COP9 signalosome complex subunit 4

Overview
NameCOP9 signalosome complex subunit 4
Smed IDSMED30020431
Length (bp)4663
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of COP9 signalosome complex subunit 4 (SMED30020431) t-SNE clustered cells

Violin plots show distribution of expression levels for COP9 signalosome complex subunit 4 (SMED30020431) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of COP9 signalosome complex subunit 4 (SMED30020431) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for COP9 signalosome complex subunit 4 (SMED30020431) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020431

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30020431h1SMcG0014260 Contig43761uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020431h1SMcG0014260 Contig43761newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30020431h1SMcG0014260 dd_Smed_v4_4122_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020431h1SMcG0014260 dd_Smed_v4_4122_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020431h1SMcG0014260 dd_Smed_v4_4122_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30020431h1SMcG0014260 dd_Smed_v6_4122_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Human
Match: COPS4 (COP9 signalosome subunit 4 [Source:HGNC Symbol;Acc:HGNC:16702])

HSP 1 Score: 140.198 bits (352), Expect = 2.790e-35
Identity = 80/204 (39.22%), Postives = 119/204 (58.33%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            L KI  R+ +F E+    R+++A  YE   D+ NAA +L G  +E  Q+    D KL   LKIA  YL+      AE+YINRA  L NE   +Q  IHYK  YA +LD +++F+EA+QR+ ELS    + +++  E  L  A    IL +A   R ++L+TL KDERC+ L  + ILEKM L+R++  +  +    +L+P+ K+
Sbjct:   89 LEKIQPRVISFEEQVASIRQHLASIYEKEEDWRNAAQVLVGIPLETGQKQYNVDYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKTIVHESERLEA-LKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKA 291          
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Human
Match: COPS4 (COP9 signalosome subunit 4 [Source:HGNC Symbol;Acc:HGNC:16702])

HSP 1 Score: 140.584 bits (353), Expect = 7.950e-35
Identity = 80/204 (39.22%), Postives = 119/204 (58.33%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            L KI  R+ +F E+    R+++A  YE   D+ NAA +L G  +E  Q+    D KL   LKIA  YL+      AE+YINRA  L NE   +Q  IHYK  YA +LD +++F+EA+QR+ ELS    + +++  E  L  A    IL +A   R ++L+TL KDERC+ L  + ILEKM L+R++  +  +    +L+P+ K+
Sbjct:   89 LEKIQPRVISFEEQVASIRQHLASIYEKEEDWRNAAQVLVGIPLETGQKQYNVDYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKTIVHESERLEA-LKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKA 291          
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Human
Match: COPS4 (COP9 signalosome subunit 4 [Source:HGNC Symbol;Acc:HGNC:16702])

HSP 1 Score: 140.198 bits (352), Expect = 1.387e-34
Identity = 80/204 (39.22%), Postives = 119/204 (58.33%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            L KI  R+ +F E+    R+++A  YE   D+ NAA +L G  +E  Q+    D KL   LKIA  YL+      AE+YINRA  L NE   +Q  IHYK  YA +LD +++F+EA+QR+ ELS    + +++  E  L  A    IL +A   R ++L+TL KDERC+ L  + ILEKM L+R++  +  +    +L+P+ K+
Sbjct:   89 LEKIQPRVISFEEQVASIRQHLASIYEKEEDWRNAAQVLVGIPLETGQKQYNVDYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKTIVHESERLEA-LKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKA 291          
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Human
Match: COPS4 (COP9 signalosome subunit 4 [Source:HGNC Symbol;Acc:HGNC:16702])

HSP 1 Score: 140.198 bits (352), Expect = 1.703e-34
Identity = 80/204 (39.22%), Postives = 119/204 (58.33%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            L KI  R+ +F E+    R+++A  YE   D+ NAA +L G  +E  Q+    D KL   LKIA  YL+      AE+YINRA  L NE   +Q  IHYK  YA +LD +++F+EA+QR+ ELS    + +++  E  L  A    IL +A   R ++L+TL KDERC+ L  + ILEKM L+R++  +  +    +L+P+ K+
Sbjct:   89 LEKIQPRVISFEEQVASIRQHLASIYEKEEDWRNAAQVLVGIPLETGQKQYNVDYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKTIVHESERLEA-LKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKA 291          
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Human
Match: COPS4 (COP9 signalosome subunit 4 [Source:HGNC Symbol;Acc:HGNC:16702])

HSP 1 Score: 109.768 bits (273), Expect = 1.599e-25
Identity = 62/151 (41.06%), Postives = 91/151 (60.26%), Query Frame = 1
Query:  484 DEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            D KL   LKIA  YL+      AE+YINRA  L NE   +Q  IHYK  YA +LD +++F+EA+QR+ ELS    + +++  E  L  A    IL +A   R ++L+TL KDERC+ L  + ILEKM L+R++  +  +    +L+P+ K+
Sbjct:   30 DYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKTIVHESERLEA-LKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKA 179          
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Celegans
Match: csn-4 (COP9 signalosome complex subunit 4 [Source:UniProtKB/Swiss-Prot;Acc:Q9N359])

HSP 1 Score: 82.0333 bits (201), Expect = 6.832e-16
Identity = 67/225 (29.78%), Postives = 112/225 (49.78%), Query Frame = 1
Query:  322 ILNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAA----VILSGTLIEENQRSMAND-EKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQ-CYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS----ELLLKKVMIE 966
            IL  I  R  ++ ++    R  +A  YE  G   +AA     I S T  + N    A +  K  L ++I +  L C  + +AE Y+NR   L+ ++  +    I +K L A + D K+RF+EA+QR+ ELS  + +  N +K   L KA +  +L    P R +LL+ + KDER     +F ++ KM L +++ + + +     L  + K+    E +LK V+ E
Sbjct:   95 ILAIIKTRTISYEDQVCILRLMLASLYEKEGRIKDAAQALIAINSDTSPKFNGPQAAKEGAKAQLCIRITKLLLDCSEIDEAEQYVNRTSILMVDLGANPDIQIEHKALQARVSDAKRRFVEAAQRYYELSATEQLP-NSDKLTALGKAIVCVLLAKPGPQRSRLLTLIFKDERAPKCASFELIAKMYLTKVIHKDELEEFEHQLQDHQKADEHGESILKGVIQE 318          
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Fly
Match: CSN4 (gene:FBgn0027054 transcript:FBtr0301230)

HSP 1 Score: 131.339 bits (329), Expect = 4.610e-32
Identity = 77/204 (37.75%), Postives = 119/204 (58.33%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            L K++ R+ +F E+    R ++A  YE    + +AA +L G  +E  Q+  + + KL   LKIA  YL+      AE +INRA  L  E N ++  + YK  YA +LD +++F+EA+QR+ ELS ++ I D  E+   L KA I  +L +A   R ++L+TL KDERC+ LP + ILEKM L R++  S+ +    LL  + K+
Sbjct:   96 LEKVNPRVISFEEQVAGIRFHLANIYERNQQWRDAATVLVGIPLETGQKQYSVECKLGTYLKIARLYLEDNDSVQAELFINRASLLQAETNSEELQVLYKVCYARVLDYRRKFIEAAQRYNELS-YRKIVDQGERMTALKKALICTVLASAGQQRSRMLATLFKDERCQHLPAYGILEKMYLERIIRRSELQEFEALLQDHQKA 298          

HSP 2 Score: 53.5286 bits (127), Expect = 1.171e-6
Identity = 28/82 (34.15%), Postives = 39/82 (47.56%), Query Frame = 3
Query: 4269 PFQTENFISSMISEDRLVGTIDQMSGYVRFPSIPIA*DFLFAYNFL*YSEYKSLASWDSKIEWICHSVNCIVEKIENAYPDW 4514
              + E   S MI+E R+ G IDQ+S  V F +  +                  L  WD +I+ +C+ VN I+EKI  A PDW
Sbjct:  339 AVKAEKIASQMITEGRMNGHIDQISAIVHFENREL------------------LPQWDRQIQSLCYQVNSIIEKISVAEPDW 402          
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Fly
Match: CSN4 (gene:FBgn0027054 transcript:FBtr0088859)

HSP 1 Score: 131.339 bits (329), Expect = 4.610e-32
Identity = 77/204 (37.75%), Postives = 119/204 (58.33%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            L K++ R+ +F E+    R ++A  YE    + +AA +L G  +E  Q+  + + KL   LKIA  YL+      AE +INRA  L  E N ++  + YK  YA +LD +++F+EA+QR+ ELS ++ I D  E+   L KA I  +L +A   R ++L+TL KDERC+ LP + ILEKM L R++  S+ +    LL  + K+
Sbjct:   96 LEKVNPRVISFEEQVAGIRFHLANIYERNQQWRDAATVLVGIPLETGQKQYSVECKLGTYLKIARLYLEDNDSVQAELFINRASLLQAETNSEELQVLYKVCYARVLDYRRKFIEAAQRYNELS-YRKIVDQGERMTALKKALICTVLASAGQQRSRMLATLFKDERCQHLPAYGILEKMYLERIIRRSELQEFEALLQDHQKA 298          

HSP 2 Score: 53.5286 bits (127), Expect = 1.171e-6
Identity = 28/82 (34.15%), Postives = 39/82 (47.56%), Query Frame = 3
Query: 4269 PFQTENFISSMISEDRLVGTIDQMSGYVRFPSIPIA*DFLFAYNFL*YSEYKSLASWDSKIEWICHSVNCIVEKIENAYPDW 4514
              + E   S MI+E R+ G IDQ+S  V F +  +                  L  WD +I+ +C+ VN I+EKI  A PDW
Sbjct:  339 AVKAEKIASQMITEGRMNGHIDQISAIVHFENREL------------------LPQWDRQIQSLCYQVNSIIEKISVAEPDW 402          
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Zebrafish
Match: cops4 (COP9 constitutive photomorphogenic homolog subunit 4 (Arabidopsis) [Source:NCBI gene;Acc:325592])

HSP 1 Score: 140.969 bits (354), Expect = 3.106e-35
Identity = 80/204 (39.22%), Postives = 119/204 (58.33%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            L KI  R+ +F E+    R+++A  YE   D+ NAA +L G  +E  Q+    D KL+  LKIA  YL+      AE+YINRA  L NE   +Q  IHYK  YA +LD +++F+EA+QR+ ELS    + + +  E  L  A    IL +A   R ++L+TL KDERC+ L  + ILEKM L+R++  +  +    +L+P+ K+
Sbjct:   89 LEKIQPRVISFEEQVASIRQHLATIYEKQEDWRNAAQVLVGIPLETGQKQYNVDYKLDTYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKSIVHETERLEA-LKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKA 291          
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Zebrafish
Match: cops4 (COP9 constitutive photomorphogenic homolog subunit 4 (Arabidopsis) [Source:NCBI gene;Acc:325592])

HSP 1 Score: 140.969 bits (354), Expect = 3.163e-35
Identity = 80/204 (39.22%), Postives = 119/204 (58.33%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            L KI  R+ +F E+    R+++A  YE   D+ NAA +L G  +E  Q+    D KL+  LKIA  YL+      AE+YINRA  L NE   +Q  IHYK  YA +LD +++F+EA+QR+ ELS    + + +  E  L  A    IL +A   R ++L+TL KDERC+ L  + ILEKM L+R++  +  +    +L+P+ K+
Sbjct:   89 LEKIQPRVISFEEQVASIRQHLATIYEKQEDWRNAAQVLVGIPLETGQKQYNVDYKLDTYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKSIVHETERLEA-LKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKA 291          
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Xenopus
Match: hhex (hematopoietically expressed homeobox [Source:Xenbase;Acc:XB-GENE-487159])

HSP 1 Score: 140.969 bits (354), Expect = 2.224e-35
Identity = 80/204 (39.22%), Postives = 119/204 (58.33%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            L KI  R+ +F E+    R+++A  YE   D+ NAA +L G  +E  Q+    D KL   LKIA  YL+      AE+YINRA  L NE   +Q  IHYK  YA +LD +++F+EA+QR+ ELS    + +++  E  L  A    IL +A   R ++L+TL KDERC+ L  + ILEKM L+R++  +  +    +L+P+ K+
Sbjct:   89 LEKIQPRVISFEEQVASVRQHLASIYEKEEDWRNAAQVLVGIPLETGQKQYNVDYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKTIVHESERMEA-LKHALHCTILASAGQQRSRMLATLFKDERCQQLSAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKA 291          
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Xenopus
Match: hhex (hematopoietically expressed homeobox [Source:Xenbase;Acc:XB-GENE-487159])

HSP 1 Score: 141.354 bits (355), Expect = 2.522e-35
Identity = 80/204 (39.22%), Postives = 119/204 (58.33%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            L KI  R+ +F E+    R+++A  YE   D+ NAA +L G  +E  Q+    D KL   LKIA  YL+      AE+YINRA  L NE   +Q  IHYK  YA +LD +++F+EA+QR+ ELS    + +++  E  L  A    IL +A   R ++L+TL KDERC+ L  + ILEKM L+R++  +  +    +L+P+ K+
Sbjct:   68 LEKIQPRVISFEEQVASVRQHLASIYEKEEDWRNAAQVLVGIPLETGQKQYNVDYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKTIVHESERMEA-LKHALHCTILASAGQQRSRMLATLFKDERCQQLSAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKA 270          
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Xenopus
Match: hhex (hematopoietically expressed homeobox [Source:Xenbase;Acc:XB-GENE-487159])

HSP 1 Score: 140.969 bits (354), Expect = 3.052e-35
Identity = 80/204 (39.22%), Postives = 119/204 (58.33%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            L KI  R+ +F E+    R+++A  YE   D+ NAA +L G  +E  Q+    D KL   LKIA  YL+      AE+YINRA  L NE   +Q  IHYK  YA +LD +++F+EA+QR+ ELS    + +++  E  L  A    IL +A   R ++L+TL KDERC+ L  + ILEKM L+R++  +  +    +L+P+ K+
Sbjct:   89 LEKIQPRVISFEEQVASVRQHLASIYEKEEDWRNAAQVLVGIPLETGQKQYNVDYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKTIVHESERMEA-LKHALHCTILASAGQQRSRMLATLFKDERCQQLSAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKA 291          
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Xenopus
Match: hhex (hematopoietically expressed homeobox [Source:Xenbase;Acc:XB-GENE-487159])

HSP 1 Score: 140.969 bits (354), Expect = 5.116e-35
Identity = 80/204 (39.22%), Postives = 119/204 (58.33%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            L KI  R+ +F E+    R+++A  YE   D+ NAA +L G  +E  Q+    D KL   LKIA  YL+      AE+YINRA  L NE   +Q  IHYK  YA +LD +++F+EA+QR+ ELS    + +++  E  L  A    IL +A   R ++L+TL KDERC+ L  + ILEKM L+R++  +  +    +L+P+ K+
Sbjct:   89 LEKIQPRVISFEEQVASVRQHLASIYEKEEDWRNAAQVLVGIPLETGQKQYNVDYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKTIVHESERMEA-LKHALHCTILASAGQQRSRMLATLFKDERCQQLSAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKA 291          
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Xenopus
Match: hhex (hematopoietically expressed homeobox [Source:Xenbase;Acc:XB-GENE-487159])

HSP 1 Score: 98.5969 bits (244), Expect = 3.722e-21
Identity = 61/154 (39.61%), Postives = 86/154 (55.84%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPS 786
            L KI  R+ +F E+    R+++A  YE   D+ NAA +L G  +E  Q+    D KL   LKIA  YL+      AE+YINRA  L NE   +Q  IHYK  YA +LD +++F+EA+QR+ ELS    + +++  E  L  A    IL +A  S
Sbjct:   89 LEKIQPRVISFEEQVASVRQHLASIYEKEEDWRNAAQVLVGIPLETGQKQYNVDYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKTIVHESERMEA-LKHALHCTILASAGSS 241          
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Mouse
Match: Cops4 (COP9 signalosome subunit 4 [Source:MGI Symbol;Acc:MGI:1349414])

HSP 1 Score: 140.584 bits (353), Expect = 1.137e-36
Identity = 80/204 (39.22%), Postives = 119/204 (58.33%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            L KI  R+ +F E+    R+++A  YE   D+ NAA +L G  +E  Q+    D KL   LKIA  YL+      AE+YINRA  L NE   +Q  IHYK  YA +LD +++F+EA+QR+ ELS    + +++  E  L  A    IL +A   R ++L+TL KDERC+ L  + ILEKM L+R++  +  +    +L+P+ K+
Sbjct:    4 LEKIQPRVISFEEQVASIRQHLASIYEKEEDWRNAAQVLVGIPLETGQKQYNVDYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKTIVHESERLEA-LKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKA 206          
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Mouse
Match: Cops4 (COP9 signalosome subunit 4 [Source:MGI Symbol;Acc:MGI:1349414])

HSP 1 Score: 140.198 bits (352), Expect = 1.243e-36
Identity = 80/204 (39.22%), Postives = 119/204 (58.33%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            L KI  R+ +F E+    R+++A  YE   D+ NAA +L G  +E  Q+    D KL   LKIA  YL+      AE+YINRA  L NE   +Q  IHYK  YA +LD +++F+EA+QR+ ELS    + +++  E  L  A    IL +A   R ++L+TL KDERC+ L  + ILEKM L+R++  +  +    +L+P+ K+
Sbjct:   38 LEKIQPRVISFEEQVASIRQHLASIYEKEEDWRNAAQVLVGIPLETGQKQYNVDYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKTIVHESERLEA-LKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKA 240          
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Mouse
Match: Cops4 (COP9 signalosome subunit 4 [Source:MGI Symbol;Acc:MGI:1349414])

HSP 1 Score: 140.584 bits (353), Expect = 5.208e-35
Identity = 80/204 (39.22%), Postives = 119/204 (58.33%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            L KI  R+ +F E+    R+++A  YE   D+ NAA +L G  +E  Q+    D KL   LKIA  YL+      AE+YINRA  L NE   +Q  IHYK  YA +LD +++F+EA+QR+ ELS    + +++  E  L  A    IL +A   R ++L+TL KDERC+ L  + ILEKM L+R++  +  +    +L+P+ K+
Sbjct:   89 LEKIQPRVISFEEQVASIRQHLASIYEKEEDWRNAAQVLVGIPLETGQKQYNVDYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKTIVHESERLEA-LKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKA 291          
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Mouse
Match: Cops4 (COP9 signalosome subunit 4 [Source:MGI Symbol;Acc:MGI:1349414])

HSP 1 Score: 115.546 bits (288), Expect = 1.921e-28
Identity = 69/169 (40.83%), Postives = 98/169 (57.99%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCK 831
            L KI  R+ +F E+    R+++A  YE   D+ NAA +L G  +E  Q+    D KL   LKIA  YL+      AE+YINRA  L NE   +Q  IHYK  YA +LD +++F+EA+QR+ ELS    + +++  E  L  A    IL +A   R ++L+TL KDERC+
Sbjct:   38 LEKIQPRVISFEEQVASIRQHLASIYEKEEDWRNAAQVLVGIPLETGQKQYNVDYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKTIVHESERLEA-LKHALHCTILASAGQQRSRMLATLFKDERCQ 205          
BLAST of COP9 signalosome complex subunit 4 vs. UniProt/SwissProt
Match: sp|Q6P0H6|CSN4_DANRE (COP9 signalosome complex subunit 4 OS=Danio rerio OX=7955 GN=cops4 PE=2 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 2.388e-34
Identity = 80/204 (39.22%), Postives = 119/204 (58.33%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            L KI  R+ +F E+    R+++A  YE   D+ NAA +L G  +E  Q+    D KL+  LKIA  YL+      AE+YINRA  L NE   +Q  IHYK  YA +LD +++F+EA+QR+ ELS    + + +  E  L  A    IL +A   R ++L+TL KDERC+ L  + ILEKM L+R++  +  +    +L+P+ K+
Sbjct:   89 LEKIQPRVISFEEQVASIRQHLATIYEKQEDWRNAAQVLVGIPLETGQKQYNVDYKLDTYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKSIVHETERLEA-LKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKA 291          
BLAST of COP9 signalosome complex subunit 4 vs. UniProt/SwissProt
Match: sp|Q5R648|CSN4_PONAB (COP9 signalosome complex subunit 4 OS=Pongo abelii OX=9601 GN=COPS4 PE=2 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 2.775e-34
Identity = 80/204 (39.22%), Postives = 119/204 (58.33%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            L KI  R+ +F E+    R+++A  YE   D+ NAA +L G  +E  Q+    D KL   LKIA  YL+      AE+YINRA  L NE   +Q  IHYK  YA +LD +++F+EA+QR+ ELS    + +++  E  L  A    IL +A   R ++L+TL KDERC+ L  + ILEKM L+R++  +  +    +L+P+ K+
Sbjct:   89 LEKIQPRVISFEEQVASVRQHLASIYEKEEDWRNAAQVLVGIPLETGQKQYNVDYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKTIVHESERLEA-LKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKA 291          
BLAST of COP9 signalosome complex subunit 4 vs. UniProt/SwissProt
Match: sp|O88544|CSN4_MOUSE (COP9 signalosome complex subunit 4 OS=Mus musculus OX=10090 GN=Cops4 PE=1 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 3.643e-34
Identity = 80/204 (39.22%), Postives = 119/204 (58.33%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            L KI  R+ +F E+    R+++A  YE   D+ NAA +L G  +E  Q+    D KL   LKIA  YL+      AE+YINRA  L NE   +Q  IHYK  YA +LD +++F+EA+QR+ ELS    + +++  E  L  A    IL +A   R ++L+TL KDERC+ L  + ILEKM L+R++  +  +    +L+P+ K+
Sbjct:   89 LEKIQPRVISFEEQVASIRQHLASIYEKEEDWRNAAQVLVGIPLETGQKQYNVDYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKTIVHESERLEA-LKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKA 291          
BLAST of COP9 signalosome complex subunit 4 vs. UniProt/SwissProt
Match: sp|A7Y521|CSN4_PIG (COP9 signalosome complex subunit 4 OS=Sus scrofa OX=9823 GN=COPS4 PE=2 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 3.818e-34
Identity = 80/204 (39.22%), Postives = 119/204 (58.33%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            L KI  R+ +F E+    R+++A  YE   D+ NAA +L G  +E  Q+    D KL   LKIA  YL+      AE+YINRA  L NE   +Q  IHYK  YA +LD +++F+EA+QR+ ELS    + +++  E  L  A    IL +A   R ++L+TL KDERC+ L  + ILEKM L+R++  +  +    +L+P+ K+
Sbjct:   89 LEKIQPRVISFEEQVASIRQHLASIYEKEEDWRNAAQVLVGIPLETGQKQYNVDYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKTIVHESERLEA-LKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKA 291          
BLAST of COP9 signalosome complex subunit 4 vs. UniProt/SwissProt
Match: sp|Q4R5E6|CSN4_MACFA (COP9 signalosome complex subunit 4 OS=Macaca fascicularis OX=9541 GN=COPS4 PE=2 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 3.818e-34
Identity = 80/204 (39.22%), Postives = 119/204 (58.33%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            L KI  R+ +F E+    R+++A  YE   D+ NAA +L G  +E  Q+    D KL   LKIA  YL+      AE+YINRA  L NE   +Q  IHYK  YA +LD +++F+EA+QR+ ELS    + +++  E  L  A    IL +A   R ++L+TL KDERC+ L  + ILEKM L+R++  +  +    +L+P+ K+
Sbjct:   89 LEKIQPRVISFEEQVASIRQHLASIYEKEEDWRNAAQVLVGIPLETGQKQYNVDYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKTIVHESERLEA-LKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKA 291          
BLAST of COP9 signalosome complex subunit 4 vs. TrEMBL
Match: A0A4U5VB25 (COP9 signalosome complex subunit 4 OS=Collichthys lucidus OX=240159 GN=D9C73_018208 PE=4 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 3.986e-34
Identity = 82/204 (40.20%), Postives = 123/204 (60.29%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            L KI  R+ +F E+    R+++A  YE  GD+ NAA +L G  +E  Q+    D KL+  LKIA  YL+      AE+YINRA  L NE + +Q  IHYK  YA +LD +++F+EA+QR+ ELS    + +++  E  L  A    IL +A   R ++L+TL KDERC+ L T+ ILEKM L+R++  +  +    +L+P+ K+
Sbjct:   89 LEKIQPRVISFEEQVASIRQHLATIYEKEGDWRNAAQVLVGIPLETGQKQYNVDYKLDTYLKIARLYLEDDDPVQAEAYINRASLLQNESSNEQLQIHYKVCYARVLDFRRKFIEAAQRYNELSYKSIVHESERLEA-LKHALNCTILASAGQQRSRMLATLFKDERCQQLATYGILEKMYLDRIIRGNQLQEFAAMLMPHQKA 291          
BLAST of COP9 signalosome complex subunit 4 vs. TrEMBL
Match: H3D7J9 (COP9 constitutive photomorphogenic homolog subunit 4 (Arabidopsis) OS=Tetraodon nigroviridis OX=99883 PE=4 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 4.811e-34
Identity = 82/204 (40.20%), Postives = 123/204 (60.29%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            L KI  R+ +F E+    R+++A  YE  GD+ NAA +L G  +E  Q+    D KL+  LKIA  YL+      AE+YINRA  L NE + +Q  IHYK  YA +LD +++F+EA+QR+ ELS    + +++  E  L  A    IL +A   R ++L+TL KDERC+ L T+ ILEKM L+R++  +  +    +L+P+ K+
Sbjct:   89 LEKIQPRVISFEEQVASIRQHLATIYEKEGDWRNAAQVLVGIPLETGQKQYNVDYKLDTYLKIARLYLEDDDPVQAEAYINRASLLQNESSNEQLQIHYKVCYARVLDFRRKFIEAAQRYNELSYKTIVHESERLEA-LKHALNCTILASAGQQRSRMLATLFKDERCQQLATYGILEKMYLDRIIRGNQLQEFAAMLMPHQKA 291          
BLAST of COP9 signalosome complex subunit 4 vs. TrEMBL
Match: A0A3B5KE76 (COP9 constitutive photomorphogenic homolog subunit 4 (Arabidopsis) OS=Takifugu rubripes OX=31033 GN=cops4 PE=4 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 5.437e-34
Identity = 83/204 (40.69%), Postives = 123/204 (60.29%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            L KI  R+ +F E+    R+++A  YE  GD+ NAA +L G  +E  Q+    D KL+  LKIA  YL+      AE+YINRA  L NE + +Q  IHYK  YA +LD +++F+EA+QR+ ELS ++ I    E+   L  A    IL +A   R ++L+TL KDERC+ L T+ ILEKM L+R++  +  +    +L+P+ K+
Sbjct:   89 LEKIQPRVISFEEQVASIRQHLATIYEKEGDWRNAAQVLVGIPLETGQKQYNVDYKLDTYLKIARLYLEDDDPVQAEAYINRASLLQNESSNEQLQIHYKVCYARVLDFRRKFIEAAQRYNELS-YKTIVHETERLEALKHALNCTILASAGQQRSRMLATLFKDERCQQLATYGILEKMYLDRIIRGNQLQEFAAMLMPHQKA 291          
BLAST of COP9 signalosome complex subunit 4 vs. TrEMBL
Match: A0A5C6NI23 (COP9 signalosome complex subunit 4 OS=Takifugu flavidus OX=433684 GN=D4764_20G0003010 PE=4 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 5.437e-34
Identity = 83/204 (40.69%), Postives = 123/204 (60.29%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            L KI  R+ +F E+    R+++A  YE  GD+ NAA +L G  +E  Q+    D KL+  LKIA  YL+      AE+YINRA  L NE + +Q  IHYK  YA +LD +++F+EA+QR+ ELS ++ I    E+   L  A    IL +A   R ++L+TL KDERC+ L T+ ILEKM L+R++  +  +    +L+P+ K+
Sbjct:   89 LEKIQPRVISFEEQVASIRQHLATIYEKEGDWRNAAQVLVGIPLETGQKQYNVDYKLDTYLKIARLYLEDDDPVQAEAYINRASLLQNESSNEQLQIHYKVCYARVLDFRRKFIEAAQRYNELS-YKTIVHETERLEALKHALNCTILASAGQQRSRMLATLFKDERCQQLATYGILEKMYLDRIIRGNQLQEFAAMLMPHQKA 291          
BLAST of COP9 signalosome complex subunit 4 vs. TrEMBL
Match: A0A0S7HJX3 (CSN4 (Fragment) OS=Poeciliopsis prolifica OX=188132 GN=CSN4 PE=4 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 1.195e-33
Identity = 81/204 (39.71%), Postives = 122/204 (59.80%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            L KI  R+ +F E+    R+++A  YE  GD+ NAA +L G  +E  Q+    D KL+  LKIA  YL+      AE+YINRA  L NE + +Q  IHYK  YA +LD +++F+EA+QR+ ELS    + +++  E  L  A    IL +A   R ++L+TL KDERC+ L  + ILEKM L+R++  +  +    +L+P+ K+
Sbjct:  126 LEKIQPRVISFEEQVASIRQHLATIYEKEGDWRNAAQVLVGIPLETGQKQYNVDYKLDTYLKIARLYLEDDDPVQAEAYINRASLLQNESSNEQLQIHYKVCYARVLDFRRKFIEAAQRYNELSYKSIVHESERLEA-LKHALNCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKA 328          
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Cavefish
Match: cops4 (COP9 signalosome subunit 4 [Source:NCBI gene;Acc:103038815])

HSP 1 Score: 140.969 bits (354), Expect = 2.732e-35
Identity = 80/204 (39.22%), Postives = 120/204 (58.82%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            L KI  R+ +F E+    R+++A  YE   D+ NAA +L G  +E  Q+    D KL+  LKIA  YL+      AE+YINRA  L NE   +Q  IHYK  YA +LD +++F+EA+QR+ ELS    + +++  E  L  A    IL +A   R ++L+TL KDERC+ L  + ILEKM L+R++  +  +    +L+P+ K+
Sbjct:   89 LEKIQPRVISFEEQVASIRQHLATIYEKEEDWRNAAQVLVGIPLETGQKQYNVDYKLDTYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKSIVHESERLEA-LKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKA 291          

HSP 2 Score: 53.9138 bits (128), Expect = 1.021e-6
Identity = 29/91 (31.87%), Postives = 44/91 (48.35%), Query Frame = 3
Query: 4248 IEFPVMFPFQTENFISSMISEDRLVGTIDQMSGYVRFPSIPIA*DFLFAYNFL*YSEYKSLASWDSKIEWICHSVNCIVEKIENAYPDWSP 4520
            +E P   P + E   S MI+E R+ G IDQ+ G V F +                   + L +WD +I+ +C  VN ++EKI  A P+W+ 
Sbjct:  328 LEIP---PAKAEKIASQMITEGRMNGFIDQIDGIVHFET------------------REPLPTWDKQIQSLCFQVNNLLEKISQAAPEWTA 397          
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Cavefish
Match: cops4 (COP9 signalosome subunit 4 [Source:NCBI gene;Acc:103038815])

HSP 1 Score: 98.2117 bits (243), Expect = 2.255e-21
Identity = 61/154 (39.61%), Postives = 87/154 (56.49%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPS 786
            L KI  R+ +F E+    R+++A  YE   D+ NAA +L G  +E  Q+    D KL+  LKIA  YL+      AE+YINRA  L NE   +Q  IHYK  YA +LD +++F+EA+QR+ ELS    + +++  E  L  A    IL +A  S
Sbjct:   89 LEKIQPRVISFEEQVASIRQHLATIYEKEEDWRNAAQVLVGIPLETGQKQYNVDYKLDTYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKSIVHESERLEA-LKHALHCTILASAGSS 241          

HSP 2 Score: 53.5286 bits (127), Expect = 9.185e-7
Identity = 29/90 (32.22%), Postives = 44/90 (48.89%), Query Frame = 3
Query: 4248 IEFPVMFPFQTENFISSMISEDRLVGTIDQMSGYVRFPSIPIA*DFLFAYNFL*YSEYKSLASWDSKIEWICHSVNCIVEKIENAYPDWS 4517
            +E P   P + E   S MI+E R+ G IDQ+ G V F +                   + L +WD +I+ +C  VN ++EKI  A P+W+
Sbjct:  271 LEIP---PAKAEKIASQMITEGRMNGFIDQIDGIVHFET------------------REPLPTWDKQIQSLCFQVNNLLEKISQAAPEWT 339          
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001209.1 (pep scaffold:Pmarinus_7.0:GL478826:34518:39563:1 gene:ENSPMAG00000001075.1 transcript:ENSPMAT00000001209.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.88 bits (333), Expect = 3.481e-33
Identity = 78/207 (37.68%), Postives = 115/207 (55.56%), Query Frame = 1
Query:  316 NKILNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            +  L+KI  R+ +F E+    R+++A  YE   D+ NAA +L G  +E  Q+  + D KL   LKIA  YL+      AE++INRA  L NE       IHYK  YA +LD +++F+EA+QR+ ELS    + + +E+   L  A    IL +A   R ++L+TL KDERC+ L    ILEKM L+R++           L P+ K+
Sbjct:   92 HHALDKIQPRVISFEEQVASIRQHVASIYEREQDWRNAAQVLVGIPLETGQKHYSTDYKLETYLKIARLYLEDDDPVQAEAFINRASLLQNESASPLLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKPLVAE-EERLQALKHALHCTILASAGQQRSRMLATLFKDERCQQLAAHGILEKMYLDRIIRSGQLHEFSAELAPHQKA 297          

HSP 2 Score: 55.0694 bits (131), Expect = 8.910e-8
Identity = 28/94 (29.79%), Postives = 44/94 (46.81%), Query Frame = 3
Query: 4236 IFVYIEFPVMFPFQTENFISSMISEDRLVGTIDQMSGYVRFPSIPIA*DFLFAYNFL*YSEYKSLASWDSKIEWICHSVNCIVEKIENAYPDWS 4517
            +   +E P   P + E   S MI+E R+ G +DQ+ G V F S                   + L +WD +I+ +C  VN ++EKI    P+W+
Sbjct:  330 LGALLEIP---PEKAEKIASQMITEGRMAGVVDQIDGIVHFES------------------REPLPTWDKQIQSLCFQVNTLLEKITQHAPEWT 402          
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Medaka
Match: cops4 (COP9 signalosome subunit 4 [Source:NCBI gene;Acc:101172094])

HSP 1 Score: 145.591 bits (366), Expect = 8.393e-37
Identity = 81/204 (39.71%), Postives = 121/204 (59.31%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKS 936
            L KI  R+ +F E+    R+++A  YE  GD+ NAA +L G  +E  Q+    D KL+  LKIA  YL+      AE+YINRA  L NE + +Q  IHYK  YA +LD +++F+EA+QR+ ELS    + + +  E  L  A    IL +A   R ++L+TL KDERC+ L  + ILEKM L+R++  +  +    +L+P+ K+
Sbjct:   89 LEKIQPRVISFEEQVASIRQHLATIYEKEGDWRNAAQVLVGIPLETGQKQYNVDYKLDTYLKIARLYLEDDDPVQAEAYINRASLLQNESSNEQLQIHYKVCYARVLDFRRKFIEAAQRYNELSYKSIVHETERLEA-LKHALNCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKA 291          

HSP 2 Score: 54.299 bits (129), Expect = 6.517e-7
Identity = 29/91 (31.87%), Postives = 44/91 (48.35%), Query Frame = 3
Query: 4248 IEFPVMFPFQTENFISSMISEDRLVGTIDQMSGYVRFPSIPIA*DFLFAYNFL*YSEYKSLASWDSKIEWICHSVNCIVEKIENAYPDWSP 4520
            +E P   P + E   S MI+E R+ G IDQ+ G V F +                   + L +WD +I+ +C  VN ++EKI  A P+W+ 
Sbjct:  328 LEIP---PAKAEKIASQMITEGRMNGFIDQIDGIVHFET------------------REPLPTWDKQIQSLCFQVNNLLEKIRQAAPEWAA 397          
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Medaka
Match: cops4 (COP9 signalosome subunit 4 [Source:NCBI gene;Acc:101172094])

HSP 1 Score: 102.449 bits (254), Expect = 9.775e-23
Identity = 62/154 (40.26%), Postives = 88/154 (57.14%), Query Frame = 1
Query:  325 LNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPS 786
            L KI  R+ +F E+    R+++A  YE  GD+ NAA +L G  +E  Q+    D KL+  LKIA  YL+      AE+YINRA  L NE + +Q  IHYK  YA +LD +++F+EA+QR+ ELS    + + +  E  L  A    IL +A  S
Sbjct:   89 LEKIQPRVISFEEQVASIRQHLATIYEKEGDWRNAAQVLVGIPLETGQKQYNVDYKLDTYLKIARLYLEDDDPVQAEAYINRASLLQNESSNEQLQIHYKVCYARVLDFRRKFIEAAQRYNELSYKSIVHETERLEA-LKHALNCTILASAGSS 241          

HSP 2 Score: 54.299 bits (129), Expect = 6.197e-7
Identity = 29/90 (32.22%), Postives = 44/90 (48.89%), Query Frame = 3
Query: 4248 IEFPVMFPFQTENFISSMISEDRLVGTIDQMSGYVRFPSIPIA*DFLFAYNFL*YSEYKSLASWDSKIEWICHSVNCIVEKIENAYPDWS 4517
            +E P   P + E   S MI+E R+ G IDQ+ G V F +                   + L +WD +I+ +C  VN ++EKI  A P+W+
Sbjct:  271 LEIP---PAKAEKIASQMITEGRMNGFIDQIDGIVHFET------------------REPLPTWDKQIQSLCFQVNNLLEKIRQAAPEWA 339          
BLAST of COP9 signalosome complex subunit 4 vs. Planmine SMEST
Match: SMESG000006062.1 (SMESG000006062.1)

HSP 1 Score: 519.235 bits (1336), Expect = 7.792e-172
Identity = 277/278 (99.64%), Postives = 277/278 (99.64%), Query Frame = 1
Query:  220 DTSLSLTPLFVRVSVNYCVVYKDKFVEVIESLNKILNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKSELLLKKVMIEXXXXXXXXXXXXXXXXXASQLLKISPNDV 1053
            DTSLSLTPLFVRVSVNYCVVYKDKFVEVIESLNKILNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKSELLLKKVMIESNISSISHVYSSISLESASQLLKISPND 
Sbjct:   73 DTSLSLTPLFVRVSVNYCVVYKDKFVEVIESLNKILNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKSELLLKKVMIESNISSISHVYSSISLESASQLLKISPNDT 350          

HSP 2 Score: 106.686 bits (265), Expect = 7.792e-172
Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 2
Query:   11 MYRHYNDYXXXXXXXXXXXXXXXDIEILELIYNFNEIKDHVNSIEEFLDKINNSYEACTPSVVYRIIEH 217
            MYRHYNDYNSTLPNMNNNNSNCSDIEILELIYNFNEIKDHVNSIEEFLDKINNSYEACTPSVVYRIIEH
Sbjct:    1 MYRHYNDYNSTLPNMNNNNSNCSDIEILELIYNFNEIKDHVNSIEEFLDKINNSYEACTPSVVYRIIEH 69          

HSP 3 Score: 154.451 bits (389), Expect = 7.086e-40
Identity = 76/97 (78.35%), Postives = 77/97 (79.38%), Query Frame = 3
Query: 4269 PFQTENFISSMISEDRLVGTIDQMSGYVRFPSIPIA*DFLFAYNFL*YSEYKSLASWDSKIEWICHSVNCIVEKIENAYPDWSPGKNDISRAKAEIN 4559
            P  TENFISSMISEDRLVGTIDQMSGYVRFP                  +YKSLASWDSKIEWICHSVNCIVEKIENAYPDWSPGKNDISRAKAEIN
Sbjct:  347 PNDTENFISSMISEDRLVGTIDQMSGYVRFP------------------KYKSLASWDSKIEWICHSVNCIVEKIENAYPDWSPGKNDISRAKAEIN 425          
BLAST of COP9 signalosome complex subunit 4 vs. Planmine SMEST
Match: SMESG000006062.1 (SMESG000006062.1)

HSP 1 Score: 519.62 bits (1337), Expect = 7.971e-171
Identity = 277/278 (99.64%), Postives = 277/278 (99.64%), Query Frame = 1
Query:  220 DTSLSLTPLFVRVSVNYCVVYKDKFVEVIESLNKILNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKSELLLKKVMIEXXXXXXXXXXXXXXXXXASQLLKISPNDV 1053
            DTSLSLTPLFVRVSVNYCVVYKDKFVEVIESLNKILNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKSELLLKKVMIESNISSISHVYSSISLESASQLLKISPND 
Sbjct:   59 DTSLSLTPLFVRVSVNYCVVYKDKFVEVIESLNKILNKISNRLQTFREETIKCRENIAKCYEDIGDFSNAAVILSGTLIEENQRSMANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYKRLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTAASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLPYHKSELLLKKVMIESNISSISHVYSSISLESASQLLKISPNDT 336          

HSP 2 Score: 154.836 bits (390), Expect = 4.520e-40
Identity = 76/97 (78.35%), Postives = 77/97 (79.38%), Query Frame = 3
Query: 4269 PFQTENFISSMISEDRLVGTIDQMSGYVRFPSIPIA*DFLFAYNFL*YSEYKSLASWDSKIEWICHSVNCIVEKIENAYPDWSPGKNDISRAKAEIN 4559
            P  TENFISSMISEDRLVGTIDQMSGYVRFP                  +YKSLASWDSKIEWICHSVNCIVEKIENAYPDWSPGKNDISRAKAEIN
Sbjct:  333 PNDTENFISSMISEDRLVGTIDQMSGYVRFP------------------KYKSLASWDSKIEWICHSVNCIVEKIENAYPDWSPGKNDISRAKAEIN 411          

HSP 3 Score: 94.7449 bits (234), Expect = 6.095e-20
Identity = 46/46 (100.00%), Postives = 46/46 (100.00%), Query Frame = 2
Query:   80 DIEILELIYNFNEIKDHVNSIEEFLDKINNSYEACTPSVVYRIIEH 217
            DIEILELIYNFNEIKDHVNSIEEFLDKINNSYEACTPSVVYRIIEH
Sbjct:   10 DIEILELIYNFNEIKDHVNSIEEFLDKINNSYEACTPSVVYRIIEH 55          
BLAST of COP9 signalosome complex subunit 4 vs. Planmine SMEST
Match: SMESG000014261.1 (SMESG000014261.1)

HSP 1 Score: 67.3958 bits (163), Expect = 5.063e-11
Identity = 35/61 (57.38%), Postives = 41/61 (67.21%), Query Frame = -1
Query: 2771 GHSTVWFDDNLKYG*SEPTETFNNPTICRNCN-------------*SNNKFPTVTNHSKSK 2914
            GHS +WF+D LKYG SEPTETFNNPT+C +CN              SNNK  TV+NHSKS+
Sbjct:  437 GHSAIWFEDTLKYGRSEPTETFNNPTLCGDCNDVDRTNAENTINLLSNNKSSTVSNHSKSE 497          
BLAST of COP9 signalosome complex subunit 4 vs. Planmine SMEST
Match: SMESG000014261.1 (SMESG000014261.1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.300e-11
Identity = 35/61 (57.38%), Postives = 41/61 (67.21%), Query Frame = -1
Query: 2771 GHSTVWFDDNLKYG*SEPTETFNNPTICRNCN-------------*SNNKFPTVTNHSKSK 2914
            GHS +WF+D LKYG SEPTETFNNPT+C +CN              SNNK  TV+NHSKS+
Sbjct:  468 GHSAIWFEDTLKYGRSEPTETFNNPTLCGDCNDVDRTNAENTINLLSNNKSSTVSNHSKSE 528          
The following BLAST results are available for this feature:
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
COPS42.790e-3539.22COP9 signalosome subunit 4 [Source:HGNC Symbol;Acc... [more]
COPS47.950e-3539.22COP9 signalosome subunit 4 [Source:HGNC Symbol;Acc... [more]
COPS41.387e-3439.22COP9 signalosome subunit 4 [Source:HGNC Symbol;Acc... [more]
COPS41.703e-3439.22COP9 signalosome subunit 4 [Source:HGNC Symbol;Acc... [more]
COPS41.599e-2541.06COP9 signalosome subunit 4 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
csn-46.832e-1629.78COP9 signalosome complex subunit 4 [Source:UniPro... [more]
back to top
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CSN44.610e-3237.75gene:FBgn0027054 transcript:FBtr0301230[more]
CSN44.610e-3237.75gene:FBgn0027054 transcript:FBtr0088859[more]
back to top
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cops43.106e-3539.22COP9 constitutive photomorphogenic homolog subunit... [more]
cops43.163e-3539.22COP9 constitutive photomorphogenic homolog subunit... [more]
back to top
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hhex2.224e-3539.22hematopoietically expressed homeobox [Source:Xenba... [more]
hhex2.522e-3539.22hematopoietically expressed homeobox [Source:Xenba... [more]
hhex3.052e-3539.22hematopoietically expressed homeobox [Source:Xenba... [more]
hhex5.116e-3539.22hematopoietically expressed homeobox [Source:Xenba... [more]
hhex3.722e-2139.61hematopoietically expressed homeobox [Source:Xenba... [more]
back to top
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Cops41.137e-3639.22COP9 signalosome subunit 4 [Source:MGI Symbol;Acc:... [more]
Cops41.243e-3639.22COP9 signalosome subunit 4 [Source:MGI Symbol;Acc:... [more]
Cops45.208e-3539.22COP9 signalosome subunit 4 [Source:MGI Symbol;Acc:... [more]
Cops41.921e-2840.83COP9 signalosome subunit 4 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of COP9 signalosome complex subunit 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P0H6|CSN4_DANRE2.388e-3439.22COP9 signalosome complex subunit 4 OS=Danio rerio ... [more]
sp|Q5R648|CSN4_PONAB2.775e-3439.22COP9 signalosome complex subunit 4 OS=Pongo abelii... [more]
sp|O88544|CSN4_MOUSE3.643e-3439.22COP9 signalosome complex subunit 4 OS=Mus musculus... [more]
sp|A7Y521|CSN4_PIG3.818e-3439.22COP9 signalosome complex subunit 4 OS=Sus scrofa O... [more]
sp|Q4R5E6|CSN4_MACFA3.818e-3439.22COP9 signalosome complex subunit 4 OS=Macaca fasci... [more]
back to top
BLAST of COP9 signalosome complex subunit 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4U5VB253.986e-3440.20COP9 signalosome complex subunit 4 OS=Collichthys ... [more]
H3D7J94.811e-3440.20COP9 constitutive photomorphogenic homolog subunit... [more]
A0A3B5KE765.437e-3440.69COP9 constitutive photomorphogenic homolog subunit... [more]
A0A5C6NI235.437e-3440.69COP9 signalosome complex subunit 4 OS=Takifugu fla... [more]
A0A0S7HJX31.195e-3339.71CSN4 (Fragment) OS=Poeciliopsis prolifica OX=18813... [more]
back to top
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cops42.732e-3539.22COP9 signalosome subunit 4 [Source:NCBI gene;Acc:1... [more]
cops42.255e-2139.61COP9 signalosome subunit 4 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000001209.13.481e-3337.68pep scaffold:Pmarinus_7.0:GL478826:34518:39563:1 g... [more]
back to top
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of COP9 signalosome complex subunit 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cops48.393e-3739.71COP9 signalosome subunit 4 [Source:NCBI gene;Acc:1... [more]
cops49.775e-2340.26COP9 signalosome subunit 4 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of COP9 signalosome complex subunit 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000006062.17.792e-17299.64SMESG000006062.1[more]
SMESG000006062.17.971e-17199.64SMESG000006062.1[more]
SMESG000014261.15.063e-1157.38SMESG000014261.1[more]
SMESG000014261.16.300e-1157.38SMESG000014261.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020431 ID=SMED30020431|Name=COP9 signalosome complex subunit 4|organism=Schmidtea mediterranea sexual|type=transcript|length=4663bp
TTTAATTTAAATGTACCGCCATTATAACGATTATAATTCAACATTGCCGA
ATATGAATAATAATAATTCTAATTGTAGTGATATAGAAATTTTAGAATTG
ATATATAATTTTAACGAAATTAAAGACCATGTAAATTCAATTGAAGAGTT
TCTTGATAAAATTAATAATTCATATGAAGCTTGTACTCCTTCTGTGGTGT
ATCGAATCATTGAACATATGATACGTCGCTCAGTCTAACTCCATTATTTG
TTCGAGTTTCTGTAAATTATTGTGTTGTGTACAAAGATAAATTTGTTGAA
GTTATTGAATCATTAAATAAAATTTTGAACAAAATCTCCAACCGGCTACA
AACATTTAGAGAAGAGACAATAAAATGTCGAGAAAATATAGCTAAATGCT
ATGAAGACATTGGCGATTTCTCAAATGCTGCTGTTATACTGAGTGGGACA
CTTATTGAAGAGAATCAAAGATCAATGGCTAATGATGAAAAATTGAATTT
AAATTTAAAAATAGCTGAATATTATTTGAAGTGCTATTCCGTTAAAGATG
CCGAGTCATATATAAATCGAGCCTGTCAGTTACTTAACGAAGTTAACAAG
GATCAATGTTATATTCACTATAAAAGATTGTATGCTGAAATGTTGGATAT
GAAACAGAGATTTCTCGAGGCATCTCAACGATTCATGGAACTTTCGTTGC
ATCAGTTTATCACGGATAATAAAGAAAAAGAAGTGTATCTAATAAAAGCA
ACTATATCAGCAATATTAACTGCAGCGTCTCCCAGTCGATTTAAATTGTT
ATCTACACTTTGTAAAGACGAAAGATGTAAAAGCTTGCCTACGTTTAGTA
TATTAGAAAAAATGTCTCTCAATCGATTGGTCGACGAGAGCGATTTCAAG
GGAATAATGGATCTGTTATTACCATATCACAAAAGCGAATTGCTCCTGAA
AAAGGTTATGATAGAAAGCAATATCTCATCAATTAGTCATGTCTATTCAT
CGATTAGCCTCGAAAGCGCATCGCAATTGCTGAAAATATCTCCTAATGAT
GTTAGTTAGATTTGACTATTTAATATTATTTTATATTAGTAAGAGAGGGG
CGCTTTGTCTTCTGGGAACGCATTAAAATTCCCTTTGTAAAATCCCCCCC
ACTATACAACAATAGCATTAATTTCCGTTATACTATCTCTAATATTTCAT
AACTGTTTTATGGGAGATTCTCAAGCAGTTGAGAACATTTTCAAATATAT
TTAAATGGAGAAAGATAAATCTTTGATTCCTGTAGCTAGGGAAAATGGGG
CCTCAAATTATCGAGCTTCCAGTTGTGTTGGGTCTCGGTTGGAAGGTTTT
TGCAAATTTTCAATTTATAGTGAAATAATCAATATTTTCATATCATTGAA
TTTAGTGTATTTCTCTATATCAGGGTTTCTTAATCTTTTACACTTCGTTA
CTTTAAAATTGAATTATTGTCCCTCCTCGCTCAGAAGATATTTTTTCGGG
GAGGAACATTTAATCGGTGACAAGTCTCTGCTCTTTGTAGTGTTGACTTT
TTGGAGTTCATGTTGCTATTTATAGACGTAAGGGTCGCCCATATATTGCG
TACGCACTGGGGAGAGCGTGAGGGAGTCATGACAGAGTGTGTGCGTTACG
CATGCACATATTCTATTACTTTGAAATTCGGACGGTTCCTAAATAGCCAA
CCGCATCATTATTCCGTATTTAAAGATGGATTTTAAGAAAACGTGAAAGA
TATGAATTGAATTAATTATAAATGCAACTAAAATTCTGGATTTTAAATTG
GTTTACTAATTGATATATTACTATAACCAGAAAGTGCACACAAAACGGAA
CCAACGAATGCTCGGAATAATTTGTTTGATTATTGGCATGGATTAAAAAT
AATATATTCAAGAAGATACCTAGATGACTTGCTAAAGAGGGAAAGTTTAT
ATTTTGGAGATGTTCCCGTAGTTGAAAGTGTTGTTATTGATTGCATAGAT
ATTTTCATTTATTTGGAGGCCGGTGGGATTGGGATCTTTTGTTTCTATAA
CTTCTTTCATGAAAAAGCTTTTAACTTGCAAAATTTGTCTTCGTTCATTC
TCGCGATTAATATTTAAATCCCGACATCCAAAACACAAACGAAACACATG
GACTATTGCTGATCTTGAAGTTAAATTCCAGAAAATAAAGCAGCAACATA
TCCACAGATTATTTTCTCGGGCCCGCAACACCAGGCATAATATCCATTTT
TATATTAGAGTCGATAATTGATTTCATAATTAATATTTTTATTGTAAACC
TATAAATAGCCTTCCAAGAAGTATTATTTATTTTTTTAAACTAATATTTA
TATTTTATAATTAGCAAGACTGACTGTACATTGCTCACGTAAAAATCAAA
TCTTCAAATAAATTAATCGGTTTGCAAAAATGATTATAAAAGTTTGCAAA
CTGAATCGGTTACTTTAATCCCAGAATCTTGAAAATAATTAATAACAAAA
TAAAATCCCTTGATATTAAGAATAACCAAAAAACACCTGATTATAGTCAG
AAAATGCACTTTGTCGAATTCGCCCTCTAAAATCAATAATTACATTTTTG
TGGTGCAAAAAACTTCAGTTCTTCTGACTTTTTTGAAAACCAAAAAACAC
TTCTGAATAGTCAGAAATTGAGCTTTGCACTTCAAAATCAATAATACTGG
CTACTTTCTAATTACTTTAATTATAAAACTTCAAAGCAATTAATAACAAA
ATTCTTTGTTTGTTGAATGTTTTACTTTTGGAGTGATTAGTGACTGTAGG
GAATTTATTGTTAGATTAATTGCAATTTCTACAAATTGTAGGATTGTTAA
ATGTTTCTGTCGGTTCACTTCAACCGTATTTCAAATTGTCATCAAACCAA
ACAGTACTATGGCCAATTTACTGATCACTGCAATTATCATTATAACAGTT
GCCCCGGGTAAATTCACTTCACGACATATTGAATTTGGAATTACTTTCAA
TTTTAAATCCTTTAATTTTTTTTCAAATCTTTTACAAGTTCTTTTGATTT
CGAACTTTTTTATTACGAATTTAGTAGTTATTACTAAAATACGTAGAAAC
TATTCCAACTAGGAATCAAATGATCAACTGTTTAATTTTTTGTACAAATC
AATACCAAAAAGAAATTGATTTTTGCGAATCCGGGATATATTAACAAAAA
CAGACGAAAATAAGAAACAAACATTAAAACCCTTTTTCTTGTTTTGTGCT
ATTCCTTATGATTTTTTATTTTTAAAAAATTTCTGTGTTTGGTAAAAAAG
ACCGTTACAATGGGGTTAAAAATCTAAAATCATTTTAAACGATTTGAAGT
AGGTAACAATTAGAATTGAATTGTGTAGAAATGCGAAAAAGAAGAAAATC
AACCAATTATTAAATTTGAATTTGTAAAACTGGTCAGATATCGATTAGAC
AATGGTGAAGATCATGATGATAATGAATTTATCGGTATAAACGGTCGGAT
AGCAAGTGAATGTATAAAAACCTGAGTTAGGTAAACAACAACAAAAATTA
AACAAGAGGGAATTCAAAAGGCCATTATCAGGATAGCATGATTGATGGGA
AGATGTGGGAAAATATCATCATTAGGAAAGGGAACGGTAGAGTACTTAAT
TATACTGTTGTACTTCGAGATCATGAAAGTAAGCTGTATAAAGAAGATTG
TCAAACAGAAGAAATTTGGGTCGAGAATAATCAATCAAATGGATCATACT
ACTATATAAAGAAAGTAGAAATTAGAAACAGCCGGCATTTCGCCTTAGGT
AGAAACGAAGAATAAGAGAATATAAATTTGGTATAAATACAATCTATTAG
AAGTAGGACACAACAGAAAAGTTGTCAAAGGAATTCGTAGAGCAGTCAGA
GTCCAAGCAGGATCAGATTATTGATTTGGTGTGTAATAATTTGTGATAAA
TAGTTGCAAATACAAATATATATTGGGAGTATTGGGTTTTAATTTATAGA
GCGCATGGAGTCAGAACTACCGGCTATTATCATTTCATTGATTAAAGCCC
AATAGTTAGATTTGTATGAATAAAGTAACCTGAATGTGATTCCAATACAC
ATTTCCAGCTGGCTATATGAGAATCGGTGTTCAAAATTTATGATCGTGGA
AAAACTCAAAAACTATGACATTATCTTGATTCTTGTCGCGCTTTTATTGG
CGGGTACCCAAAAAGATCCGAATTATAATTTATCGATTTTTGTTTATATA
GAATTTCCCGTCATGTTTCCATTCCAGACTGAGAATTTTATTTCCTCAAT
GATATCGGAGGATAGACTGGTAGGCACAATCGATCAAATGTCCGGTTACG
TAAGATTTCCTAGTATTCCTATTGCTTAGGATTTTCTATTTGCTTATAAT
TTCCTTTGATATTCAGAGTATAAATCACTGGCATCGTGGGACAGCAAAAT
CGAATGGATTTGTCATTCGGTCAATTGTATTGTGGAGAAAATAGAAAATG
CCTATCCGGATTGGTCGCCGGGAAAAAATGATATTTCTCGTGCCAAGGCT
GAGATTAATTAATAATATTGAATTAAATTGCTTTTATTTCGTTTCGTTTT
TTATGCTCGTTTGATTTATTAAATTTTTATTTATTAAATGCATAGCGATT
GAGAAAGTTATTC
back to top

protein sequence of SMED30020431-orf-1

>SMED30020431-orf-1 ID=SMED30020431-orf-1|Name=SMED30020431-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=195bp
MANDEKLNLNLKIAEYYLKCYSVKDAESYINRACQLLNEVNKDQCYIHYK
RLYAEMLDMKQRFLEASQRFMELSLHQFITDNKEKEVYLIKATISAILTA
ASPSRFKLLSTLCKDERCKSLPTFSILEKMSLNRLVDESDFKGIMDLLLP
YHKSELLLKKVMIESNISSISHVYSSISLESASQLLKISPNDVS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000039gamma neoblast
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR037754CSN4
IPR040134PSMD12/CSN4
IPR000717PCI_dom
IPR011991WHTH_DNA-bd_dom
IPR011990TPR-like_helical_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0000338protein deneddylation
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0008021synaptic vesicle
GO:0008180COP9 signalosome
GO:0030054cell junction
GO:0031410cytoplasmic vesicle
GO:0045202synapse
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 151..194
e-value: 4.0E-5
score: 25.1
IPR037754COP9 signalosome complex subunit 4PANTHERPTHR10855:SF2COP9 SIGNALOSOME COMPLEX SUBUNIT 4coord: 3..193
IPR04013426S Proteasome non-ATPase regulatory subunit 12/COP9 signalosome complex subunit 4PANTHERPTHR1085526S PROTEASOME NON-ATPASE REGULATORY SUBUNIT 12/COP9 SIGNALOSOME COMPLEX SUBUNIT 4coord: 3..193