.2 (nuclear distribution protein nudE homolog 1 [Source:NCBI gene;Acc:101158111])

HSP 1 Score: 147.517 bits (371), Expect = 9.632e-40
Identity = 126/322 (39.13%), Postives = 178/322 (55.28%), Query Frame = 3
Query:   57 MTEVDFQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYS--------------ARSNNF------------VSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSA 944
            M +  F+S EEE+ +W+ +A   Q+   + +EE Q ++  SRD E ELE +L   E+RN+ L+ TN++L  ELEN   ++    +   +QIS  + ++      +  LQKYIRELEQ NDDLER KR T+MSL+DFE+++N  IE+NA+LE+EL+EKE L+E+VQRLK+EARDLRQ+L V++    QQV    QD                   K S+ C   +  PL    S G        P  R+     +S              A S +F            +S   LT +ARISALN+V ++LRKVG++E KLTS 
Sbjct:    1 MGDPQFESPEEELRFWKEQAARHQQTAEEAREELQEFQQMSRDYEAELETELKQCEARNRELLATNNRLRTELENYKEKYETQHSEACRQISGLEGDLAETSAVRDQLQKYIRELEQANDDLERTKRATIMSLEDFEQRMNQVIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQQ---KQQV----QD------------------RKPSLSC--SVKDPLTPSTSTGLPTPPMTPPDRRAEDKTAFSKSAPSSTVTPPRPTASSEDFSTTAPCTSRGESLSATPLTMSARISALNIVGELLRKVGSLESKLTSC 295          
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Medaka
Match: NDE1 (nudE neurodevelopment protein 1 [Source:NCBI gene;Acc:101165210])

HSP 1 Score: 140.198 bits (352), Expect = 3.654e-37
Identity = 117/294 (39.80%), Postives = 176/294 (59.86%), Query Frame = 3
Query:   72 FQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSA---RSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSA 944
            F S+EEE+ +W+ +A+  Q+   + QEE Q ++  SRD E ELE +L   E RNK L++ N++L++ELE +  +     +   + I+  ++++T+ +  K  LQKYIRELEQ NDDLER KR T+MSL+DFE+++N  IE+NA+LE+EL+EKE L+E+VQRLK+EARDLR +L V+     Q+ ++    +   A     +R DL          Q + S P+               P+   S Y+   A   R  + ++   LT +ARISALN+V ++LRKVG +E KL S 
Sbjct:    9 FTSVEEEMVFWKEQAQRHQQRADEAQEELQEFQQMSRDYEAELETELKQCEGRNKELLLENNRLHMELEAIKEKCEARLSDALRHITALEEDLTQTRAVKDHLQKYIRELEQANDDLERTKRATIMSLEDFEQRMNQVIERNAFLESELDEKENLLESVQRLKDEARDLRHELAVR-----QRERRPSSSLGRDA-----DRPDL---------SQINPSAPVT--------------PNKPISSYITPPASSIRRGDGLTGTPLTTSARISALNIVGELLRKVGNLESKLASC 269          
BLAST of Nuclear distribution protein nudE-like 1 vs. Planmine SMEST
Match: SMESG000016071.1 (SMESG000016071.1)

HSP 1 Score: 682.945 bits (1761), Expect = 0.000e+0
Identity = 372/372 (100.00%), Postives = 372/372 (100.00%), Query Frame = 3
Query:   57 MTEVDFQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRXXXXXXXXXXXXXXSRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIXXXXXXXXXXXXXXXXXXXXQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSAAHRGLSESESSYPNYGSRTPSRHRMSESVITNGYMRQNDNDAFESEICATPVASPVKSYFGFDKPPTTPLTQTVRE 1172
            MTEVDFQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRDLENELELQLNDYESRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIEKNAYLENELEEKETLVETVQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSAAHRGLSESESSYPNYGSRTPSRHRMSESVITNGYMRQNDNDAFESEICATPVASPVKSYFGFDKPPTTPLTQTVRE
Sbjct:    1 MTEVDFQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRDLENELELQLNDYESRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTRLKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIEKNAYLENELEEKETLVETVQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALATSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSGYLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSAAHRGLSESESSYPNYGSRTPSRHRMSESVITNGYMRQNDNDAFESEICATPVASPVKSYFGFDKPPTTPLTQTVRE 372          
The following BLAST results are available for this feature:
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NDE11.962e-4745.02nudE neurodevelopment protein 1 [Source:HGNC Symbo... [more]
NDE11.962e-4745.02nudE neurodevelopment protein 1 [Source:HGNC Symbo... [more]
NDE11.962e-4745.02nudE neurodevelopment protein 1 [Source:HGNC Symbo... [more]
NDE11.962e-4745.02nudE neurodevelopment protein 1 [Source:HGNC Symbo... [more]
NDEL12.514e-4139.74nudE neurodevelopment protein 1 like 1 [Source:HGN... [more]
back to top
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nudE1.792e-2331.27gene:FBgn0036059 transcript:FBtr0113158[more]
nudE1.792e-2331.27gene:FBgn0036059 transcript:FBtr0345695[more]
nudE3.784e-1931.46gene:FBgn0036059 transcript:FBtr0113159[more]
nudE1.300e-1538.42gene:FBgn0036059 transcript:FBtr0076344[more]
nudE2.021e-1538.42gene:FBgn0036059 transcript:FBtr0114600[more]
back to top
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ndel1b2.622e-4137.75nudE neurodevelopment protein 1-like 1b [Source:NC... [more]
ndel1b2.622e-4137.75nudE neurodevelopment protein 1-like 1b [Source:NC... [more]
ndel1b2.622e-4137.75nudE neurodevelopment protein 1-like 1b [Source:NC... [more]
ndel1a5.558e-3840.78nudE neurodevelopment protein 1-like 1a [Source:NC... [more]
ndel1a5.558e-3840.78nudE neurodevelopment protein 1-like 1a [Source:NC... [more]
back to top
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nde12.455e-4242.86nudE neurodevelopment protein 1 [Source:NCBI gene;... [more]
nde13.080e-4242.52nudE neurodevelopment protein 1 [Source:NCBI gene;... [more]
cfap615.573e-4241.38cilia and flagella associated protein 61 [Source:X... [more]
nde16.772e-4242.76nudE neurodevelopment protein 1 [Source:NCBI gene;... [more]
cfap618.168e-4239.94cilia and flagella associated protein 61 [Source:X... [more]
back to top
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nde11.299e-4843.81nudE neurodevelopment protein 1 [Source:MGI Symbol... [more]
Nde11.383e-4843.81nudE neurodevelopment protein 1 [Source:MGI Symbol... [more]
Nde12.140e-4840.97nudE neurodevelopment protein 1 [Source:MGI Symbol... [more]
Ndel19.730e-4240.72nudE neurodevelopment protein 1 like 1 [Source:MGI... [more]
Ndel11.239e-4140.72nudE neurodevelopment protein 1 like 1 [Source:MGI... [more]
back to top
BLAST of Nuclear distribution protein nudE-like 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9ES39|NDE1_RAT8.981e-4844.44Nuclear distribution protein nudE homolog 1 OS=Rat... [more]
sp|Q9CZA6|NDE1_MOUSE1.497e-4740.97Nuclear distribution protein nudE homolog 1 OS=Mus... [more]
sp|Q9NXR1|NDE1_HUMAN9.423e-4745.02Nuclear distribution protein nudE homolog 1 OS=Hom... [more]
sp|Q5ZMC9|NDE1_CHICK1.939e-4542.24Nuclear distribution protein nudE homolog 1 OS=Gal... [more]
sp|Q66IZ7|NDL1B_XENLA1.050e-4441.53Nuclear distribution protein nudE-like 1-B OS=Xeno... [more]
back to top
BLAST of Nuclear distribution protein nudE-like 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3IXS57.056e-4841.72nuclear distribution protein nudE homolog 1 isofor... [more]
A0A1S3IX511.814e-4744.78nuclear distribution protein nudE homolog 1 isofor... [more]
A0A1S3IZ052.415e-4744.78nuclear distribution protein nudE homolog 1 isofor... [more]
A0A1S3IXS23.020e-4744.78nuclear distribution protein nudE homolog 1 isofor... [more]
A0A1S3IXM23.848e-4744.78nuclear distribution protein nudE homolog 1 isofor... [more]
back to top
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ndel1b1.793e-4241.23nuclear distribution protein nudE-like 1-B [Source... [more]
ndel1a3.245e-3941.10nuclear distribution protein nudE-like 1-A [Source... [more]
ndel1a4.644e-3941.10nuclear distribution protein nudE-like 1-A [Source... [more]
nde11.336e-3840.26nudE neurodevelopment protein 1 [Source:NCBI gene;... [more]
back to top
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nde18.975e-3839.86nudE neurodevelopment protein 1 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO342708.510e-3841.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nuclear distribution protein nudE-like 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ndel1b2.050e-4340.58nuclear distribution protein nudE-like 1-B [Source... [more]
ndel1a5.670e-4241.83nuclear distribution protein nudE-like 1-B [Source... [more]
ENSORLT00000000974.29.632e-4039.13nuclear distribution protein nudE homolog 1 [Sourc... [more]
NDE13.654e-3739.80nudE neurodevelopment protein 1 [Source:NCBI gene;... [more]
back to top
BLAST of Nuclear distribution protein nudE-like 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000016071.10.000e+0100.00SMESG000016071.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020436 ID=SMED30020436|Name=Nuclear distribution protein nudE-like 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1429bp
TTAGTAAATTCACTATTAATCAATATTTAAAAAATTAAAAAATAATTAAT
TGAGATATGACAGAAGTTGATTTTCAGTCAATAGAAGAAGAAATCGAATA
CTGGAGAAATAAAGCCAAGATTTTACAAGAAGAACTTATAGATACTCAAG
AAGAATTTCAAAATTATGAGATTAGTAGTAGGGATTTAGAAAACGAATTA
GAATTACAACTAAATGATTATGAATCCAGAAATAAAAATTTAATTATAAC
AAATGATAAATTAAATTTAGAGTTAGAAAATTTGTCAATACGTTTTTCAG
AAACTACCGCCAGTCTTAATCAACAGATATCAGATTATCAAGATGAAGTA
ACCAGATTAAAAAATGATAAATCTACTTTGCAGAAATATATTCGAGAATT
AGAGCAAACAAATGATGATTTAGAAAGAGCAAAAAGGGTCACTGTTATGT
CTTTACAAGACTTTGAAGAAAAATTAAATATAGCAATCGAAAAGAATGCA
TACTTGGAAAACGAATTGGAGGAAAAAGAAACACTCGTTGAAACAGTTCA
ACGACTGAAGGAAGAAGCTAGAGATTTGCGCCAAGATCTTCAAGTCAAAG
AAATGTCACTAAATCAGCAAGTTAAGAAATCAGATCAAGACATTGAAGCT
CTGGCCACAAGTATGATTGAAGAGCGCGATGATTTGCAAATGTGCCACAA
ATCCAGCATTTATTGCCAAACCGATTTATCTATACCTCTTGATTCAATTT
TATCTAACGGATTCAGTGAATCGAATTCTAACCACCCTCATTCCAGGAGT
TCTGGATACTTGAATTACAGTGCGAGATCAAACAATTTTGTCAGCAACCA
TTCTCTCACACCAGCTGCACGCATATCGGCCCTGAATCTAGTCAGTGATA
TGTTGAGAAAAGTCGGAGCTATAGAACACAAATTAACTTCAGCAGCACAT
CGGGGTTTATCAGAAAGTGAATCTAGTTACCCCAACTATGGGTCTCGTAC
TCCATCTCGACATAGAATGTCTGAAAGTGTCATCACGAATGGATACATGA
GACAAAACGATAACGATGCATTTGAATCAGAAATATGCGCCACTCCTGTT
GCCTCTCCAGTCAAATCTTATTTTGGATTCGATAAGCCTCCAACAACGCC
TCTAACGCAAACAGTTAGAGAATGAGATCCCTCATTTTCGGGCAATATCA
CTAAACCGATTCCAATCTTGATCTTCGATATCGTTTTCTTTCATTGACTG
CTAAGTTCGTATTAGTAGATTCGTGTTTTTGTATAAATTAAAACTGAGAA
TTTTATTGTCGATATGAATATCTCGAGATTAGTTCGGTCTTTATCTCTAC
GAGAGTATTTTCTATTAAATAAATTTCAAATAAAATTTTATCAGTTATTT
GTACTTTTATTATGTGTAAAAATTGTTTT
back to top

protein sequence of SMED30020436-orf-1

>SMED30020436-orf-1 ID=SMED30020436-orf-1|Name=SMED30020436-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=373bp
MTEVDFQSIEEEIEYWRNKAKILQEELIDTQEEFQNYEISSRDLENELEL
QLNDYESRNKNLIITNDKLNLELENLSIRFSETTASLNQQISDYQDEVTR
LKNDKSTLQKYIRELEQTNDDLERAKRVTVMSLQDFEEKLNIAIEKNAYL
ENELEEKETLVETVQRLKEEARDLRQDLQVKEMSLNQQVKKSDQDIEALA
TSMIEERDDLQMCHKSSIYCQTDLSIPLDSILSNGFSESNSNHPHSRSSG
YLNYSARSNNFVSNHSLTPAARISALNLVSDMLRKVGAIEHKLTSAAHRG
LSESESSYPNYGSRTPSRHRMSESVITNGYMRQNDNDAFESEICATPVAS
PVKSYFGFDKPPTTPLTQTVRE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000103central nervous system
PLANA:0000429neoblast
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: biological process
TermDefinition
GO:0007100mitotic centrosome separation
GO:0032418lysosome localization
GO:0060052neurofilament cytoskeleton organization
GO:1900029positive regulation of ruffle assembly
GO:0000132establishment of mitotic spindle orientation
GO:0001764neuron migration
GO:0007020microtubule nucleation
GO:0007049cell cycle
GO:0007067mitotic nuclear division
GO:0007275multicellular organism development
GO:0007399nervous system development
GO:0007405neuroblast proliferation
GO:0021987cerebral cortex development
GO:0030154cell differentiation
GO:0030900forebrain development
GO:0031023microtubule organizing center organization
GO:0047496vesicle transport along microtubule
GO:0051298centrosome duplication
GO:0051301cell division
GO:0051303establishment of chromosome localization
GO:2000574regulation of microtubule motor activity
Vocabulary: INTERPRO
TermDefinition
IPR033494NUDE
IPR006964NUDE_dom
Vocabulary: cellular component
TermDefinition
GO:0000775chromosome, centromeric region
GO:0000776kinetochore
GO:0000777condensed chromosome kinetochore
GO:0005694chromosome
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005815microtubule organizing center
GO:0005819spindle
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0016020membrane
GO:0031616spindle pole centrosome
GO:0032154cleavage furrow
GO:0045202synapse
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008017microtubule binding
GO:0019904protein domain specific binding
GO:0042802identical protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 6..79
NoneNo IPR availableCOILSCoilCoilcoord: 133..188
NoneNo IPR availableCOILSCoilCoilcoord: 84..128
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 300..320
IPR006964NUDE domainPFAMPF04880NUDE_Ccoord: 132..321
e-value: 5.3E-19
score: 69.4
IPR033494NUDE familyPANTHERPTHR10921NUCLEAR DISTRIBUTION PROTEIN NUDE HOMOLOG 1coord: 1..328