SMED30020424

Overview
NameSMED30020424
Smed IDSMED30020424
Length (bp)1516
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30020424 (SMED30020424) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30020424 (SMED30020424) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30020424 (SMED30020424) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30020424 (SMED30020424) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020424

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30020424h1SMcG0001762 SmedASXL_004803SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30020424 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.021370:293..1858 +7531
Homology
BLAST of SMED30020424 vs. Ensembl Mouse
Match: Utp15 (UTP15 small subunit processome component [Source:MGI Symbol;Acc:MGI:2145443])

HSP 1 Score: 50.0618 bits (118), Expect = 5.874e-6
Identity = 38/128 (29.69%), Postives = 64/128 (50.00%), Query Frame = 1
Query:  493 RMFSWIDEYITCCTINPWENGHLLM-GSVDGIIGLYDTEIEKIINKSHCHSKRVNTVSYSYYNESLMLSGSDNNQVVLWNC-NEKSIRVHKTNSPITSCSMSDGV---LYGFGEANGNVSIFDIRNSR 861
            + FS   +   C T    ++G LL+ GS DG++ L+D      + +   H+K V+TV ++  N   ++SG+D+  V LW+  N K I   K +S    C  +  +   L+  G  +  V IFD R ++
Sbjct:   74 KTFSRFKDTAYCATFR--QDGQLLVAGSEDGVVQLFDINGRAPLRQFEGHTKAVHTVDFTADNYH-VVSGADDYTVKLWDIPNSKEILTFKEHSDYVRCGCASKLNPDLFVTGSYDHTVKIFDARTNK 198          
BLAST of SMED30020424 vs. UniProt/SwissProt
Match: sp|Q94BM7|SPA4_ARATH (Protein SPA1-RELATED 4 OS=Arabidopsis thaliana OX=3702 GN=SPA4 PE=1 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 4.950e-8
Identity = 35/116 (30.17%), Postives = 63/116 (54.31%), Query Frame = 1
Query:  577 DGIIGLYDTEIEKIINKSHCHSKRVNTVSYSYYNESLMLSGSDNNQVVLWNCNEK-SIRVHKTNSPITSCSMSD--GVLYGFGEANGNVSIFDIRNSREPVYTQ-KNYNSIDYVQF 912
            +G++ ++D    +++ +   H KRV ++ YS  + +L+ SGSD+  V LW+ N+  SI   KT + I         G    FG A+  V  +D+RN + P+ T   ++ ++ YV+F
Sbjct:  555 EGVVQVWDVARNQLVTEMKEHEKRVWSIDYSSADPTLLASGSDDGSVKLWSINQGVSIGTIKTKANICCVQFPSETGRSLAFGSADHKVYYYDLRNPKLPLCTMIGHHKTVSYVRF 670          
BLAST of SMED30020424 vs. UniProt/SwissProt
Match: sp|Q9LJR3|SPA3_ARATH (Protein SPA1-RELATED 3 OS=Arabidopsis thaliana OX=3702 GN=SPA3 PE=1 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 4.287e-7
Identity = 34/116 (29.31%), Postives = 62/116 (53.45%), Query Frame = 1
Query:  577 DGIIGLYDTEIEKIINKSHCHSKRVNTVSYSYYNESLMLSGSDNNQVVLWNCNEK-SIRVHKTNSPITSCSMS--DGVLYGFGEANGNVSIFDIRNSREPVYTQKNYN-SIDYVQF 912
            DG++ ++D    +++ +   H KRV ++  S  + +L+ SGSD+  V LW+ N+  SI   KT + +         G    FG A+  V  +D+RN + P+ T   ++ ++ YV+F
Sbjct:  605 DGVVQIWDVARSQLVTEMKEHKKRVWSIDISSADPTLLASGSDDGTVKLWSINQGVSIGTIKTKANVCCVQFPSDSGRSLAFGSADHKVYYYDLRNPKIPLCTMIGHSKTVSYVKF 720          
BLAST of SMED30020424 vs. TrEMBL
Match: A0A059BVP7 (Uncharacterized protein OS=Eucalyptus grandis OX=71139 GN=EUGRSUZ_F03314 PE=4 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 2.367e-7
Identity = 36/116 (31.03%), Postives = 65/116 (56.03%), Query Frame = 1
Query:  577 DGIIGLYDTEIEKIINKSHCHSKRVNTVSYSYYNESLMLSGSDNNQVVLWNCNEK-SIRVHKTNSPITSCSMS--DGVLYGFGEANGNVSIFDIRNSREPVYTQKNYN-SIDYVQF 912
            +G++ ++D    +++ +   H KRV ++ +S  + +L+ SGSD+  V LW+ N+  SI   KT + + S       G    FG A+  +  +D+RNSR P+ T   +N ++ YV+F
Sbjct:  476 EGVVQVWDVTRSQVLREMREHEKRVWSIDFSSADPTLLASGSDDGSVKLWSINQGVSIGTIKTKANVCSVQFPSDSGHSLAFGSADHKIYYYDLRNSRAPLCTLAGHNKTVSYVKF 591          
BLAST of SMED30020424 vs. TrEMBL
Match: A0A059BVK7 (Uncharacterized protein OS=Eucalyptus grandis OX=71139 GN=EUGRSUZ_F03314 PE=4 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 2.502e-7
Identity = 36/116 (31.03%), Postives = 65/116 (56.03%), Query Frame = 1
Query:  577 DGIIGLYDTEIEKIINKSHCHSKRVNTVSYSYYNESLMLSGSDNNQVVLWNCNEK-SIRVHKTNSPITSCSMS--DGVLYGFGEANGNVSIFDIRNSREPVYTQKNYN-SIDYVQF 912
            +G++ ++D    +++ +   H KRV ++ +S  + +L+ SGSD+  V LW+ N+  SI   KT + + S       G    FG A+  +  +D+RNSR P+ T   +N ++ YV+F
Sbjct:  672 EGVVQVWDVTRSQVLREMREHEKRVWSIDFSSADPTLLASGSDDGSVKLWSINQGVSIGTIKTKANVCSVQFPSDSGHSLAFGSADHKIYYYDLRNSRAPLCTLAGHNKTVSYVKF 787          
BLAST of SMED30020424 vs. TrEMBL
Match: A0A444SC69 (Protein NEDD1 OS=Armadillidium vulgare OX=13347 GN=Avbf_14587 PE=4 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 2.701e-7
Identity = 63/264 (23.86%), Postives = 114/264 (43.18%), Query Frame = 1
Query:  145 VEIITAVDYQ--GDTIAIYEMKNRQFKLYTID---LTFKSSFDGKFDLNCLKLYQ--DRWICAGDSWGKLHLFDIHKNSYVKSFSTYXXXXXXXXXXXXDQNHIFACYENGQISVVNLKLDKSRMFSWIDEYITCCTINPWENGHLLMG--SVDGIIGLYDTEIEKIINKSHCHSKRVNTVSYSYYNESLMLSGSDNNQVVLWNCNEKSIRVH-KTNSPITSCS-MSDGVLYGFGEANGNVSIFDIRNSREPVYTQKNYNSIDY 903
            + II AV +   G  ++ +     +  LYT+D         F    ++ CL+  +   R++  GDS  ++ ++D+  N   KS++   +        SSD +           ++ N     S       E      I        ++G    +G + LYD    K+  + + HS  V+ V++S  NE LM+S   + +++ ++ N KSI +  +T +P+T  S M++G     G   G V ++D+R    P+Y  K Y    Y
Sbjct:    2 IGIIPAVSWNKDGQILSAFNQNTSEVSLYTVDSRSAICSGIFKIPGNVTCLEFCKTNSRYLAIGDSKDQILIWDVKGNYKKKSYTVPKSCITNLSFSSSDSHLAVGTVHGDAFTISNTNNLVSSPIKVFLEKTEVKDIRYSMLNRSIVGVCGGNGYVALYDAITSKVFARHNSHSAPVSNVAFSPINELLMISVGYDKKLISYDVNTKSIVMKCETENPLTCISFMTNGQSVAVGTMKGEVIVYDLRMLSHPLYKTKAYKGPVY 265          
BLAST of SMED30020424 vs. TrEMBL
Match: A0A059BWJ4 (Uncharacterized protein OS=Eucalyptus grandis OX=71139 GN=EUGRSUZ_F03314 PE=4 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 2.754e-7
Identity = 36/116 (31.03%), Postives = 65/116 (56.03%), Query Frame = 1
Query:  577 DGIIGLYDTEIEKIINKSHCHSKRVNTVSYSYYNESLMLSGSDNNQVVLWNCNEK-SIRVHKTNSPITSCSMS--DGVLYGFGEANGNVSIFDIRNSREPVYTQKNYN-SIDYVQF 912
            +G++ ++D    +++ +   H KRV ++ +S  + +L+ SGSD+  V LW+ N+  SI   KT + + S       G    FG A+  +  +D+RNSR P+ T   +N ++ YV+F
Sbjct:  519 EGVVQVWDVTRSQVLREMREHEKRVWSIDFSSADPTLLASGSDDGSVKLWSINQGVSIGTIKTKANVCSVQFPSDSGHSLAFGSADHKIYYYDLRNSRAPLCTLAGHNKTVSYVKF 634          
BLAST of SMED30020424 vs. TrEMBL
Match: A0A507EQ58 (WD_REPEATS_REGION domain-containing protein OS=Spizellomyces sp. 'palustris' OX=117820 GN=SpCBS45565_g05208 PE=4 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 3.910e-7
Identity = 38/136 (27.94%), Postives = 70/136 (51.47%), Query Frame = 1
Query:  520 ITCCTINPWENGHLLMGSVDGIIGLYDTEIEKIINKSHCHSKRVNTVSYSYYNESLMLSGSDNNQVVLWNCNEKSIRVHKTNSPITSCSM----SDGVLYGFGEANGNVSIFDIRNSREPVYT-QKNYNSIDYVQF 912
            I+C T NP+   HL+    +GI+ L+D  I + +     H KR  +V +   +   + SG D+ +V +W+ N+K+  V   +S    CS+     +     FG A+  +  +DIR+ R P++  + +  ++ YV+F
Sbjct:  384 ISCLTWNPYIRNHLVSSDYEGIVTLWDAGIGRAMCHFEEHEKRAWSVDWCQTDPLRLASGGDDTKVKIWSTNQKN-SVATIHSAANVCSVKFNPENSNHIAFGSADHKIHYYDIRDMRAPLHVFEGHRKAVSYVKF 518          
BLAST of SMED30020424 vs. Planmine SMEST
Match: SMESG000059975.1 (SMESG000059975.1)

HSP 1 Score: 853.588 bits (2204), Expect = 0.000e+0
Identity = 451/451 (100.00%), Postives = 451/451 (100.00%), Query Frame = 1
Query:  103 MTTCKPKLNSIDFDVEIITAVDYQGDTIAIYEMKNRQFKLYTIDLTFKSSFDGKFDLNCLKLYQDRWICAGDSWGKLHLFDIHKNSYVKSFSTYXXXXXXXXXXXXDQNHIFACYENGQISVVNLKLDKSRMFSWIDEYITCCTINPWENGHLLMGSVDGIIGLYDTEIEKIINKSHCHSKRVNTVSYSYYNESLMLSGSDNNQVVLWNCNEKSIRVHKTNSPITSCSMSDGVLYGFGEANGNVSIFDIRNSREPVYTQKNYNSIDYVQFCFKSFQNKTDDFFDCLNSSENLINKENLDDSLASCFSVGAHSKSSQKXXXXXXXXXXXXXXXXXXXXXGKDSAIKSFNTPIASKKIFGDFDTPKNQSSHKPKQPIKPSNLPLRDVIQNKIEISLRSMEDRIHTNIMSQIIDQFAISENIIINKLMQFRETNEELRRINENLKEKCNQLPYM 1455
            MTTCKPKLNSIDFDVEIITAVDYQGDTIAIYEMKNRQFKLYTIDLTFKSSFDGKFDLNCLKLYQDRWICAGDSWGKLHLFDIHKNSYVKSFSTYSNESIIEIVISSDQNHIFACYENGQISVVNLKLDKSRMFSWIDEYITCCTINPWENGHLLMGSVDGIIGLYDTEIEKIINKSHCHSKRVNTVSYSYYNESLMLSGSDNNQVVLWNCNEKSIRVHKTNSPITSCSMSDGVLYGFGEANGNVSIFDIRNSREPVYTQKNYNSIDYVQFCFKSFQNKTDDFFDCLNSSENLINKENLDDSLASCFSVGAHSKSSQKSNLSLDFSVSSNNSFNDFNSSGKDSAIKSFNTPIASKKIFGDFDTPKNQSSHKPKQPIKPSNLPLRDVIQNKIEISLRSMEDRIHTNIMSQIIDQFAISENIIINKLMQFRETNEELRRINENLKEKCNQLPYM
Sbjct:    1 MTTCKPKLNSIDFDVEIITAVDYQGDTIAIYEMKNRQFKLYTIDLTFKSSFDGKFDLNCLKLYQDRWICAGDSWGKLHLFDIHKNSYVKSFSTYSNESIIEIVISSDQNHIFACYENGQISVVNLKLDKSRMFSWIDEYITCCTINPWENGHLLMGSVDGIIGLYDTEIEKIINKSHCHSKRVNTVSYSYYNESLMLSGSDNNQVVLWNCNEKSIRVHKTNSPITSCSMSDGVLYGFGEANGNVSIFDIRNSREPVYTQKNYNSIDYVQFCFKSFQNKTDDFFDCLNSSENLINKENLDDSLASCFSVGAHSKSSQKSNLSLDFSVSSNNSFNDFNSSGKDSAIKSFNTPIASKKIFGDFDTPKNQSSHKPKQPIKPSNLPLRDVIQNKIEISLRSMEDRIHTNIMSQIIDQFAISENIIINKLMQFRETNEELRRINENLKEKCNQLPYM 451          
BLAST of SMED30020424 vs. Planmine SMEST
Match: SMESG000038919.1 (SMESG000038919.1)

HSP 1 Score: 242.662 bits (618), Expect = 1.079e-72
Identity = 129/321 (40.19%), Postives = 201/321 (62.62%), Query Frame = 1
Query:   85 IDIFDKMTTCKPKLNSIDFDVEIITAVDYQGDTIAIYEMKNRQFKLYTIDLTFKSSFDGKFDLNCLKLYQDRWICAGDSWGKLHLFDIHKNSYVKSFSTYXXXXXXXXXXXXDQNHIFACYENGQISVVNLKLDKSRMFSWIDEYITCCTINPWENGHLLMGSVDGIIGLYDTEIEKIINKSHCHSKRVNTVSYSYYNESLMLSGSDNNQVVLWNCNEKS-IRVHKTNSPITSCSMSDGVLYGFGEANGNVSIFDIRNSREPVYTQKNYNSIDYVQFCFKSFQNKTDDF--FDCLNS-----SENLINKENLDDSLASCFS 1023
            +D+F    + +PKL ++ F  +I+ + DY G  I ++E   R  K Y  + T KSS  GK D+NCL LY+D  I AG + G +H+FD+ K  Y+KSF+T S +SI+ I ++ D  +IF+ Y +G +S + +K       +WI   ++C    PW    LL+G +DG + LYD   E+ +  S  H+ +VN VSYSY+NE L +SG ++ Q+VL+N NEK+ ++  KT+SP+TSCSMS+GV + FGE NG ++++DIRN ++ +++ K+ + I+Y+QF F SF   T D   F   ++     S+ L+ K N + S+ASCFS
Sbjct:  149 LDVFFFKESGRPKLRTVYFQNDILVSSDYLGQNIGVFERSGRTIKTYNRETTLKSSVLGKLDMNCLALYKDVHIFAGGNKGNIHVFDLRKEKYLKSFNTNSEKSIVNIELTIDNRNIFSVYSDGTVSKLEIKNKNVNHLTWISGQVSCIKSCPWAVNKLLLGFLDGSVNLYDVNSERKLFASVAHTNKVNCVSYSYHNELLAMSGGNDKQIVLYNINEKTPMKTLKTSSPVTSCSMSEGVFFSFGEENGTITVYDIRNLKKAIFSHKSDSKINYLQFSFDSFLKNTKDTDSFQAFSTSSCSVSKALVRKSNYNCSVASCFS 469          
BLAST of SMED30020424 vs. Planmine SMEST
Match: SMESG000039027.1 (SMESG000039027.1)

HSP 1 Score: 226.098 bits (575), Expect = 2.027e-68
Identity = 145/425 (34.12%), Postives = 231/425 (54.35%), Query Frame = 1
Query:  220 LYTIDLTFKSSFDGKFDLNCLKLYQDRWICAGDSWGKLHLFDIHKNSYVKSFSTYXXXXXXXXXXXXDQNHIFACYENGQISVVNLKLDKSRMFSWIDEYITCCTINPWENGHLLMGSVDGIIGLYDTEIEKIINKSHCHSKRVNTVSYSYYNESLMLSGSDNNQVVLWNCNE-KSIRVHKTNSPITSCSMSDGVLYGFGEANGNVSIFDIRNSREPVYTQKNYNSIDYVQFCFKSFQNK-TDDFFDCLNSSENLINKENLDDSLASCFSVGAHSKSSQKXXXXXXXXXXXXXXXXXXXXXGKDS-AIKSFNTPIASKKIFGDFDTPKNQSSHKPKQPI-KPSNLP-------------LRDVIQNKIEISLRSMEDRIHTNIMSQIIDQFAISENIIINKLMQFRETNEELRRINENLKEKCNQ 1443
            +YT + T KSS +G F+ NC+ LY    +  G++ GK+ ++D+  N   K F T    ++  I +S D  +IF CY +G++S + +K  +    +WI E I C  I+PW   +LL+GSV+G + LYD      +  S+ H   VN VSYSY+N+ + +SG ++ Q +L+  NE + ++ +KT SP+T CS+SDGVL+ FGEANG++SI+DIR   + VY  K  + I Y+QF +KS QN  + ++   +  S    NK + D SL SCFS G +S     ++       + ++     +S    S   K  N     K++   F+TP N +   P  P+ KP ++              LR  I  ++   L  +EDR+ ++I+ + IDQ  I+EN II  ++       EL + N++L EK N+
Sbjct:    3 IYTAEGTLKSSLNGNFNFNCMVLYGSDCLLTGENHGKIRVYDLKNNLTRKLFDTNYPITVDLIDVSIDNKNIFVCYADGKVSKLEIKTARVDNLTWISEKIKCLKISPWVANNLLVGSVNGSVSLYDANNHSRVFTSNTHKGMVNCVSYSYFNDKIAISGGEDKQAILYGINESRPLKTYKTISPVTHCSISDGVLFSFGEANGDISIYDIRKLNKFVYFHKLNDRISYLQFTYKSHQNGDSIEYLSTIEQSGGYANKLSYDCSLESCFSEGEYSVHYNNNHQISCDGFNISHINQRKSSLSPVSNEFKLSNENKLRKQV--QFETPVNNNPSVPIDPVAKPESIIESNIQSGGFDKEFLRQTIHEELNKQLMELEDRLSSDILMKTIDQLFITENNIIQSILPVVTETRELLKENKSLCEKLNR 425          
The following BLAST results are available for this feature:
BLAST of SMED30020424 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020424 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020424 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020424 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020424 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020424 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Utp155.874e-629.69UTP15 small subunit processome component [Source:M... [more]
back to top
BLAST of SMED30020424 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q94BM7|SPA4_ARATH4.950e-830.17Protein SPA1-RELATED 4 OS=Arabidopsis thaliana OX=... [more]
sp|Q9LJR3|SPA3_ARATH4.287e-729.31Protein SPA1-RELATED 3 OS=Arabidopsis thaliana OX=... [more]
back to top
BLAST of SMED30020424 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A059BVP72.367e-731.03Uncharacterized protein OS=Eucalyptus grandis OX=7... [more]
A0A059BVK72.502e-731.03Uncharacterized protein OS=Eucalyptus grandis OX=7... [more]
A0A444SC692.701e-723.86Protein NEDD1 OS=Armadillidium vulgare OX=13347 GN... [more]
A0A059BWJ42.754e-731.03Uncharacterized protein OS=Eucalyptus grandis OX=7... [more]
A0A507EQ583.910e-727.94WD_REPEATS_REGION domain-containing protein OS=Spi... [more]
back to top
BLAST of SMED30020424 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020424 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020424 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020424 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020424 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020424 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000059975.10.000e+0100.00SMESG000059975.1[more]
SMESG000038919.11.079e-7240.19SMESG000038919.1[more]
SMESG000039027.12.027e-6834.12SMESG000039027.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020424 ID=SMED30020424|Name=SMED30020424|organism=Schmidtea mediterranea sexual|type=transcript|length=1516bp
ATCATTTCGAGCTTTATACTATATAAATGATAAATGAAAAAAAAAGTTGG
CAGTTTCATAATCTGTCACGGTGATGTTTGTAGAATAGATATATTCGATA
AAATGACCACCTGTAAACCTAAATTAAATTCCATTGATTTTGACGTTGAA
ATAATAACAGCAGTTGATTATCAAGGCGATACAATTGCAATTTATGAAAT
GAAAAATAGGCAATTTAAATTATATACAATTGATTTAACTTTTAAATCAT
CTTTTGACGGAAAGTTCGATTTAAATTGCTTGAAACTATATCAAGATCGT
TGGATTTGTGCTGGCGATAGTTGGGGAAAACTCCACCTTTTTGATATCCA
TAAAAATTCATATGTAAAATCTTTTAGTACTTATAGTAATGAATCAATCA
TTGAAATTGTAATTTCTTCCGATCAAAATCATATTTTTGCATGCTACGAA
AATGGTCAGATTTCAGTTGTTAACTTAAAATTGGATAAAAGTCGTATGTT
TTCATGGATTGACGAATACATCACTTGTTGTACTATAAACCCATGGGAAA
ATGGACATCTTTTAATGGGATCCGTTGATGGAATAATTGGTTTGTACGAT
ACAGAGATTGAAAAAATAATCAATAAATCTCACTGTCACAGTAAAAGAGT
CAATACCGTTTCATATTCATATTACAATGAGAGTTTAATGCTATCAGGTA
GTGATAATAATCAGGTCGTATTGTGGAATTGTAACGAAAAGTCGATTAGA
GTTCATAAAACAAATAGCCCAATCACATCTTGTTCAATGAGTGATGGAGT
TCTTTATGGATTCGGAGAAGCCAATGGAAATGTTTCTATTTTCGACATTA
GGAATTCAAGAGAACCGGTTTATACTCAGAAAAATTACAACTCAATCGAT
TATGTTCAATTTTGCTTTAAATCTTTCCAAAATAAGACCGACGATTTTTT
CGATTGTTTAAATTCATCAGAAAACTTAATAAATAAAGAAAACCTTGATG
ATTCGCTCGCTTCTTGTTTTTCAGTTGGTGCGCATTCTAAATCCAGTCAA
AAATCCAATCTCAGCTTGGATTTTTCGGTATCCTCCAATAATTCATTTAA
TGATTTTAATTCCTCTGGCAAAGATTCGGCAATAAAATCATTCAATACTC
CAATCGCTTCAAAAAAAATCTTTGGTGACTTTGATACACCAAAAAATCAA
TCATCACATAAACCGAAACAGCCAATCAAACCGTCTAATTTACCTTTGAG
AGATGTAATCCAAAATAAAATTGAAATCTCTTTGCGATCTATGGAAGATC
GGATTCACACTAATATAATGTCTCAAATTATCGATCAGTTTGCCATTTCA
GAAAATATTATTATTAATAAATTGATGCAATTCCGTGAAACTAATGAGGA
ACTCAGGAGAATAAATGAAAATTTGAAAGAAAAATGCAACCAATTACCTT
ATATGTGATTTGAATATTATTTTGATGTACTCAACTGATTTTCCATTGGC
TGAATTTTTATTGGTG
back to top

protein sequence of SMED30020424-orf-1

>SMED30020424-orf-1 ID=SMED30020424-orf-1|Name=SMED30020424-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=475bp
MKKKVGSFIICHGDVCRIDIFDKMTTCKPKLNSIDFDVEIITAVDYQGDT
IAIYEMKNRQFKLYTIDLTFKSSFDGKFDLNCLKLYQDRWICAGDSWGKL
HLFDIHKNSYVKSFSTYSNESIIEIVISSDQNHIFACYENGQISVVNLKL
DKSRMFSWIDEYITCCTINPWENGHLLMGSVDGIIGLYDTEIEKIINKSH
CHSKRVNTVSYSYYNESLMLSGSDNNQVVLWNCNEKSIRVHKTNSPITSC
SMSDGVLYGFGEANGNVSIFDIRNSREPVYTQKNYNSIDYVQFCFKSFQN
KTDDFFDCLNSSENLINKENLDDSLASCFSVGAHSKSSQKSNLSLDFSVS
SNNSFNDFNSSGKDSAIKSFNTPIASKKIFGDFDTPKNQSSHKPKQPIKP
SNLPLRDVIQNKIEISLRSMEDRIHTNIMSQIIDQFAISENIIINKLMQF
RETNEELRRINENLKEKCNQLPYM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0046872metal ion binding