Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase

Overview
NameVery-long-chain (3R)-3-hydroxyacyl-CoA dehydratase
Smed IDSMED30020430
Length (bp)1560
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase (SMED30020430) t-SNE clustered cells

Violin plots show distribution of expression levels for Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase (SMED30020430) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase (SMED30020430) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase (SMED30020430) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020430

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30020430h1SMcG0020090 dd_Smed_v4_3998_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020430h1SMcG0020090 dd_Smed_v4_3998_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30020430h1SMcG0020090 dd_Smed_v4_3998_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30020430h1SMcG0020090 dd_Smed_v4_3998_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Human
Match: HACD3 (3-hydroxyacyl-CoA dehydratase 3 [Source:HGNC Symbol;Acc:HGNC:24175])

HSP 1 Score: 177.178 bits (448), Expect = 5.073e-50
Identity = 108/366 (29.51%), Postives = 189/366 (51.64%), Query Frame = 1
Query:   85 PIVFWGQSKDYILLSIKIINAKNVVVNIAEENLSFSGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLTSQPMKLPWLKCDFNNFFFDESDYGSDESVKHN-KPNKKDLTESLTEDDFIESEKLFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAM-VFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFYYLMMRMYGQRKQKIGPIVKK 1176
            P V+W Q    + L +++ + +N  ++I E  L F  +G GA G   Y F  ++ L ++     +K+ +  + + ++K++   W RLT Q  +  +L  DF+ +  DESD   +   K   + NK  L          ESE   + +T     YL MYNL Q+ G+ ++F          G E     +  + D +   Q+++V+E ++A +G V +SP +   +Q+ GRN +LF I      +Q    +F++   WS +EI RY +Y+L  +  +   LTWLRY++W+PLYP+G + E   +++++P+  E+ +FS  LP    I+  F  FL +Y+ +  +G Y     +Y QR+++ G   KK
Sbjct:    8 PHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLEF-LDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWL-DESDAEMELRAKEEERLNKLRL----------ESEGSPETLTNLRKGYLFMYNLVQFLGFSWIFVNLTVRFCILGKESFYDTFHTVADMMYFCQMLAVVETINAAIG-VTTSPVLPSLIQLLGRNFILFIIFGTMEEMQNKAVVFFVFYLWSAIEIFRYSFYMLTCIDMDWKVLTWLRYTLWIPLYPLGCLAEAVSVIQSIPIFNETGRFSFTLPYPVKIKVRFSFFLQIYLIMIFLGLYINFRHLYKQRRRRYGQKKKK 360          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Human
Match: HACD3 (3-hydroxyacyl-CoA dehydratase 3 [Source:HGNC Symbol;Acc:HGNC:24175])

HSP 1 Score: 164.851 bits (416), Expect = 8.712e-46
Identity = 103/345 (29.86%), Postives = 178/345 (51.59%), Query Frame = 1
Query:  148 KNVVVNIAEENLSFSGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLTSQPMKLPWLKCDFNNFFFDESDYGSDESVKHN-KPNKKDLTESLTEDDFIESEKLFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAM-VFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFYYLMMRMYGQRKQKIGPIVKK 1176
            +N  ++I E  L F  +G GA G   Y F  ++ L ++     +K+ +  + + ++K++   W RLT Q  +  +L  DF+ +  DESD   +   K   + NK  L          ESE   + +T     YL MYNL Q+ G+ ++F          G E     +  + D +   Q+++V+E ++A +G V +SP +   +Q+ GRN +LF I      +Q    +F++   WS +EI RY +Y+L  +  +   LTWLRY++W+PLYP+G + E   +++++P+  E+ +FS  LP    I+  F  FL +Y+ +  +G Y     +Y QR+++ G   KK
Sbjct:    4 QNPAISITENVLHFKAQGHGAKGDNVYEFHLEF-LDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWL-DESDAEMELRAKEEERLNKLRL----------ESEGSPETLTNLRKGYLFMYNLVQFLGFSWIFVNLTVRFCILGKESFYDTFHTVADMMYFCQMLAVVETINAAIG-VTTSPVLPSLIQLLGRNFILFIIFGTMEEMQNKAVVFFVFYLWSAIEIFRYSFYMLTCIDMDWKVLTWLRYTLWIPLYPLGCLAEAVSVIQSIPIFNETGRFSFTLPYPVKIKVRFSFFLQIYLIMIFLGLYINFRHLYKQRRRRYGQKKKK 335          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Human
Match: HACD3 (3-hydroxyacyl-CoA dehydratase 3 [Source:HGNC Symbol;Acc:HGNC:24175])

HSP 1 Score: 164.851 bits (416), Expect = 3.555e-45
Identity = 103/348 (29.60%), Postives = 179/348 (51.44%), Query Frame = 1
Query:  139 INAKNVVVNIAEENLSFSGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLTSQPMKLPWLKCDFNNFFFDESDYGSDESVKHN-KPNKKDLTESLTEDDFIESEKLFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAM-VFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFYYLMMRMYGQRKQKIGPIVKK 1176
            +  +N  ++I E  L F  +G GA G   Y F  ++ L ++     +K+ +  + + ++K++   W RLT Q  +  +L  DF+ +  DESD   +   K   + NK  L          ESE   + +T     YL MYNL Q+ G+ ++F          G E     +  + D +   Q+++V+E ++A +G V +SP +   +Q+ GRN +LF I      +Q    +F++   WS +EI RY +Y+L  +  +   LTWLRY++W+PLYP+G + E   +++++P+  E+ +FS  LP    I+  F  FL +Y+ +  +G Y     +Y QR+++ G   KK
Sbjct:   64 VGLQNPAISITENVLHFKAQGHGAKGDNVYEFHLEF-LDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWL-DESDAEMELRAKEEERLNKLRL----------ESEGSPETLTNLRKGYLFMYNLVQFLGFSWIFVNLTVRFCILGKESFYDTFHTVADMMYFCQMLAVVETINAAIG-VTTSPVLPSLIQLLGRNFILFIIFGTMEEMQNKAVVFFVFYLWSAIEIFRYSFYMLTCIDMDWKVLTWLRYTLWIPLYPLGCLAEAVSVIQSIPIFNETGRFSFTLPYPVKIKVRFSFFLQIYLIMIFLGLYINFRHLYKQRRRRYGQKKKK 398          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Human
Match: HACD3 (3-hydroxyacyl-CoA dehydratase 3 [Source:HGNC Symbol;Acc:HGNC:24175])

HSP 1 Score: 130.568 bits (327), Expect = 3.837e-34
Identity = 73/229 (31.88%), Postives = 126/229 (55.02%), Query Frame = 1
Query:  493 IESEKLFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAM-VFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFYYLMMRMYGQRKQKIGPIVKK 1176
            +ESE   + +T     YL MYNL Q+ G+ ++F          G E     +  + D +   Q+++V+E ++A +G V +SP +   +Q+ GRN +LF I      +Q    +F++   WS +EI RY +Y+L  +  +   LTWLRY++W+PLYP+G + E   +++++P+  E+ +FS  LP    I+  F  FL +Y+ +  +G Y     +Y QR+++ G   KK
Sbjct:   16 LESEGSPETLTNLRKGYLFMYNLVQFLGFSWIFVNLTVRFCILGKESFYDTFHTVADMMYFCQMLAVVETINAAIG-VTTSPVLPSLIQLLGRNFILFIIFGTMEEMQNKAVVFFVFYLWSAIEIFRYSFYMLTCIDMDWKVLTWLRYTLWIPLYPLGCLAEAVSVIQSIPIFNETGRFSFTLPYPVKIKVRFSFFLQIYLIMIFLGLYINFRHLYKQRRRRYGQKKKK 243          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Human
Match: HACD3 (3-hydroxyacyl-CoA dehydratase 3 [Source:HGNC Symbol;Acc:HGNC:24175])

HSP 1 Score: 130.568 bits (327), Expect = 3.837e-34
Identity = 73/229 (31.88%), Postives = 126/229 (55.02%), Query Frame = 1
Query:  493 IESEKLFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAM-VFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFYYLMMRMYGQRKQKIGPIVKK 1176
            +ESE   + +T     YL MYNL Q+ G+ ++F          G E     +  + D +   Q+++V+E ++A +G V +SP +   +Q+ GRN +LF I      +Q    +F++   WS +EI RY +Y+L  +  +   LTWLRY++W+PLYP+G + E   +++++P+  E+ +FS  LP    I+  F  FL +Y+ +  +G Y     +Y QR+++ G   KK
Sbjct:   16 LESEGSPETLTNLRKGYLFMYNLVQFLGFSWIFVNLTVRFCILGKESFYDTFHTVADMMYFCQMLAVVETINAAIG-VTTSPVLPSLIQLLGRNFILFIIFGTMEEMQNKAVVFFVFYLWSAIEIFRYSFYMLTCIDMDWKVLTWLRYTLWIPLYPLGCLAEAVSVIQSIPIFNETGRFSFTLPYPVKIKVRFSFFLQIYLIMIFLGLYINFRHLYKQRRRRYGQKKKK 243          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Celegans
Match: hpo-8 (Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase hpo-8 [Source:UniProtKB/Swiss-Prot;Acc:O17040])

HSP 1 Score: 83.5741 bits (205), Expect = 3.396e-18
Identity = 67/218 (30.73%), Postives = 112/218 (51.38%), Query Frame = 1
Query:  541 YLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIA-FLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDF----VIFLLLYIPLATIGFYYLMMRMYGQRKQKIGPIVKKD 1179
            YL+ YN+ Q  G+  +    +  L  +G+    ++Y  +  +L   Q  ++LE++HA +G V+S      MQV  R ++++ I+   S  +    +  L   WS  E++RY +Y L +LK+ I  FL +LRY+++  LYP+G   E   +  ++  + E K  ++ +PN  N+   F    +I  L YIP    GF  L   M GQRK+ +G   KK 
Sbjct:    6 YLVAYNVLQILGWSAILVKTVLGL-ANGLTWP-QLYESVEFELKIFQTAAILEVIHAIVGLVRSPVGTTAMQVTSRVVLVWPILHLCSTARFSIGVPLLLVAWSVTEVIRYSFYALSVLKQPIPYFLLYLRYTLFYVLYPMGVSGELLTLFASLNEVDEKKILTLEMPNRLNMGISFWWVLIIAALSYIP----GFPQLYFYMIGQRKKILGGGSKKK 217          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Celegans
Match: hpo-8 (Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase hpo-8 [Source:UniProtKB/Swiss-Prot;Acc:O17040])

HSP 1 Score: 83.5741 bits (205), Expect = 3.396e-18
Identity = 67/218 (30.73%), Postives = 112/218 (51.38%), Query Frame = 1
Query:  541 YLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIA-FLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDF----VIFLLLYIPLATIGFYYLMMRMYGQRKQKIGPIVKKD 1179
            YL+ YN+ Q  G+  +    +  L  +G+    ++Y  +  +L   Q  ++LE++HA +G V+S      MQV  R ++++ I+   S  +    +  L   WS  E++RY +Y L +LK+ I  FL +LRY+++  LYP+G   E   +  ++  + E K  ++ +PN  N+   F    +I  L YIP    GF  L   M GQRK+ +G   KK 
Sbjct:    6 YLVAYNVLQILGWSAILVKTVLGL-ANGLTWP-QLYESVEFELKIFQTAAILEVIHAIVGLVRSPVGTTAMQVTSRVVLVWPILHLCSTARFSIGVPLLLVAWSVTEVIRYSFYALSVLKQPIPYFLLYLRYTLFYVLYPMGVSGELLTLFASLNEVDEKKILTLEMPNRLNMGISFWWVLIIAALSYIP----GFPQLYFYMIGQRKKILGGGSKKK 217          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Celegans
Match: R10E4.9 (Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase [Source:UniProtKB/TrEMBL;Acc:Q21905])

HSP 1 Score: 54.6842 bits (130), Expect = 2.368e-8
Identity = 52/152 (34.21%), Postives = 74/152 (48.68%), Query Frame = 1
Query:  535 NLYLLMYNLFQYA----GYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEG 978
            N+ L +Y L  +     G+LY+F A      ++  E K   YP I   L+ +  +  L+I  ++    KS+P  VF+QV GR LVL+   V    +      F L A +   E+ R PYYL   L      LTWLRY+ +  LYP+GF  E 
Sbjct:    6 NMILFIYTLVLFILHGYGFLYIFHA------EYTSEFK---YPEIMWFLLFITSLQYLDIPFSFF-LTKSNPVAVFVQVSGRLLVLW---VASHMVSWKYAAFSLVAVYLLSELCRGPYYLSNCLGTPNRSLTWLRYNAFKVLYPVGFTCEA 144          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Fly
Match: Hacd2 (gene:FBgn0032524 transcript:FBtr0080519)

HSP 1 Score: 242.276 bits (617), Expect = 4.104e-75
Identity = 125/365 (34.25%), Postives = 210/365 (57.53%), Query Frame = 1
Query:   70 MTAFHPIVFWGQSKDYILLSIKIINAKNVVVNIAEENLSFSGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLTSQPMKLPWLKCDFNNFFFDESDYGSDESVKHNKPNKKDLTESLTEDDFIESEKLFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATI-GFYYLMMRMYGQRKQKIG 1161
            M    P V+W Q+K  +LL + + +AK  + + +  +++FS  G GA G+  Y FE  +Y  +   ++++ + +N IE++++K   + WPRL + P K  WLK DF+ +   E D   +E  +  + + +     L + +        K+ TK   +Y++ YNL  + GYLY+      + Y+ G++   K Y  + +    +QL+  LE++H   G+ K SP + F QV GRN +LF ++     +   P +F++   WS VE+VRYPYYL  LL   +  LTWLRY+IW+PLYP+G + EG ++L+ +P ++E+K+F++ +PN +NI FD V+FL +Y+ L  I G Y +M  M   R +K+G
Sbjct:    1 MANLSPFVYWSQTKQTLLLKVDLKDAKGAIADFSPVSVNFSANGHGARGVNAYKFELHFYALIDDENATFVVSDNKIELQIRKLEPEWWPRLVATPQKPHWLKIDFDRWR-TEDDVEVEEKPRDVRQDYEKEYADLQKREL----GYIKEKTK--KVYMIFYNLAMFVGYLYIMVVMGVLYYRDGVDSIGKTYANVGNAFKFIQLLQYLEVMHPMFGYTKGSPVVPFFQVSGRNFILFLMIDMEPRMYAKPVVFYVFIIWSLVELVRYPYYLAQLLGREVGLLTWLRYTIWIPLYPMGILCEGIIVLRNIPYIEETKRFTVEMPNPWNITFDMVLFLKIYLMLLIIPGSYLVMSHMAKLRSKKLG 358          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Fly
Match: Hacd1 (gene:FBgn0032394 transcript:FBtr0080313)

HSP 1 Score: 92.4337 bits (228), Expect = 7.232e-21
Identity = 69/222 (31.08%), Postives = 112/222 (50.45%), Query Frame = 1
Query:  514 KDVTKPLNLYLLMYNLFQYAGYLYVFGACL--WILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFL----LLYIPLATIGFYYLMMRMYGQRKQKIG 1161
            K+ +    LYL  YN  Q  G+ Y+    +  +IL       +  ++ Y R  +I  Q  + +EIL+A  G VKS+P +   QVF R +V+  +V+     +  P +      W+  EI+RY YY L ++K    F+ +LRY+ ++ LYPIG   E      A    +E+  +S+ +PN +N  F +  FL    L YIP+    F  L + M+ QR++ +G
Sbjct:   16 KEPSAVTKLYLFAYNAGQVVGWSYILWQLVNYYILQGPEFRAQVTLWEYTRLAVIIFQNAAFVEILNASFGLVKSNPVVTGFQVFSRMMVVVGVVMATPTGKVSPGLPIALLAWAITEIIRYGYYALNIVKVVPHFVVFLRYTTFIVLYPIGVTGELLCFWWAQSYARENSVWSVVMPNKWNATFSYFGFLWIVMLGYIPI----FPQLYLHMFAQRRKILG 233          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Zebrafish
Match: hacd3 (3-hydroxyacyl-CoA dehydratase 3 [Source:NCBI gene;Acc:393441])

HSP 1 Score: 197.978 bits (502), Expect = 3.657e-58
Identity = 113/358 (31.56%), Postives = 187/358 (52.23%), Query Frame = 1
Query:   70 MTAFHPIVFWGQSKDYILLSIKIINAKNVVVNIAEENLSFSGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLTSQPMKLPWLKCDFNNFFFDESDYGSDESVKHNKPNKKDLTESLTEDDFIESEKLFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFYYLMMRMYGQ 1143
            M+A  P V+W Q    I L ++I +A+++ + + E  L F G+G GA G   Y F  ++  PV P     K  +  + + ++K+ +  W RLT Q  K  +L  DF+ +  DESD   +   K  K NK      + +D F+  +K F          L MYNL Q+ GY ++F      L+  G +     +  I D +   Q+++++E+++  +G VK+     F+QV GRN +LF I     ++Q  P +F++   WS +EI RYP+Y+L  +      LTWLRY+IW+PLYP+G + E   +++++P+  E+K  SI LP A  +   F   L LY+ +  +G +     ++ Q
Sbjct:    1 MSALTPHVYWAQRHGEIYLRVEISDAQDLSIGVEENILQFRGQGHGAKGENEYEFSLEFLKPVKPEVKH-KSTQRQVNITVRKQEEVWWNRLTKQEKKPLFLAPDFDRWL-DESDAEMELREKEEKINKVSFESRVRKDPFLGLKKGF----------LFMYNLVQFLGYSWIFVNMTVRLFILGQDSFYDTFHTIADVMYFCQMLAIMEVINPAVGLVKTGVMPAFIQVMGRNFILFVIFGSLEDMQNKPVVFFVFYLWSTIEIFRYPFYMLACIDTEWKLLTWLRYTIWMPLYPLGVLAEAVAVIQSIPIFDETKLLSIPLPKATGLSLSFSYILQLYLVVMFLGLFINFRHLFKQ 346          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Zebrafish
Match: hacd3 (3-hydroxyacyl-CoA dehydratase 3 [Source:NCBI gene;Acc:393441])

HSP 1 Score: 197.978 bits (502), Expect = 3.657e-58
Identity = 113/358 (31.56%), Postives = 187/358 (52.23%), Query Frame = 1
Query:   70 MTAFHPIVFWGQSKDYILLSIKIINAKNVVVNIAEENLSFSGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLTSQPMKLPWLKCDFNNFFFDESDYGSDESVKHNKPNKKDLTESLTEDDFIESEKLFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFYYLMMRMYGQ 1143
            M+A  P V+W Q    I L ++I +A+++ + + E  L F G+G GA G   Y F  ++  PV P     K  +  + + ++K+ +  W RLT Q  K  +L  DF+ +  DESD   +   K  K NK      + +D F+  +K F          L MYNL Q+ GY ++F      L+  G +     +  I D +   Q+++++E+++  +G VK+     F+QV GRN +LF I     ++Q  P +F++   WS +EI RYP+Y+L  +      LTWLRY+IW+PLYP+G + E   +++++P+  E+K  SI LP A  +   F   L LY+ +  +G +     ++ Q
Sbjct:    1 MSALTPHVYWAQRHGEIYLRVEISDAQDLSIGVEENILQFRGQGHGAKGENEYEFSLEFLKPVKPEVKH-KSTQRQVNITVRKQEEVWWNRLTKQEKKPLFLAPDFDRWL-DESDAEMELREKEEKINKVSFESRVRKDPFLGLKKGF----------LFMYNLVQFLGYSWIFVNMTVRLFILGQDSFYDTFHTIADVMYFCQMLAIMEVINPAVGLVKTGVMPAFIQVMGRNFILFVIFGSLEDMQNKPVVFFVFYLWSTIEIFRYPFYMLACIDTEWKLLTWLRYTIWMPLYPLGVLAEAVAVIQSIPIFDETKLLSIPLPKATGLSLSFSYILQLYLVVMFLGLFINFRHLFKQ 346          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Zebrafish
Match: hacd3 (3-hydroxyacyl-CoA dehydratase 3 [Source:NCBI gene;Acc:393441])

HSP 1 Score: 185.652 bits (470), Expect = 1.753e-53
Identity = 112/364 (30.77%), Postives = 184/364 (50.55%), Query Frame = 1
Query:   70 MTAFHPIVFWGQSKDYILLSIKIINAKNVVVNIAEE------NLSFSGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLTSQPMKLPWLKCDFNNFFFDESDYGSDESVKHNKPNKKDLTESLTEDDFIESEKLFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFYYLMMRMYGQ 1143
            M+A  P V+W Q    I L ++I +A+    +   +        SF G+G GA G   Y F  ++  PV P     K  +  + + ++K+ +  W RLT Q  K  +L  DF+ +  DESD   +   K  K NK      + +D F+  +K F          L MYNL Q+ GY ++F      L+  G +     +  I D +   Q+++++E+++  +G VK+     F+QV GRN +LF I     ++Q  P +F++   WS +EI RYP+Y+L  +      LTWLRY+IW+PLYP+G + E   +++++P+  E+K  SI LP A  +   F   L LY+ +  +G +     ++ Q
Sbjct:    1 MSALTPHVYWAQRHGEIYLRVEISDAQVKTTSFHSQLPDFSIICSFKGQGHGAKGENEYEFSLEFLKPVKPEVKH-KSTQRQVNITVRKQEEVWWNRLTKQEKKPLFLAPDFDRWL-DESDAEMELREKEEKINKVSFESRVRKDPFLGLKKGF----------LFMYNLVQFLGYSWIFVNMTVRLFILGQDSFYDTFHTIADVMYFCQMLAIMEVINPAVGLVKTGVMPAFIQVMGRNFILFVIFGSLEDMQNKPVVFFVFYLWSTIEIFRYPFYMLACIDTEWKLLTWLRYTIWMPLYPLGVLAEAVAVIQSIPIFDETKLLSIPLPKATGLSLSFSYILQLYLVVMFLGLFINFRHLFKQ 352          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Zebrafish
Match: hacd2 (3-hydroxyacyl-CoA dehydratase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6053])

HSP 1 Score: 101.679 bits (252), Expect = 5.951e-24
Identity = 75/232 (32.33%), Postives = 113/232 (48.71%), Query Frame = 1
Query:  496 ESEKLFKDVTKPLNL---YLLMYNLFQYAGYLYV-FGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLL----YIPLATIGFYYLMMRMYGQRKQKIGPI 1167
             SE   K    P  L   YL++YN+   AG+L +  G     L +    G   +Y  I   L   Q  ++LEILH  +G V SS  +   QV  R  + + +      +Q++  +      W+  EI+RY +Y   LL      + W RY+ ++ LYP+G M E   I  A+P +Q++  +SI LPN +N  FD+  FL+     YIPL     Y+ MMR   QRK+ +G +
Sbjct:   13 HSESGHKKKKGPGTLATAYLVIYNVIMTAGWLVIAVGLVRAYLARGSYHG---LYYSIEKPLKFFQTGALLEILHCAVGIVPSSVVLTGFQVMSRVFLTWAVTHSVREVQSEDSVLLFVVAWTVTEIIRYSFYTFSLLNHLPYLIKWARYTFFIVLYPMGVMGELLTIYAALPYVQKAGLYSITLPNKYNFSFDYHTFLIFVMISYIPLFP-QLYFHMMR---QRKKVLGHV 237          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Zebrafish
Match: hacd2 (3-hydroxyacyl-CoA dehydratase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6053])

HSP 1 Score: 93.9745 bits (232), Expect = 1.719e-21
Identity = 66/208 (31.73%), Postives = 100/208 (48.08%), Query Frame = 1
Query:  496 ESEKLFKDVTKPLNL---YLLMYNLFQYAGYLYV-FGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLL----YIP 1095
             SE   K    P  L   YL++YN+   AG+L +  G     L +    G   +Y  I   L   Q  ++LEILH  +G V SS  +   QV  R  + + +      +Q++  +      W+  EI+RY +Y   LL      + W RY+ ++ LYP+G M E   I  A+P +Q++  +SI LPN +N  FD+  FL+     YIP
Sbjct:    9 HSESGHKKKKGPGTLATAYLVIYNVIMTAGWLVIAVGLVRAYLARGSYHG---LYYSIEKPLKFFQTGALLEILHCAVGIVPSSVVLTGFQVMSRVFLTWAVTHSVREVQSEDSVLLFVVAWTVTEIIRYSFYTFSLLNHLPYLIKWARYTFFIVLYPMGVMGELLTIYAALPYVQKAGLYSITLPNKYNFSFDYHTFLIFVMISYIP 213          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Xenopus
Match: lrp12 (LDL receptor related protein 12 [Source:Xenbase;Acc:XB-GENE-980112])

HSP 1 Score: 166.392 bits (420), Expect = 2.916e-46
Identity = 103/327 (31.50%), Postives = 166/327 (50.76%), Query Frame = 1
Query:   85 PIVFWGQSKDYILLSIKIINAKNVVVNIAEENLSFSGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLTSQPMKLPWLKCDFNNFFFDESDYGSDESVKHNKPNKKDLTESLTEDDFIESEKLFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFD 1065
            P VFW Q    + L +++ + +N  + I++  L+F  +G GA G+  Y F  +++ PV P       +   + + +KK  K  WPRL  Q  K  +L  D + +  DESD      +K   P        L     I    L+         YL MYNL Q+ G+ ++F      L+  G +     +  + D +   Q +++LEI++  +G VK+  A   +QV GRN +LF I+     +QT   +F++   WS +EI RYP+Y+L  L      LTW+RY+IW+PLYP+G + E   I++A+P+  E+ +FS+ LP  F + F 
Sbjct:   10 PHVFWAQRHHELYLRVELSDVQNPDITISDNVLNFKAQGHGAKGVNLYEFSLEFFAPVKPKFIQRSTQRQ-VAITVKKSEKLWWPRLIKQERKPRFLAPDCDRWL-DESD------LKTILP--------LHAIGRIRGSFLYLKRG-----YLFMYNLVQFLGFSWIFVNMTVRLFILGQDSFYDTFNSMGDMMYFCQTLALLEIINPLIGLVKTGVAPALIQVLGRNFILFFILGQLDEMQTKAIVFFIFYLWSSIEIFRYPFYMLACLDTEWKLLTWIRYTIWIPLYPLGALAEAASIIQAIPIFNETGRFSLRLPLEFTVSFS 315          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Xenopus
Match: lrp12 (LDL receptor related protein 12 [Source:Xenbase;Acc:XB-GENE-980112])

HSP 1 Score: 167.162 bits (422), Expect = 3.440e-46
Identity = 107/353 (30.31%), Postives = 176/353 (49.86%), Query Frame = 1
Query:   76 AFHPIVFWGQSKDYILLSIKIINAKNVV----------------------VNIAEENLSFSGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLTSQPMKLPWLKCDFNNFFFDESDYGSDESVKHNKPNKKDLTESL-TEDDFIESEKLFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFD 1065
            +  P VFW Q    + L +++ + + V+                      + I++  L+F  +G GA G+  Y F  +++ PV P  S+    +  + + +KK  K  WPRL  Q  K  +L  D + +  DESD   +   K  +   K  TES   ED F+  ++           YL MYNL Q+ G+ ++F      L+  G +     +  + D +   Q +++LEI++  +G VK+  A   +QV GRN +LF I+     +QT   +F++   WS +EI RYP+Y+L  L      LTW+RY+IW+PLYP+G + E   I++A+P+  E+ +FS+ LP  F + F 
Sbjct:    7 SLTPHVFWAQRHHELYLRVELSDVQVVLGMGGVASLPLNYISQHTDTNPDITISDNVLNFKAQGHGAKGVNLYEFSLEFFAPVKPKRST----QRQVAITVKKSEKLWWPRLIKQERKPRFLAPDCDRWL-DESDAEMELREKEEERITKIRTESRKREDPFLYLKRG----------YLFMYNLVQFLGFSWIFVNMTVRLFILGQDSFYDTFNSMGDMMYFCQTLALLEIINPLIGLVKTGVAPALIQVLGRNFILFFILGQLDEMQTKAIVFFIFYLWSSIEIFRYPFYMLACLDTEWKLLTWIRYTIWIPLYPLGALAEAASIIQAIPIFNETGRFSLRLPLEFTVSFS 344          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Xenopus
Match: lrp12 (LDL receptor related protein 12 [Source:Xenbase;Acc:XB-GENE-980112])

HSP 1 Score: 156.377 bits (394), Expect = 7.773e-43
Identity = 97/302 (32.12%), Postives = 156/302 (51.66%), Query Frame = 1
Query:   76 AFHPIVFWGQSKDYILLSIKIINAKNVVVNIAEENLSFSGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLTSQPMKLPWLKCDFNNFFFDESDYGSDESVKHNKPNKKDLTESL-TEDDFIESEKLFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEG 978
            +  P VFW Q    + L +++ + +N  + I++  L+F  +G GA G+  Y F  +++ PV P       +   + + +KK  K  WPRL  Q  K  +L  D + +  DESD   +   K  +   K  TES   ED F+  ++           YL MYNL Q+ G+ ++F      L+  G +     +  + D +   Q +++LEI++  +G VK+  A   +QV GRN +LF I+     +QT   +F++   WS +EI RYP+Y+L  L      LTW+RY+IW+PLYP+G + EG
Sbjct:    7 SLTPHVFWAQRHHELYLRVELSDVQNPDITISDNVLNFKAQGHGAKGVNLYEFSLEFFAPVKPKFIQRSTQRQ-VAITVKKSEKLWWPRLIKQERKPRFLAPDCDRWL-DESDAEMELREKEEERITKIRTESRKREDPFLYLKRG----------YLFMYNLVQFLGFSWIFVNMTVRLFILGQDSFYDTFNSMGDMMYFCQTLALLEIINPLIGLVKTGVAPALIQVLGRNFILFFILGQLDEMQTKAIVFFIFYLWSSIEIFRYPFYMLACLDTEWKLLTWIRYTIWIPLYPLGALAEG 296          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Xenopus
Match: HACD1 (3-hydroxyacyl-CoA dehydratase 1 [Source:NCBI gene;Acc:100145048])

HSP 1 Score: 98.5969 bits (244), Expect = 9.721e-23
Identity = 72/245 (29.39%), Postives = 120/245 (48.98%), Query Frame = 1
Query:  463 LTESLTEDDFIESEKLFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLL----YIPLATIGFYYLMMRMYGQRKQKIGP--IVKKD 1179
            +  S  E    E E   K +      +L  YN+   AG+L +  A +    + G      +Y  I+  L   Q  ++LE++H  +G V +S  +  +QV  R  +++ I      +Q++  +      W+  EI RY YY   LL     F+ W RY++++ LYP+G + E   I  A+P +++S  +S+ LPN +N+ FD+  FL++    YIPL    F  L   M  QR++ +    IV+KD
Sbjct:    1 MASSDDEGSVEEKEHTKKKIGPLATAWLTFYNIAMTAGWLVLAIAMIRFYAEKGTH--KGLYRNIQKTLKFFQTFALLELVHCALGIVHTSVLVTGVQVSSRIFMVWFITSSIKQVQSEHGVLIFLVVWTVTEITRYSYYTFKLLNHLPYFIKWARYNLFIVLYPVGVVGELLTIYAALPHVRKSAMYSLRLPNKYNVSFDYYYFLIIAMCSYIPL----FPQLYFHMLRQRRRVLHGEVIVEKD 239          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Xenopus
Match: kif2a (kinesin heavy chain member 2A [Source:Xenbase;Acc:XB-GENE-951755])

HSP 1 Score: 94.7449 bits (234), Expect = 2.647e-21
Identity = 65/217 (29.95%), Postives = 104/217 (47.93%), Query Frame = 1
Query:  541 YLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLL----YIPLATIGFYYLMMRMYGQRKQKIGPIVKKD 1179
            YL++YN+   AG+L +    +      G      +Y  I   L   Q  ++LEI H  +G V SS  +   QV  R  + + +      +Q +  +      W+  EI+RY +Y   LL      + W RY++++ LYP+G   E   I  A+P ++++  +SI LPN +N  FD+  FL+L    YIP+    F  L   M+ QR++ I    KK 
Sbjct:   36 YLVIYNVVMTAGWLVIAVGLVRTYLTKG--SYHNLYYSIERPLKFFQTGALLEIGHCAVGIVPSSVVLTAFQVMSRVFLTWAVTHSVREVQNEDSVLLFVVAWTITEIIRYSFYTFSLLNHLPYIIKWARYTLFIVLYPMGVTGELLTIYAALPTVKKTGLYSISLPNKYNFSFDYYTFLILVMMSYIPI----FPQLYFHMFHQRRKVITAEHKKS 246          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Mouse
Match: Hacd3 (3-hydroxyacyl-CoA dehydratase 3 [Source:MGI Symbol;Acc:MGI:1889341])

HSP 1 Score: 175.252 bits (443), Expect = 1.684e-49
Identity = 105/366 (28.69%), Postives = 190/366 (51.91%), Query Frame = 1
Query:   85 PIVFWGQSKDYILLSIKIINAKNVVVNIAEENLSFSGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLTSQPMKLPWLKCDFNNFFFDESDYGSDESVKHN-KPNKKDLTESLTEDDFIESEKLFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAM-VFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFYYLMMRMYGQRKQKIGPIVKK 1176
            P V+W Q    + L +++ + +N  ++I +  L F  +G GA G   Y F  ++ L ++    ++++ +  + + ++K+    W RLT Q  +  +L  DF+ +  DESD   +   K   + NK  L          E E   + +T     YL MYNL Q  G+ ++F       +  G E     +  + D +   Q+++++E L+A +G V S+P +   +Q  GRN +LF +      +Q    +F++  +WS +EI RYP+Y+L  +  +   LTWLRY++W+PLYP+G ++E   +++++P+  ES +FS  LP    ++  F  FL +Y+ +  +G Y     +Y QR+++ G   KK
Sbjct:    8 PHVYWAQRHRELYLRVELSDVQNPAISITDNVLHFKAQGHGAKGDNVYEFHLEF-LDLVKPEPAYRLTQRQVNITVQKKGSHWWERLTKQEKRPLFLAPDFDRWL-DESDAEMELRAKEEERLNKLRL----------EREGSPETLTNLKKGYLFMYNLVQLLGFSWIFVNLTVRFFILGKESFYDTFHNVADMMYFCQMLALVETLNAAIG-VTSTPVLPALIQFLGRNFILFLVFGTMEEMQNKAVVFFVFYSWSAIEIFRYPFYMLSCIDMDWKVLTWLRYTMWIPLYPLGCLSEAVAVIQSIPVFNESGRFSFTLPYPVKMKVRFSFFLQVYLVMLFLGLYINFRHLYKQRRRRYGQKKKK 360          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Mouse
Match: Hacd1 (3-hydroxyacyl-CoA dehydratase 1 [Source:MGI Symbol;Acc:MGI:1353592])

HSP 1 Score: 96.2857 bits (238), Expect = 4.591e-22
Identity = 67/219 (30.59%), Postives = 111/219 (50.68%), Query Frame = 1
Query:  541 YLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLL----YIPLATIGFYYLMMRMYGQRKQKIGP--IVKKD 1179
            +L  YN+   AG+L +  A +    + G      +Y  I+  L   Q  ++LE++H  +G V +S  +  +QV  R  +++ I      +Q +  +     +W+  EI RY +Y   LL     F+ W RY++++ LYP+G   E   I  A+P +++S  FS+ LPN +N+ FD+  FLL+    YIPL    F  L   M  QR++ +    I +KD
Sbjct:   35 WLTFYNIAMTAGWLVLAIAMVRFYMEKGTH--RGLYKSIQKTLKFFQTFALLEVVHCLIGIVPTSVLVTGVQVSSRIFMVWLITHSIKPIQNEESVVLFLVSWTVTEITRYSFYTFSLLDHLPHFIKWARYNLFIILYPVGVAGELLTIYAALPYVKKSGMFSVRLPNKYNVSFDYYYFLLITMASYIPL----FPQLYFHMLRQRRKVLHGEVIAEKD 247          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Mouse
Match: Hacd1 (3-hydroxyacyl-CoA dehydratase 1 [Source:MGI Symbol;Acc:MGI:1353592])

HSP 1 Score: 96.2857 bits (238), Expect = 4.591e-22
Identity = 67/219 (30.59%), Postives = 111/219 (50.68%), Query Frame = 1
Query:  541 YLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLL----YIPLATIGFYYLMMRMYGQRKQKIGP--IVKKD 1179
            +L  YN+   AG+L +  A +    + G      +Y  I+  L   Q  ++LE++H  +G V +S  +  +QV  R  +++ I      +Q +  +     +W+  EI RY +Y   LL     F+ W RY++++ LYP+G   E   I  A+P +++S  FS+ LPN +N+ FD+  FLL+    YIPL    F  L   M  QR++ +    I +KD
Sbjct:   35 WLTFYNIAMTAGWLVLAIAMVRFYMEKGTH--RGLYKSIQKTLKFFQTFALLEVVHCLIGIVPTSVLVTGVQVSSRIFMVWLITHSIKPIQNEESVVLFLVSWTVTEITRYSFYTFSLLDHLPHFIKWARYNLFIILYPVGVAGELLTIYAALPYVKKSGMFSVRLPNKYNVSFDYYYFLLITMASYIPL----FPQLYFHMLRQRRKVLHGEVIAEKD 247          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Mouse
Match: Hacd2 (3-hydroxyacyl-CoA dehydratase 2 [Source:MGI Symbol;Acc:MGI:1918007])

HSP 1 Score: 95.5153 bits (236), Expect = 9.690e-22
Identity = 64/208 (30.77%), Postives = 103/208 (49.52%), Query Frame = 1
Query:  541 YLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLL----YIPLATIGFYYLMMRMYGQRKQ 1152
            YL++YN+   AG+L +    +      G      +Y  I   L   Q  ++LEILH  +G V SS  +   QV  R  +++ +      +Q++  +      W+  EI+RY +Y   LL      + W RY++++ LYP+G   E   I  A+P ++++  +SI LPN +N  FD+  FL+L    YIPL    F  L   M  QR++
Sbjct:   41 YLVIYNVVMTAGWLVIAVGLVRAYLAKG--SYHSLYYSIERPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWAVTHSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYIIKWARYTLFIVLYPMGVTGELLTIYAALPFVRQAGLYSISLPNKYNFSFDYHAFLILIMISYIPL----FPQLYFHMIHQRRK 242          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Mouse
Match: Hacd4 (3-hydroxyacyl-CoA dehydratase 4 [Source:MGI Symbol;Acc:MGI:1914025])

HSP 1 Score: 91.2781 bits (225), Expect = 2.926e-20
Identity = 56/205 (27.32%), Postives = 105/205 (51.22%), Query Frame = 1
Query:  535 NLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFYYLMMRMYGQRK 1149
            N+YL +Y L Q+ G+ ++        +  G +  +  +  I   +   Q +S+LE+LH Y+G   +     F+Q+  R ++LF ++     +Q    +  L   W+ +++VRY Y +L ++  + A LTWL  ++W+P+YP+  + E   I +++P  +     S  LP   +  F +V  L LY+ +  IG Y+    +Y +RK
Sbjct:   37 NVYLFIYYLIQFCGHSWILANMTVRFFSFGKDSMADTFYAIGLVMRVCQSISLLELLHIYIGIESNQLFPRFLQLTERVIILFGVITSQEEVQEKCVVCVLFILWNLLDMVRYTYSMLSVIGTSYAALTWLSQTLWMPIYPLCVLAEAFTIYQSLPYFESFGTNSTVLPFDLSTCFPYV--LKLYLMMLFIGMYFTYSHLYTERK 239          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. UniProt/SwissProt
Match: sp|Q7SY06|HACD3_DANRE (Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Danio rerio OX=7955 GN=hacd3 PE=2 SV=2)

HSP 1 Score: 197.978 bits (502), Expect = 2.761e-57
Identity = 113/358 (31.56%), Postives = 187/358 (52.23%), Query Frame = 1
Query:   70 MTAFHPIVFWGQSKDYILLSIKIINAKNVVVNIAEENLSFSGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLTSQPMKLPWLKCDFNNFFFDESDYGSDESVKHNKPNKKDLTESLTEDDFIESEKLFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFYYLMMRMYGQ 1143
            M+A  P V+W Q    I L ++I +A+++ + + E  L F G+G GA G   Y F  ++  PV P     K  +  + + ++K+ +  W RLT Q  K  +L  DF+ +  DESD   +   K  K NK      + +D F+  +K F          L MYNL Q+ GY ++F      L+  G +     +  I D +   Q+++++E+++  +G VK+     F+QV GRN +LF I     ++Q  P +F++   WS +EI RYP+Y+L  +      LTWLRY+IW+PLYP+G + E   +++++P+  E+K  SI LP A  +   F   L LY+ +  +G +     ++ Q
Sbjct:    1 MSALTPHVYWAQRHGEIYLRVEISDAQDLSIGVEENILQFRGQGHGAKGENEYEFSLEFLKPVKPEVKH-KSTQRQVNITVRKQEEVWWNRLTKQEKKPLFLAPDFDRWL-DESDAEMELREKEEKINKVSFESRVRKDPFLGLKKGF----------LFMYNLVQFLGYSWIFVNMTVRLFILGQDSFYDTFHTIADVMYFCQMLAIMEVINPAVGLVKTGVMPAFIQVMGRNFILFVIFGSLEDMQNKPVVFFVFYLWSTIEIFRYPFYMLACIDTEWKLLTWLRYTIWMPLYPLGVLAEAVAVIQSIPIFDETKLLSIPLPKATGLSLSFSYILQLYLVVMFLGLFINFRHLFKQ 346          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. UniProt/SwissProt
Match: sp|Q5ZM57|HACD3_CHICK (Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Gallus gallus OX=9031 GN=HACD3 PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 2.458e-53
Identity = 115/368 (31.25%), Postives = 192/368 (52.17%), Query Frame = 1
Query:   73 TAFHPIVFWGQSKDYILLSIKIINAKNVVVNIAEENLSFSGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLTSQPMKLPWLKCDFNNFFFDESDYGSDESVKHNKPNKKDLTESLTEDDFIESEKLFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFYYLMMRMYGQRKQKIGPIVKK 1176
             +  P V W Q    + L +++ + KN  V+IA+  L F  +G GA G   Y F+ ++  PV P     ++ +  + + ++K+    W RLT Q  +  +L  DF+ +  DESD   +   K  +   K   ES    D       FK + K    YL+MYNL Q+ G+ ++F      L+  G +     +  I D +   Q ++++EIL++ +G V+S      +QVFGRN +LF ++     +Q+   +F+L   WS +E+ RYPYY+L  +      LTWLRY+ W+PLYP+G + E   +++++P+  E+ +FS+ LPN  N+   F   L +Y+    +G +     +Y QRKQ +GP  +K
Sbjct:    4 CSLRPHVHWAQRHRELYLRVELSDVKNPDVSIADNVLRFRAQGHGAKGDNIYEFQIEFLEPVEPKPVC-RVTQRQLNITVQKKESSWWERLTKQEKRPLFLAPDFDRWL-DESDAEMELKEKEEEKINKMKIESRVPKD------PFKHLKKG---YLIMYNLVQFLGFSWIFVNMTVRLFILGKDSFYDTFHTIADMMYFCQTLALMEILNSLIGLVRSPLIPAVIQVFGRNFILFVVLGSLEEMQSKAVVFFLFYFWSIIELFRYPYYMLSCMGIEWKPLTWLRYTSWIPLYPLGGLAEAVCLIQSIPIFSETGKFSLGLPNPLNVTIQFSFLLQMYLIALFLGLFVNFRYLYKQRKQHLGPKKRK 360          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. UniProt/SwissProt
Match: sp|A7YY55|HACD3_BOVIN (Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Bos taurus OX=9913 GN=HACD3 PE=2 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 2.724e-50
Identity = 107/364 (29.40%), Postives = 183/364 (50.27%), Query Frame = 1
Query:   85 PIVFWGQSKDYILLSIKIINAKNVVVNIAEENLSFSGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLTSQPMKLPWLKCDFNNFFFDESDYGSDESVKHNKPNKKDLTESLTEDDFIESEKLFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFYYLMMRMYGQRKQKIGPIVKK 1176
            P V+W Q    + L +++ + +N  ++I E  L F  +G GA G   Y F  ++ L ++     +K+ +  + + ++K+    W RLT Q  +  +L  DF+ +  DESD   +   K  +   K   ES    + + S K           YL MYNL Q+ G+ ++F       +  G E     +  + D +   Q+++ +E ++A +G  KS       Q+ GRN +LF I      +Q    +F++   WS VEI RYP+Y+L  +  +   LTWLRY++W+PLYP+G + E   +++++P+  E+ +FS  LP    I+  F  FL +Y+ L  +G Y     +Y QR+++ G   KK
Sbjct:    8 PHVYWAQRHHELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLEF-LDLVKPEPVYKLTQRQVNITVQKKESQWWERLTKQEKRPLFLAPDFDRWL-DESDAEMELRAKEEEQLNKLRLESQGSPETLTSLK---------KGYLFMYNLVQFLGFSWIFVNMTVRFFILGKESFYDTFHTVADMMYFCQMLAAVESINAAIGVTKSPVVPSLFQLLGRNFILFIIFGTMEEMQNKAVVFFVFYIWSTVEIFRYPFYMLSCIDMDWKVLTWLRYTVWIPLYPMGCLAEAVSVIQSIPVFNETGRFSFTLPYPVKIKVRFSFFLQIYLILLFLGLYVNFRYLYKQRRRRFGQKKKK 360          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. UniProt/SwissProt
Match: sp|Q9P035|HACD3_HUMAN (Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Homo sapiens OX=9606 GN=HACD3 PE=1 SV=2)

HSP 1 Score: 177.178 bits (448), Expect = 2.436e-49
Identity = 108/366 (29.51%), Postives = 189/366 (51.64%), Query Frame = 1
Query:   85 PIVFWGQSKDYILLSIKIINAKNVVVNIAEENLSFSGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLTSQPMKLPWLKCDFNNFFFDESDYGSDESVKHN-KPNKKDLTESLTEDDFIESEKLFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAM-VFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFYYLMMRMYGQRKQKIGPIVKK 1176
            P V+W Q    + L +++ + +N  ++I E  L F  +G GA G   Y F  ++ L ++     +K+ +  + + ++K++   W RLT Q  +  +L  DF+ +  DESD   +   K   + NK  L          ESE   + +T     YL MYNL Q+ G+ ++F          G E     +  + D +   Q+++V+E ++A +G V +SP +   +Q+ GRN +LF I      +Q    +F++   WS +EI RY +Y+L  +  +   LTWLRY++W+PLYP+G + E   +++++P+  E+ +FS  LP    I+  F  FL +Y+ +  +G Y     +Y QR+++ G   KK
Sbjct:    8 PHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLEF-LDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWL-DESDAEMELRAKEEERLNKLRL----------ESEGSPETLTNLRKGYLFMYNLVQFLGFSWIFVNLTVRFCILGKESFYDTFHTVADMMYFCQMLAVVETINAAIG-VTTSPVLPSLIQLLGRNFILFIIFGTMEEMQNKAVVFFVFYLWSAIEIFRYSFYMLTCIDMDWKVLTWLRYTLWIPLYPLGCLAEAVSVIQSIPIFNETGRFSFTLPYPVKIKVRFSFFLQIYLIMIFLGLYINFRHLYKQRRRRYGQKKKK 360          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. UniProt/SwissProt
Match: sp|Q8K2C9|HACD3_MOUSE (Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Mus musculus OX=10090 GN=Hacd3 PE=1 SV=2)

HSP 1 Score: 175.252 bits (443), Expect = 1.178e-48
Identity = 105/366 (28.69%), Postives = 190/366 (51.91%), Query Frame = 1
Query:   85 PIVFWGQSKDYILLSIKIINAKNVVVNIAEENLSFSGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLTSQPMKLPWLKCDFNNFFFDESDYGSDESVKHN-KPNKKDLTESLTEDDFIESEKLFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAM-VFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFYYLMMRMYGQRKQKIGPIVKK 1176
            P V+W Q    + L +++ + +N  ++I +  L F  +G GA G   Y F  ++ L ++    ++++ +  + + ++K+    W RLT Q  +  +L  DF+ +  DESD   +   K   + NK  L          E E   + +T     YL MYNL Q  G+ ++F       +  G E     +  + D +   Q+++++E L+A +G V S+P +   +Q  GRN +LF +      +Q    +F++  +WS +EI RYP+Y+L  +  +   LTWLRY++W+PLYP+G ++E   +++++P+  ES +FS  LP    ++  F  FL +Y+ +  +G Y     +Y QR+++ G   KK
Sbjct:    8 PHVYWAQRHRELYLRVELSDVQNPAISITDNVLHFKAQGHGAKGDNVYEFHLEF-LDLVKPEPAYRLTQRQVNITVQKKGSHWWERLTKQEKRPLFLAPDFDRWL-DESDAEMELRAKEEERLNKLRL----------EREGSPETLTNLKKGYLFMYNLVQLLGFSWIFVNLTVRFFILGKESFYDTFHNVADMMYFCQMLALVETLNAAIG-VTSTPVLPALIQFLGRNFILFLVFGTMEEMQNKAVVFFVFYSWSAIEIFRYPFYMLSCIDMDWKVLTWLRYTMWIPLYPLGCLSEAVAVIQSIPVFNESGRFSFTLPYPVKMKVRFSFFLQVYLVMLFLGLYINFRHLYKQRRRRYGQKKKK 360          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. TrEMBL
Match: G4VGD4 (Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Schistosoma mansoni OX=6183 GN=Smp_121880 PE=3 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 4.495e-100
Identity = 157/387 (40.57%), Postives = 242/387 (62.53%), Query Frame = 1
Query:   76 AFHPIVFWGQSKDYILLSIKIINAKNVVVNIAEENLSFSGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLTSQPMKLPWLKCDFNNFFFDESDYGSDE------SVKHNKPNKKDL--TESLTEDDFIESEKLFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAM-VFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFYYLMMRMYGQRKQKIGPIVKKDWSNYNFLQYL 1209
              HPIV+WGQS++Y+ LSIK+ NA    + I +E   FS  G GA G+K Y F   YYLP++P  S + +    + VKL+KELKD W RLT    +LPW++ DF+ + F++SD  ++E      +V H    ++D    E +   D  E E     +  PL +YL ++N+ Q++GYLYV GA ++ L ++    K   Y +  D+L+ VQ++S+LE LHA++GW++    + V  Q+FGR+ VLFCIV+PH+   +    +WL  +WS +E+VRYPYY+L LL      +T+LR+++W+ LYPIGF+ EGKLI++++PLL ES++F + LPN+ N+ FDF  FL +Y+   + G YY M  +Y +R++ IGP   K      +L ++
Sbjct:    7 CIHPIVYWGQSEEYVFLSIKVANANVDSITINQEEFMFSAMGTGADGVKKYEFSISYYLPIIPEESRYVVTSLSVNVKLRKELKDSWSRLTLGNQRLPWVRSDFDRYQFNDSDLENNEEECLNVNVVHPSKEERDKHNEEQMMLIDAEEWEAFLNLIKNPLTIYLFIFNVVQFSGYLYVCGALVYGLMQYKEVHKIPFYEWTIDRLVFVQILSILEPLHAFLGWIRGGSILPVVFQLFGRSFVLFCIVLPHAEFHSASTTYWLFFSWSLIEVVRYPYYILSLLSFQNGLITYLRHTLWIILYPIGFICEGKLIIRSLPLLIESRKFCLELPNSANVSFDFTTFLQIYMFSMSFGLYYNMRHLYLRRRKIIGPRPIKGADQMGYLSFI 393          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. TrEMBL
Match: A0A183R4F5 (Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Schistosoma rodhaini OX=6188 PE=3 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 1.760e-98
Identity = 160/389 (41.13%), Postives = 242/389 (62.21%), Query Frame = 1
Query:   76 AFHPIVFWGQSKDYILLSIKIINAKNVVVNIAEENLSFSGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLT--SQPMKLPWLKCDFNNFFFDESDYGSDE------SVKHNKPNKKDL--TESLTEDDFIESEKLFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAM-VFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFYYLMMRMYGQRKQKIGPIVKKDWSNYNFLQYL 1209
              HPIV+WGQS++YI LSIK+ NA    + I +E   FS  G GA G+K Y F   YYLP++P  S + +    + VKL+KELKD W RLT      +LPW++ DF+ + F++SD  ++E      +V H    ++D    E +   D  E E     +  PL +YL ++N+ Q++GYLYV GA ++ L ++    K   Y +  D+L+ VQ++S+LE LHA++GW++S   + V  Q+FGR+ VLFCIV+PH+   +    +WL  +WS +E+VRYPYY+L LL      +T+LR+++W+ LYPIGF+ EGKLI++++PLL ES++F + LPN  NI FDF  FL +Y+   + G YY M  +Y +R++ IGP   K      +L ++
Sbjct:    7 CIHPIVYWGQSEEYIFLSIKVANANVDSITINQEEFMFSAMGTGADGVKKYEFSISYYLPIIPEESRYVVTSLSVNVKLRKELKDSWSRLTLXXXXQRLPWVRPDFDRYQFNDSDLENNEEECLNVNVVHPSKEERDKHNEEQMMLIDAEEWEAFLNLIKNPLTIYLFIFNVVQFSGYLYVCGALVYGLMQYKEVHKIPFYEWTIDRLVFVQILSILEPLHAFLGWIRSGSILPVVFQLFGRSFVLFCIVLPHAEFHSASTTYWLFFSWSLIEVVRYPYYILSLLSFQNGLITYLRHTLWIILYPIGFICEGKLIIRSLPLLIESRKFCLELPNPANISFDFTTFLQIYMFSMSFGLYYNMRHLYLRRRKIIGPRPIKGSDQMGYLSFI 395          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. TrEMBL
Match: A0A4S2MFA3 (Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Opisthorchis felineus OX=147828 GN=CRM22_001351 PE=3 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 2.028e-97
Identity = 166/394 (42.13%), Postives = 236/394 (59.90%), Query Frame = 1
Query:   82 HPIVFWGQSKDYILLSIKIINAKNVVVNIAEENLSFSGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLTSQPMKLPWLKCDFNNFFFDESDY---GSDES----VKHNKPNKKDLTESLTEDDFIESEK----LFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEG-------KSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFYYLMMRMYGQRKQKIGPIVKKDWSNYNFLQYL 1209
            HP V WGQ++ Y+ LS+++ +A++V V+I +E+L+F+  G GA G + Y F   YYLP++   S + +    I ++L+KELKD WPRLT Q  KLPW   DF+ + FD SD    G D      VK  +P K++      E   IE E+      K +  PL +YLL++NLFQ+AG+L VFG+ + +L K  +EG       +S I      +L  VQL++ LE LH  + WV+       +QV GR LVLF IV+PH  L TD  +FWL   WS +E+ RYP+Y+  LL      LT+LRY+ W+PLYPIGFM EGKLI++A+P L +S++FS  +PNA N+ FDF +FL  Y+      FY+LM  MY QR++ +GP  +       F  Y+
Sbjct:   16 HPFVKWGQNETYVFLSVQLGDAEDVAVDITDESLTFAAVGNGAHGREQYRFRLDYYLPIVAKQSRYTVTGRAILIRLRKELKDAWPRLTVQSEKLPWTHLDFDLYQFDASDAEPSGDDAEGGVKVKVIRPTKEERELHNAEMRAIEMEEEWEAFLKVLKHPLTIYLLLFNLFQFAGFLSVFGSLVLVLLK--VEGYVPRDWFESSI-----SRLAVVQLLAFLEPLHVCLRWVRGGILASLLQVSGRALVLFLIVIPHKELHTDSSVFWLFFVWSAIEVQRYPFYICSLLGYKNGLLTYLRYTSWIPLYPIGFMCEGKLIVRALPWLTKSRRFSYSMPNALNMAFDFPMFLHTYLVGMIAVFYFLMRYMYAQRRRVLGPRPRVGADQMGFFSYI 402          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. TrEMBL
Match: A0A4S2MAZ7 (Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Opisthorchis felineus OX=147828 GN=CRM22_001351 PE=3 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 2.364e-97
Identity = 166/394 (42.13%), Postives = 236/394 (59.90%), Query Frame = 1
Query:   82 HPIVFWGQSKDYILLSIKIINAKNVVVNIAEENLSFSGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLTSQPMKLPWLKCDFNNFFFDESDY---GSDES----VKHNKPNKKDLTESLTEDDFIESEK----LFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEG-------KSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFYYLMMRMYGQRKQKIGPIVKKDWSNYNFLQYL 1209
            HP V WGQ++ Y+ LS+++ +A++V V+I +E+L+F+  G GA G + Y F   YYLP++   S + +    I ++L+KELKD WPRLT Q  KLPW   DF+ + FD SD    G D      VK  +P K++      E   IE E+      K +  PL +YLL++NLFQ+AG+L VFG+ + +L K  +EG       +S I      +L  VQL++ LE LH  + WV+       +QV GR LVLF IV+PH  L TD  +FWL   WS +E+ RYP+Y+  LL      LT+LRY+ W+PLYPIGFM EGKLI++A+P L +S++FS  +PNA N+ FDF +FL  Y+      FY+LM  MY QR++ +GP  +       F  Y+
Sbjct:    9 HPFVKWGQNETYVFLSVQLGDAEDVAVDITDESLTFAAVGNGAHGREQYRFRLDYYLPIVAKQSRYTVTGRAILIRLRKELKDAWPRLTVQSEKLPWTHLDFDLYQFDASDAEPSGDDAEGGVKVKVIRPTKEERELHNAEMRAIEMEEEWEAFLKVLKHPLTIYLLLFNLFQFAGFLSVFGSLVLVLLK--VEGYVPRDWFESSI-----SRLAVVQLLAFLEPLHVCLRWVRGGILASLLQVSGRALVLFLIVIPHKELHTDSSVFWLFFVWSAIEVQRYPFYICSLLGYKNGLLTYLRYTSWIPLYPIGFMCEGKLIVRALPWLTKSRRFSYSMPNALNMAFDFPMFLHTYLVGMIAVFYFLMRYMYAQRRRVLGPRPRVGADQMGFFSYI 395          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. TrEMBL
Match: A0A419Q398 (Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase (Fragment) OS=Clonorchis sinensis OX=79923 GN=Hacd3 PE=3 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 1.590e-96
Identity = 169/394 (42.89%), Postives = 239/394 (60.66%), Query Frame = 1
Query:   82 HPIVFWGQSKDYILLSIKIINAKNVVVNIAEENLSFSGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLTSQPMKLPWLKCDFNNFFFDESDY--GSDES-----VKHNKPNKKDLTESLTEDDFIESEK----LFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEG-------KSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFYYLMMRMYGQRKQKIGPIVKKDWSNYNFLQYL 1209
            HP V WGQ++ ++ LS+++ +A++V V+I +E L+F+  G GA G + Y F   YYLP++   S + +    I ++L+KELKD WPRLT Q  KLPW   DF+ + FD SD     DE+     VK  +P K++      E   IE E+      K +  PL +YLL++NLFQ+AG+L VFG+ + +L K  +EG       +S I      +L  VQL++ LE LH  + WV+       +QV GR LVLF IVVPH  L TD  +FWL   WS +E+ RYP+Y+  LL      LT+LRY+ W+PLYPIGFM EGKLI++A+P L +S++FS  +PNA N+ FDF +FL  Y+   T GFY+LM  MYGQR++ +GP  +       F  Y+
Sbjct:    9 HPFVKWGQNETHVFLSVQLGDAEDVAVDITDEWLTFAAVGNGALGREQYRFRLDYYLPIVAKQSRYTVTGRAILIRLRKELKDAWPRLTIQSEKLPWAHLDFDLYQFDASDEEPSGDEAEGDVKVKVIRPTKEERELHNAEMRAIEMEEEWEAFLKVLKHPLTIYLLLFNLFQFAGFLSVFGSLVLVLLK--VEGYVPRDWFESSI-----SRLAVVQLLAFLEPLHVCLRWVRGGLLASLLQVSGRALVLFLIVVPHKELHTDSSVFWLFFVWSAIEVQRYPFYICSLLGYKNGLLTYLRYTSWIPLYPIGFMCEGKLIVRALPWLIKSRRFSYSMPNALNMAFDFPLFLHAYLVGMTAGFYFLMRYMYGQRRRVLGPRPRVGADQMGFFSYI 395          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Cavefish
Match: hacd3 (3-hydroxyacyl-CoA dehydratase 3 [Source:NCBI gene;Acc:103030450])

HSP 1 Score: 191.43 bits (485), Expect = 1.020e-55
Identity = 113/350 (32.29%), Postives = 182/350 (52.00%), Query Frame = 1
Query:   70 MTAFHPIVFWGQSKDYILLSIKIINAKNVVVNIAEENLSFSGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLTSQPMKLPWLKCDFNNFFFDESDYGSDESVKHNKPNKKDLTESLTEDDFIESEKLFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFYY 1119
            M    P VFW Q    I L ++I +AKN+ +++ E  L F G+G GA G   Y F  ++  PV P     K  +  + + ++K+    W RLT Q  K  +L  DF+ +  DESD   +   K  K NK  +   + +D F+  +K           YL MYNL Q+ G+ ++F      L+  G +     +  I D +   Q+++++E+++  +G VKS     F+QV GRN++LF I      +Q  P +F++   WS +EI RYP+Y+L  +      LTWLRY+IW+PLYP+G + E   +++++P+  E+K  SI LP A      F   L  Y+ +  +G ++
Sbjct:    1 MQTLTPHVFWAQRHGDIYLRVEISDAKNLDISVQENVLRFRGQGHGAKGENEYEFSLEFLKPVKPEVKH-KSTQRQVNIAVRKQGHCWWDRLTKQEKKPVFLAPDFDRWL-DESDAEMELKEKEEKINKVSVESRIRKDPFLGLKKG----------YLFMYNLVQFLGFSWIFVNMTVRLFILGQDSFYDTFHTIADVMYFCQMLAIIEVINPALGLVKSGVIPAFIQVMGRNVILFVIFGSLEEMQNKPVVFFVFYLWSAIEIFRYPFYMLACIDTEWKMLTWLRYTIWMPLYPLGVLAEAVSVIQSIPIFDETKFLSIPLPAALGSSISFSYILRFYLLIMFLGLFF 338          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Cavefish
Match: hacd2 (3-hydroxyacyl-CoA dehydratase 2 [Source:NCBI gene;Acc:103030449])

HSP 1 Score: 99.3673 bits (246), Expect = 3.351e-23
Identity = 68/212 (32.08%), Postives = 105/212 (49.53%), Query Frame = 1
Query:  541 YLLMYNLFQYAGYLYV-FGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLL----YIPLATIGFYYLMMRMYGQRKQKIG 1161
            YL++YN+   AG+L +  G     L +    G   +Y  I   L   Q  ++LEILH  +G V SS  +   QV  R  + + +      +Q++  +      W+  EI+RY +Y   LL      + W RY+ ++ LYP+G   E   I  A+P +Q++  +S+ LPN +N  FD+  FL+L    YIPL    F  L   M  QRK+ +G
Sbjct:   31 YLVIYNVVMTAGWLVIAVGLVRAYLTRGSYHG---LYYSIEKPLKFFQTGALLEILHCAVGIVPSSVVLTGFQVLSRVFLTWAVTHSVREVQSEDSVLLFVVAWTITEIIRYSFYTFSLLNHLPYLIKWARYTFFIVLYPMGVTGELLTIYAALPYVQKTGLYSVTLPNKYNFSFDYYTFLILTMVSYIPL----FPQLYFHMLRQRKKVLG 235          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Cavefish
Match: hacd1 (3-hydroxyacyl-CoA dehydratase 1 [Source:NCBI gene;Acc:103025300])

HSP 1 Score: 93.5893 bits (231), Expect = 2.932e-21
Identity = 65/219 (29.68%), Postives = 110/219 (50.23%), Query Frame = 1
Query:  541 YLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDF----VIFLLLYIPLATIGFYYLMMRMYGQRKQKIGP--IVKKD 1179
            +L +YN+   AG+L +  A +    + G      +Y  I   L   Q  ++LE+ H  +G V++S  +  +QV  R  +++ I      +Q    +      W+  EI RY +Y   LL     F+ W RY++++ +YP+G + E   I  A+P ++ S  +S+ LPN +N+ FD+    +I +L YIPL    F  L   M  QR++ +    IV+KD
Sbjct:   30 WLTVYNIAMTAGWLVLAVAMIRFYLQKGTH--RGLYRSIARTLKFFQTFALLEVGHCAIGIVRTSVIVTGVQVCSRIFMVWFIASSIRQVQNQESVILFLVVWTVTEITRYSFYTFNLLNHLPYFIKWARYNMFIVMYPLGVIGELMTIYAALPYVRRSGMYSLRLPNTYNVSFDYYYFLIIVMLSYIPL----FPQLYFHMLRQRRRVLHGEVIVEKD 242          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Cavefish
Match: ENSAMXT00000037901.1 (pep primary_assembly:Astyanax_mexicanus-2.0:5:1308226:1316371:-1 gene:ENSAMXG00000030657.1 transcript:ENSAMXT00000037901.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.6633 bits (226), Expect = 2.017e-20
Identity = 53/179 (29.61%), Postives = 96/179 (53.63%), Query Frame = 1
Query:  538 LYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNA--FNIQFDF 1068
            ++L +Y++ Q+ G+ + F      L   G +     +      L + Q+++VLE+++A +G V +      +Q+ GRN VLF ++     +Q     F +   WS +E+ R+P  +L ++      LTWL  + WV LYP+  + EG  +L+A+PL  E++ +S+ LP +  F+I F F
Sbjct:   54 VFLFLYHVIQFLGFTWTFSLLTANLILLGHDVLYSAFSSCAAVLYSCQVLAVLEVMNAALGLVNTPVLPALIQMSGRNTVLFVVLGSLPEMQERTVTFCVLYLWSSMEMFRHPVEMLAVVGAEWRVLTWLWNATWVLLYPLSTVAEGAAVLQALPLFDETRLYSVALPESVGFSISFSF 232          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Cavefish
Match: hacd1 (3-hydroxyacyl-CoA dehydratase 1 [Source:NCBI gene;Acc:103025300])

HSP 1 Score: 88.9669 bits (219), Expect = 1.540e-19
Identity = 55/189 (29.10%), Postives = 96/189 (50.79%), Query Frame = 1
Query:  541 YLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDF----VIFLLLYIP 1095
            +L +YN+   AG+L +  A +    + G      +Y  I   L   Q  ++LE+ H  +G V++S  +  +QV  R  +++ I      +Q    +      W+  EI RY +Y   LL     F+ W RY++++ +YP+G + E   I  A+P ++ S  +S+ LPN +N+ FD+    +I +L YIP
Sbjct:   30 WLTVYNIAMTAGWLVLAVAMIRFYLQKGTH--RGLYRSIARTLKFFQTFALLEVGHCAIGIVRTSVIVTGVQVCSRIFMVWFIASSIRQVQNQESVILFLVVWTVTEITRYSFYTFNLLNHLPYFIKWARYNMFIVMYPLGVIGELMTIYAALPYVRRSGMYSLRLPNTYNVSFDYYYFLIIVMLSYIP 216          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Sea Lamprey
Match: si:ch73-41h24.1 (3-hydroxyacyl-CoA dehydratase 4 [Source:HGNC Symbol;Acc:HGNC:20920])

HSP 1 Score: 96.6709 bits (239), Expect = 4.829e-23
Identity = 69/228 (30.26%), Postives = 115/228 (50.44%), Query Frame = 1
Query:  508 LFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQ--FDFVI--FLLLYIPLA-TIGFYYLMMRMYGQRKQKIGPIVKK 1176
            L  D       YL +Y+L Q+ G+ +VF      +   G +     +  I + +   Q +S+LE++++ +G  KS+     +QV  RNL+LF ++     LQ    +F +   WS +EI RYPYY+L  L      LTWLRYS W+PL P+    E   +L+++   + S +  +      NI   F +V+  +LLL +PL   +  +YL    Y QR++ +  + +K
Sbjct:    6 LVADFEPARKYYLFIYSLMQFLGHSWVFVNMTVRMLHFGEDSMIDTFYAIGEVMSYCQALSLLEVINSLLGLSKSALIPTILQVLSRNLLLFVVIWNQEELQNTVVVFAVFYLWSSIEIFRYPYYMLASLSMEWELLTWLRYSFWLPLCPLVLFAEVICVLQSLEHFEHSGEVFLNFQEPLNISALFPYVLYTYLLLILPLRFIVNSHYL----YKQRQKNLEMLKQK 229          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Sea Lamprey
Match: hacd1 (3-hydroxyacyl-CoA dehydratase 1 [Source:ZFIN;Acc:ZDB-GENE-170413-2])

HSP 1 Score: 94.3597 bits (233), Expect = 4.943e-22
Identity = 66/213 (30.99%), Postives = 108/213 (50.70%), Query Frame = 1
Query:  541 YLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSK--IYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLL----YIPLATIGFYYLMMRMYGQRKQKIG 1161
            +L++YN    AG+L +  +    + ++G+   S   +Y  I   L   Q  ++LE++H   G V SS  +   QV  R  +++ +      +Q +  +    + W+  EIVRY +Y   LLK     + W RY++++ LYP+G   E   I  A+P +  SK F+  LPNA NI FD+  FL++    Y+P+    F  L   M  QRK+ +G
Sbjct:   44 WLILYNTVMTAGWLVLAVS----MARYGLAKGSNRGLYRSIEKTLKIFQTGALLEVVHCATGIVPSSAVLTAFQVSSRVFLVWAVTDSVKPVQNEYSVLIYLSAWTLTEIVRYSFYTFSLLKYLPRAIKWARYTLFIVLYPLGVTGELLTIYHALPHVYRSKLFAYPLPNALNISFDYYYFLIIVMISYVPI----FPQLYFHMMSQRKKVLG 248          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Sea Lamprey
Match: ptges3b (prostaglandin E synthase 3b (cytosolic) [Source:ZFIN;Acc:ZDB-GENE-040625-144])

HSP 1 Score: 50.447 bits (119), Expect = 9.749e-8
Identity = 36/109 (33.03%), Postives = 52/109 (47.71%), Query Frame = 1
Query:   97 WGQSKDYILLSIKIINAKNVVVNIAEENLSFSGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKD-PWPRLTSQPMKLPWLKCDFNNF--FFDESD 414
            W   K+Y+ L   I ++K+V V      L FS  G   S  + Y  E + +  ++P     K  +  I   +KK      WPRLT +  KL WL  DF+N+  + DESD
Sbjct:   16 WYDRKEYVFLDFCIEDSKDVAVKFESGKLLFSCVG--GSDKEKYHNEAELFEQIIPEDCKHKRTDRTIHCLMKKSKSGVAWPRLTKEKSKLKWLSVDFDNWKDWEDESD 122          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Yeast
Match: PHS1 (Essential 3-hydroxyacyl-CoA dehydratase of the ER membrane; involved in elongation of very long-chain fatty acids; evolutionarily conserved, similar to mammalian PTPLA and PTPLB; involved in sphingolipid biosynthesis and protein trafficking [Source:SGD;Acc:S000003633])

HSP 1 Score: 62.3882 bits (150), Expect = 1.183e-11
Identity = 65/218 (29.82%), Postives = 109/218 (50.00%), Query Frame = 1
Query:  514 KDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCI--VVPH-SNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIA--FLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFYYLMMRMYGQRKQ 1152
            K +  PL+ +L +YNL    G+ Y+      ++  +   G+   +   ++    VQ  +++EI+++++G V+S       QV  R LV+  I  ++P+ S +Q+   I  L A WS  EIVRY YY  +L+ +N A   L  LRY+++  LYP G  +E ++I  A+       Q+S+            +  +L YIP    GF  L + M  QRK+
Sbjct:    3 KKLASPLS-FLPLYNLLSAVGWSYLL---YLVISLYPKVGQPAFFYQTKNVATLVQCGAIIEIINSFLGVVRSPLLTTVAQVSSRLLVVLGIFQLLPNTSGVQSVVYISLLLA-WSITEIVRYLYYFFMLVFKNGAPKILILLRYNLFWILYPTGVASELRIIYCALN--AAESQYSLLYKRI------LIAAMLAYIP----GFPMLFLHMVAQRKK 203          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Nematostella
Match: EDO32410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV55])

HSP 1 Score: 216.853 bits (551), Expect = 7.791e-66
Identity = 124/346 (35.84%), Postives = 196/346 (56.65%), Query Frame = 1
Query:   85 PIVFWGQSKDYILLSIKIINAKNVVVNIAEENLSFSGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDP--WPRLTSQPMKLPWLKCDFNNFFFDESDYGSDESVKHNKPNKKD----LTESLTEDDFIESEKLFKDVTKPLN-LYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKI---YPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYI 1092
            PIV W Q+K+ + L++++ + +   +++ E  L F G G GA G  NY  E  +  P+ P  SS K+ E ++E  + K+      W RL     +  WLK +F+ +  +E D   ++     +  ++     + + L  D  +  +++ +DV + L   YL+ YN  Q+  +LY+      I+ +  MEGK  +   Y  + D + + QL + LE+L+  +G VK+     F QVFGRNLVLF +VVPH  L  DP +  L  TWS +EI+RYP+Y++ ++      L WLRY+ W+PLYP+G +TE  LI KA+PLL ++++FSI LPNAFN  F F +FL  Y+
Sbjct:    7 PIVRWAQTKERLYLTLELSDVQYPSIDLTESRLLFKGYGHGAKGEDNYELEVNFLEPINPGESSHKVMERYVEFSIAKQKGREFFWQRLVDSEKRPNWLKINFDRWK-NEDDTEDEKQEAEEEQKRQISNIIVEQRLKRDYDMHGDRVKQDVVRFLKKFYLVTYNGIQFILFLYIVAK---IISRFIMEGKDSLAGNYDAVSDIIASCQLAAFLEVLNPAIGIVKTGVFAPFAQVFGRNLVLFMVVVPHPTLHADPVVSALFFTWSVIEIIRYPFYIVQIIGIPFEPLIWLRYTAWIPLYPVGMITEVILIWKALPLLDQTQRFSIILPNAFNFSFSFAMFLRFYL 348          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Nematostella
Match: EDO30588 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0D0])

HSP 1 Score: 87.8113 bits (216), Expect = 6.365e-20
Identity = 69/222 (31.08%), Postives = 111/222 (50.00%), Query Frame = 1
Query:  538 LYLLMYNLFQYAGY--LYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFL----LLYIPLATIGFYYLMMRMYGQRKQKIG--PIVKKD 1179
            LYL++YN     G+  + V G+  W+  +HG      ++  I   L   Q  +++E+ H  +G+V+SS  +   QV  R  +++ I+     +Q    +    A WS  E++RY +Y+  L+      L W RY+ +  LYPIG   E   I  ++P +Q+S  +S+ LPN  N+ F +  FL    L YIP+    F  L   M GQR++ +   P  KKD
Sbjct:    2 LYLVLYNAVLCLGWSIVLVLGSLHWL--RHGTH--VGLFSAISIPLYIFQTAAIMEVFHCAVGFVRSSVFLTGFQVASRLFLVWAILYSVPEVQDSIGVAAAVAAWSVTEVIRYLFYVCSLVSVLPYALQWCRYTFFFFLYPIGVTGELVAIYASLPFVQKSGIYSVALPNPLNVGFSYYFFLIAVMLSYIPI----FPQLYFHMIGQRRKVLSSEPRGKKD 215          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Medaka
Match: hacd3 (3-hydroxyacyl-CoA dehydratase 3 [Source:NCBI gene;Acc:101163569])

HSP 1 Score: 169.088 bits (427), Expect = 2.682e-47
Identity = 107/352 (30.40%), Postives = 174/352 (49.43%), Query Frame = 1
Query:   85 PIVFWGQSKDYILLSIKIINAKNVVVNIAEENLSF--------SGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLTSQPMKLPWLKCDFNNFFFDESDYGSDESVKHNKPNKKDLTESLTEDDFIESEKLFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFY 1116
            P+V+W Q  + I L +++ +A+     +  ++L+F        S  G GA G   Y F  ++  PV P  S +K  +  + V + KE +  W RL +Q  K  +L  DF+ +  +ESD   +   K  + N+   +  L E  FI  +  F          L  YNL Q+ G+ ++F      L+  G +     +  I D +   Q ++ +E+L+A  G V++     F+QV GRN +LF I      +   P +F++   WS +EI RYP+Y+L         LTWLRY++W+PLYP+G + E   +L+A+P+  ++K FSI LP A      F   L  Y+ L  +G +
Sbjct:    5 PLVYWAQRHEEIYLRVELTDAQ-----VKTQSLTFFFLCVINCSARGHGAKGQNEYEFSLEFLFPVKPEVS-YKSTQRQVNVVVGKEKRGWWERLVTQERKPVFLAPDFDRWL-EESDAEMEIREKEERRNRLR-SARLKEPGFISLKTGF----------LFAYNLVQFLGFSWIFVNMTVRLFIFGKDSLYDTFHTISDVMFFCQTLAAVEVLNAAFGVVRTGVVPTFIQVIGRNFILFIIFGSLDEMHNRPVVFFVFYLWSAIEIFRYPFYMLGCFNTEWKTLTWLRYTVWIPLYPLGVLAEAVAVLQAIPIFDKNKLFSIPLPKAIGGSLSFSYVLQGYLILMFLGLF 338          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Medaka
Match: ENSORLT00000000008.2 (very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase [Source:NCBI gene;Acc:101155409])

HSP 1 Score: 167.162 bits (422), Expect = 1.164e-46
Identity = 107/360 (29.72%), Postives = 187/360 (51.94%), Query Frame = 1
Query:   70 MTAFHPIVFWGQSKDYILLSIKIINAKNVVVNIAEEN-LSFSGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLTSQPMKLPWLKCDFNNFFFDESDYGSD-ESVKHNKPNKKDLTESLTEDDFIESEKLFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSS--PAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFYYLMMRMY 1137
            M    P V+W Q    I L +++ +AKN+ +++ + N L F   G GA G   Y F  ++  PV P     K  +  +++K++K+    W RLT Q  K  +L  DF+ +  DESD  ++ ++ +  K +K +          +ES   +  + K    YL MYNL Q+ G+ ++F      L+  G +     +    D +   Q+++V E+++  +G VK+   PAM+  QV GRN+VLF I      +Q+   +F++   WS +EI RYP+Y+L  +      LTWLRY++W+PLYP+  + E   +++++P+  +++ FS+ LP        F   L +Y+ L  +G +  +  +Y
Sbjct:    1 MQILTPHVYWAQRHGEIFLRVELSDAKNLDISLNQNNTLHFRALGHGAKGDNEYKFSLEFLEPVRPEIDH-KSTQRQVDIKIRKQRVRWWDRLTLQEKKPLFLAPDFDRWL-DESDAETELQAQEEQKISKIN----------VESRVPYLGLKKG---YLFMYNLVQFLGFSWIFVNMTVRLFILGQDSFYDTFHTTADMMYFCQILAVFEVVNPLLGLVKTGLYPAMI--QVAGRNVVLFVIFGCLEEMQSRSIVFFVFYAWSSIEIFRYPFYMLAYIDTEWQLLTWLRYNLWIPLYPLAVLAEAVAVIQSLPIFDDTRLFSLPLPGFRGRSLSFSYTLQIYLVLMFLGLFINLRHLY 343          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Medaka
Match: hacd3 (3-hydroxyacyl-CoA dehydratase 3 [Source:NCBI gene;Acc:101163569])

HSP 1 Score: 147.517 bits (371), Expect = 2.613e-39
Identity = 100/337 (29.67%), Postives = 155/337 (45.99%), Query Frame = 1
Query:  190 SGEGEGASGLKNYGFEFKYYLPVLP-----------NSS-----------------SWKIKENFIEVKLKKELKDPWPRLTSQPMKLPWLKCDFNNFFFDESDYGSDESVKHNKPNKKDLTESLTEDDFIESEKLFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFY 1116
            S  G GA G   Y F  ++  PV P           N S                 S+K  +  + V + KE +  W RL +Q  K  +L  DF+ +  +ESD   +   K  + N+   +  L E  FI  +  F          L  YNL Q+ G+ ++F      L+  G +     +  I D +   Q ++ +E+L+A  G V++     F+QV GRN +LF I      +   P +F++   WS +EI RYP+Y+L         LTWLRY++W+PLYP+G + E   +L+A+P+  ++K FSI LP A      F   L  Y+ L  +G +
Sbjct:   23 SARGHGAKGQNEYEFSLEFLFPVKPEVCVLLKCLNFNDSFPLSLFCIFIACIYTQVSYKSTQRQVNVVVGKEKRGWWERLVTQERKPVFLAPDFDRWL-EESDAEMEIREKEERRNRLR-SARLKEPGFISLKTGF----------LFAYNLVQFLGFSWIFVNMTVRLFIFGKDSLYDTFHTISDVMFFCQTLAAVEVLNAAFGVVRTGVVPTFIQVIGRNFILFIIFGSLDEMHNRPVVFFVFYLWSAIEIFRYPFYMLGCFNTEWKTLTWLRYTVWIPLYPLGVLAEAVAVLQAIPIFDKNKLFSIPLPKAIGGSLSFSYVLQGYLILMFLGLF 347          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Medaka
Match: hacd2 (3-hydroxyacyl-CoA dehydratase 2 [Source:NCBI gene;Acc:101174470])

HSP 1 Score: 98.5969 bits (244), Expect = 6.253e-23
Identity = 66/211 (31.28%), Postives = 103/211 (48.82%), Query Frame = 1
Query:  541 YLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLL----YIPLATIGFYYLMMRMYGQRKQKIG 1161
            YL++YN+   AG+L +    +      G      +Y  I   L   Q  ++LEILH  +G V SS  +   QV  R  + + +      +Q++  +      W+  EI+RY +Y   LL      + W RY+ ++ LYP+G   E   I  A+P +Q++  +S+ LPN +N  FD+  FL+L    YIPL    F  L   M  QRK+ +G
Sbjct:   31 YLVIYNVVMTAGWLVIAVGLVRAYVARG--SYHGLYYSIEKPLKFFQTGALLEILHCAVGIVPSSVVLTGFQVLSRVFLTWAVTHSVREVQSEDSVLLFVTAWTVTEIIRYSFYTFSLLNHLPYLIKWARYTFFILLYPMGVTGELLTIYAALPYVQKTGLYSVTLPNKYNFSFDYYTFLILIMISYIPL----FPQLYFHMLRQRKKVLG 235          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Medaka
Match: hacd1 (3-hydroxyacyl-CoA dehydratase 1 [Source:NCBI gene;Acc:101162008])

HSP 1 Score: 92.4337 bits (228), Expect = 1.664e-20
Identity = 64/212 (30.19%), Postives = 103/212 (48.58%), Query Frame = 1
Query:  481 EDDFIES-EKLFKDVTKP--LNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDF----VIFLLLYIP 1095
            ED  +E  E   K  TK      +L  YN+   AG+L +  A L    K G      +Y  I   L   Q  +++E+ H  +G V++S  +  +QV  R  +++ +      +Q +  +      W+  EI RY YY   LL     F+ W RY+ ++ LYP+G + E   I  A+P ++ S  +S+ LPN +N+ FD+    +I +L YIP
Sbjct:    6 EDGTVEEKENNNKKRTKSALTTAWLTFYNIAMTAGWLVLAMAMLRFYIKKGTH--KGLYRSIARTLKFFQTFALVEVGHCAIGIVRTSVIVTGVQVCSRIFMVWLVASSIRQIQNEESVILFLVVWTVTEITRYSYYTFKLLNHLPYFVKWARYNFFIVLYPLGVIGELLSIYAALPFVRRSGMYSMRLPNKYNVSFDYYYCLIIVMLSYIP 215          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Planmine SMEST
Match: SMESG000034959.1 (SMESG000034959.1)

HSP 1 Score: 798.89 bits (2062), Expect = 0.000e+0
Identity = 407/408 (99.75%), Postives = 407/408 (99.75%), Query Frame = 1
Query:   70 MTAFHPIVFWGQSKDYILLSIKIINAKNVVVNIAEENLSFSGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLTSQPMKLPWLKCDFNNFFFDESDYGSDESVKHNKPNKKDLTESLTEDDFIESEKLFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFYYLMMRMYGQRKQKIGPIVKKDWSNYNFLQYLVDTLGXXXXXXXXXXXXXXIQNNSKYSK 1293
            MT FHPIVFWGQSKDYILLSIKIINAKNVVVNIAEENLSFSGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLTSQPMKLPWLKCDFNNFFFDESDYGSDESVKHNKPNKKDLTESLTEDDFIESEKLFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFYYLMMRMYGQRKQKIGPIVKKDWSNYNFLQYLVDTLGKKKPTKSATKPAKSIQNNSKYSK
Sbjct:    1 MTGFHPIVFWGQSKDYILLSIKIINAKNVVVNIAEENLSFSGEGEGASGLKNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLTSQPMKLPWLKCDFNNFFFDESDYGSDESVKHNKPNKKDLTESLTEDDFIESEKLFKDVTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFYYLMMRMYGQRKQKIGPIVKKDWSNYNFLQYLVDTLGKKKPTKSATKPAKSIQNNSKYSK 408          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Planmine SMEST
Match: SMESG000023255.1 (SMESG000023255.1)

HSP 1 Score: 77.0258 bits (188), Expect = 8.223e-16
Identity = 73/213 (34.27%), Postives = 108/213 (50.70%), Query Frame = 1
Query:  541 YLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQLITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLF--CIVVPHSNLQTDPEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFMTEGKLILKAMPLLQESKQFSIFLPNAFNIQ--FDFVIFLLL--YIPLATIGFYYLMMRMYGQRKQKIG 1161
            YL +YNL    G+ YV    ++ L+        + Y  I   L  VQ  +VLEILH+  G+VKS   +  +QV  R  +++  C + P    +T     ++ A WS  EI+RY YY   L+      L WLRY+++  LYP+G   E   IL++      +  F I LPN+ NIQ  +DF++ L+L  Y P+    F  L   M  QRK+ +G
Sbjct:    7 YLFIYNLTLTCGWAYVLYKEIYALWSTKFN-LVETYSIIEKPLKLVQTAAVLEILHSAFGFVKSRVDITTIQVSSRLFLVWGICNIFPKIISETYGIPMFIIA-WSIAEIIRYGYYANHLINCVPYPLVWLRYTLFYVLYPMGVTGEVLAILESFRNAYGTTSF-IDLPNSLNIQMRYDFILVLVLVSYFPI----FPQLFGHMIVQRKKILG 212          
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Planmine SMEST
Match: SMESG000068003.1 (SMESG000068003.1)

HSP 1 Score: 60.077 bits (144), Expect = 1.952e-10
Identity = 39/107 (36.45%), Postives = 55/107 (51.40%), Query Frame = 1
Query:   79 FHPIVFWGQSKDYILLSIKIINAKNVVVNIAEENLSFSGEGEGASGL--KNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLTSQPMKLP-WLKCDFN 390
             HP V W Q KDY+ ++I I + K+ V+N+ EE+ SFS    G SG+  K+Y   F ++  V    S     +  I + +KK     WP L  +    P WLK DFN
Sbjct:    9 MHPTVLWAQRKDYLYITICIGDIKDKVMNLKEESFSFS----GISGIPPKHYEVNFDFHSKVHTEDSKQISTDREIVLLIKKSTSGYWPSLIKKSGPKPHWLKTDFN 111          
The following BLAST results are available for this feature:
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HACD35.073e-5029.513-hydroxyacyl-CoA dehydratase 3 [Source:HGNC Symbo... [more]
HACD38.712e-4629.863-hydroxyacyl-CoA dehydratase 3 [Source:HGNC Symbo... [more]
HACD33.555e-4529.603-hydroxyacyl-CoA dehydratase 3 [Source:HGNC Symbo... [more]
HACD33.837e-3431.883-hydroxyacyl-CoA dehydratase 3 [Source:HGNC Symbo... [more]
HACD33.837e-3431.883-hydroxyacyl-CoA dehydratase 3 [Source:HGNC Symbo... [more]
back to top
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hpo-83.396e-1830.73Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase... [more]
hpo-83.396e-1830.73Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase... [more]
R10E4.92.368e-834.21Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase... [more]
back to top
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Hacd24.104e-7534.25gene:FBgn0032524 transcript:FBtr0080519[more]
Hacd17.232e-2131.08gene:FBgn0032394 transcript:FBtr0080313[more]
back to top
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hacd33.657e-5831.563-hydroxyacyl-CoA dehydratase 3 [Source:NCBI gene;... [more]
hacd33.657e-5831.563-hydroxyacyl-CoA dehydratase 3 [Source:NCBI gene;... [more]
hacd31.753e-5330.773-hydroxyacyl-CoA dehydratase 3 [Source:NCBI gene;... [more]
hacd25.951e-2432.333-hydroxyacyl-CoA dehydratase 2 [Source:ZFIN;Acc:Z... [more]
hacd21.719e-2131.733-hydroxyacyl-CoA dehydratase 2 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrp122.916e-4631.50LDL receptor related protein 12 [Source:Xenbase;Ac... [more]
lrp123.440e-4630.31LDL receptor related protein 12 [Source:Xenbase;Ac... [more]
lrp127.773e-4332.12LDL receptor related protein 12 [Source:Xenbase;Ac... [more]
HACD19.721e-2329.393-hydroxyacyl-CoA dehydratase 1 [Source:NCBI gene;... [more]
kif2a2.647e-2129.95kinesin heavy chain member 2A [Source:Xenbase;Acc:... [more]
back to top
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hacd31.684e-4928.693-hydroxyacyl-CoA dehydratase 3 [Source:MGI Symbol... [more]
Hacd14.591e-2230.593-hydroxyacyl-CoA dehydratase 1 [Source:MGI Symbol... [more]
Hacd14.591e-2230.593-hydroxyacyl-CoA dehydratase 1 [Source:MGI Symbol... [more]
Hacd29.690e-2230.773-hydroxyacyl-CoA dehydratase 2 [Source:MGI Symbol... [more]
Hacd42.926e-2027.323-hydroxyacyl-CoA dehydratase 4 [Source:MGI Symbol... [more]
back to top
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7SY06|HACD3_DANRE2.761e-5731.56Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase... [more]
sp|Q5ZM57|HACD3_CHICK2.458e-5331.25Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase... [more]
sp|A7YY55|HACD3_BOVIN2.724e-5029.40Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase... [more]
sp|Q9P035|HACD3_HUMAN2.436e-4929.51Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase... [more]
sp|Q8K2C9|HACD3_MOUSE1.178e-4828.69Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase... [more]
back to top
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4VGD44.495e-10040.57Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase... [more]
A0A183R4F51.760e-9841.13Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase... [more]
A0A4S2MFA32.028e-9742.13Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase... [more]
A0A4S2MAZ72.364e-9742.13Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase... [more]
A0A419Q3981.590e-9642.89Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase... [more]
back to top
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hacd31.020e-5532.293-hydroxyacyl-CoA dehydratase 3 [Source:NCBI gene;... [more]
hacd23.351e-2332.083-hydroxyacyl-CoA dehydratase 2 [Source:NCBI gene;... [more]
hacd12.932e-2129.683-hydroxyacyl-CoA dehydratase 1 [Source:NCBI gene;... [more]
ENSAMXT00000037901.12.017e-2029.61pep primary_assembly:Astyanax_mexicanus-2.0:5:1308... [more]
hacd11.540e-1929.103-hydroxyacyl-CoA dehydratase 1 [Source:NCBI gene;... [more]
back to top
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:ch73-41h24.14.829e-2330.263-hydroxyacyl-CoA dehydratase 4 [Source:HGNC Symbo... [more]
hacd14.943e-2230.993-hydroxyacyl-CoA dehydratase 1 [Source:ZFIN;Acc:Z... [more]
ptges3b9.749e-833.03prostaglandin E synthase 3b (cytosolic) [Source:ZF... [more]
back to top
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PHS11.183e-1129.82Essential 3-hydroxyacyl-CoA dehydratase of the ER ... [more]
back to top
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO324107.791e-6635.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO305886.365e-2031.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hacd32.682e-4730.403-hydroxyacyl-CoA dehydratase 3 [Source:NCBI gene;... [more]
ENSORLT00000000008.21.164e-4629.72very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase... [more]
hacd32.613e-3929.673-hydroxyacyl-CoA dehydratase 3 [Source:NCBI gene;... [more]
hacd26.253e-2331.283-hydroxyacyl-CoA dehydratase 2 [Source:NCBI gene;... [more]
hacd11.664e-2030.193-hydroxyacyl-CoA dehydratase 1 [Source:NCBI gene;... [more]
back to top
BLAST of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000034959.10.000e+099.75SMESG000034959.1[more]
SMESG000023255.18.223e-1634.27SMESG000023255.1[more]
SMESG000068003.11.952e-1036.45SMESG000068003.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020430 ID=SMED30020430|Name=Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase|organism=Schmidtea mediterranea sexual|type=transcript|length=1560bp
TTCAATTGTTAATTTGATTTGAAATTCTATTTTAACGTAAAATTTTGGTG
TGATATATAAGAATTATTTATGACAGCATTTCACCCTATTGTATTTTGGG
GACAATCAAAGGACTATATTTTATTGAGTATTAAAATTATCAATGCAAAA
AATGTAGTCGTAAATATTGCTGAGGAAAATCTCAGTTTTAGTGGTGAAGG
TGAAGGAGCAAGTGGTCTAAAAAATTATGGATTTGAATTTAAATATTATC
TACCAGTTCTTCCTAATTCAAGTAGTTGGAAAATTAAAGAAAACTTCATC
GAAGTTAAATTAAAAAAAGAACTTAAAGATCCATGGCCTAGATTAACATC
TCAGCCGATGAAATTACCTTGGCTAAAATGTGATTTTAATAATTTCTTTT
TCGATGAAAGTGATTACGGTTCTGATGAGTCTGTAAAGCATAATAAGCCT
AATAAAAAAGATTTAACCGAATCGTTAACTGAAGATGATTTTATAGAATC
CGAAAAATTATTTAAAGATGTTACGAAACCGTTAAATCTCTATCTTTTAA
TGTATAACTTATTCCAATATGCCGGATACCTTTATGTATTTGGTGCTTGC
CTATGGATATTATACAAGCACGGAATGGAAGGTAAATCCAAAATATATCC
CTACATTCGTGATCAGCTTATAACTGTACAATTGGTTTCCGTTCTTGAGA
TATTGCATGCTTACATGGGCTGGGTTAAATCGTCACCAGCTATGGTGTTC
ATGCAGGTTTTTGGCAGAAATCTGGTGTTGTTTTGTATTGTTGTTCCACA
TTCTAATTTACAAACCGACCCAGAGATTTTCTGGCTTGCAGCAACTTGGA
GCTGTGTTGAAATAGTTAGATATCCTTATTATTTGCTTATTCTTCTTAAA
GAAAACATCGCTTTTTTAACTTGGTTGCGCTACTCAATTTGGGTTCCTCT
CTATCCGATTGGATTTATGACCGAAGGAAAATTGATTTTAAAAGCAATGC
CATTGTTACAAGAGTCGAAACAGTTTTCAATATTTTTACCCAATGCTTTT
AATATTCAATTTGACTTTGTCATATTCTTGCTTCTTTACATTCCTCTGGC
TACCATAGGTTTTTATTATTTAATGATGCGCATGTATGGGCAAAGAAAAC
AGAAAATAGGACCCATTGTGAAGAAGGATTGGAGTAATTACAATTTTCTC
CAGTATCTTGTCGATACTCTAGGTAAAAAGAAACCGACTAAGTCAGCGAC
GAAACCAGCAAAATCCATACAAAATAACAGCAAATACAGTAAGAAGGAAA
TTATTGAAAATAAATTAGAATAAAATGAGCTTTAAATGTTCATTATTAGC
ATGTTTGTGTGTATGTGTGTGTAATTGTTTGTTTTAATGATGGATTTCAC
ATATTATATTGTCATTAGTATTTTTTCGCTGTTCTTACATTTGATTGGAT
TTGCTTAAATATTGATTTATATTTTAAATGGTTTAATCAATTTAGATTTT
TAAATACATCAATATTTATTTTAAAATTGTTTTTATTGAATAAAAATCTT
TAATCTTGAA
back to top

protein sequence of SMED30020430-orf-1

>SMED30020430-orf-1 ID=SMED30020430-orf-1|Name=SMED30020430-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=418bp
MTAFHPIVFWGQSKDYILLSIKIINAKNVVVNIAEENLSFSGEGEGASGL
KNYGFEFKYYLPVLPNSSSWKIKENFIEVKLKKELKDPWPRLTSQPMKLP
WLKCDFNNFFFDESDYGSDESVKHNKPNKKDLTESLTEDDFIESEKLFKD
VTKPLNLYLLMYNLFQYAGYLYVFGACLWILYKHGMEGKSKIYPYIRDQL
ITVQLVSVLEILHAYMGWVKSSPAMVFMQVFGRNLVLFCIVVPHSNLQTD
PEIFWLAATWSCVEIVRYPYYLLILLKENIAFLTWLRYSIWVPLYPIGFM
TEGKLILKAMPLLQESKQFSIFLPNAFNIQFDFVIFLLLYIPLATIGFYY
LMMRMYGQRKQKIGPIVKKDWSNYNFLQYLVDTLGKKKPTKSATKPAKSI
QNNSKYSKKEIIENKLE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR007052CS_dom
IPR008978HSP20-like_chaperone
IPR007482Tyr_Pase-like_PTPLA
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006629lipid metabolic process
GO:0006631fatty acid metabolic process
GO:0006633fatty acid biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0016829lyase activity
GO:01023443-hydroxy-behenoyl-CoA dehydratase activity
GO:01023453-hydroxy-lignoceroyl-CoA dehydratase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007482Protein-tyrosine phosphatase-like, PTPLAPFAMPF04387PTPLAcoord: 204..364
e-value: 1.8E-47
score: 161.1
IPR007482Protein-tyrosine phosphatase-like, PTPLAPANTHERPTHR11035PTPLA DOMAIN PROTEINcoord: 127..366
IPR007052CS domainPFAMPF04969CScoord: 10..83
e-value: 4.0E-5
score: 24.6
IPR007052CS domainPROSITEPS51203CScoord: 3..93
score: 15.574
IPR008978HSP20-like chaperoneGENE3DG3DSA:2.60.40.790coord: 4..126
e-value: 3.6E-24
score: 87.6
IPR008978HSP20-like chaperoneSUPERFAMILYSSF49764HSP20-like chaperonescoord: 4..110
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 388..417
NoneNo IPR availablePANTHERPTHR11035:SF35VERY-LONG-CHAIN (3R)-3-HYDROXYACYL-COA DEHYDRATASEcoord: 127..366
NoneNo IPR availableCDDcd06465p23_hB-ind1_likecoord: 6..115
e-value: 1.37055E-29
score: 108.836
NoneNo IPR availableTMHMMTMhelixcoord: 158..180
NoneNo IPR availableTMHMMTMhelixcoord: 282..301
NoneNo IPR availableTMHMMTMhelixcoord: 329..351
NoneNo IPR availableTMHMMTMhelixcoord: 253..275
NoneNo IPR availableTMHMMTMhelixcoord: 200..219