Cystinosin homolog-like Protein

Overview
NameCystinosin homolog-like Protein
Smed IDSMED30020423
Length (bp)2235
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cystinosin homolog-like Protein (SMED30020423) t-SNE clustered cells

Violin plots show distribution of expression levels for Cystinosin homolog-like Protein (SMED30020423) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cystinosin homolog-like Protein (SMED30020423) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cystinosin homolog-like Protein (SMED30020423) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020423

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30020423SMESG000079054.1 dd_Smed_v4_4571_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020423SMESG000079054.1 dd_Smed_v4_4571_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
X1 cellSMED30020423SMESG000079054.1 SMESG000036375.1 isotig03286be_Smed_v2PMID:22543868
Onal et al., 2012
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cystinosin homolog-like Protein vs. Ensembl Human
Match: CTNS (cystinosin, lysosomal cystine transporter [Source:HGNC Symbol;Acc:HGNC:2518])

HSP 1 Score: 102.449 bits (254), Expect = 3.206e-25
Identity = 46/75 (61.33%), Postives = 58/75 (77.33%), Query Frame = 1
Query: 1726 KAVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYR 1950
            +A MN+  KST GWSIGN+ LDFTGG  S++QM + SYNN+ W   F DPTKFGLG+FSI FD++F +QH+ LYR
Sbjct:   33 QAYMNFYYKSTEGWSIGNVLLDFTGGSFSLLQMFLQSYNNDQWTLIFGDPTKFGLGVFSIVFDVVFFIQHFCLYR 107          
BLAST of Cystinosin homolog-like Protein vs. Ensembl Human
Match: CTNS (cystinosin, lysosomal cystine transporter [Source:HGNC Symbol;Acc:HGNC:2518])

HSP 1 Score: 103.219 bits (256), Expect = 6.691e-24
Identity = 49/93 (52.69%), Postives = 63/93 (67.74%), Query Frame = 1
Query: 1726 KAVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYRGAEPIIYAVFENDDELRS 2004
            +A MN+  KST GWSIGN+ LDFTGG  S++QM + SYNN+ W   F DPTKFGLG+FSI FD++F +QH+ LYR    +  A   +   LR 
Sbjct:  137 QAYMNFYYKSTEGWSIGNVLLDFTGGSFSLLQMFLQSYNNDQWTLIFGDPTKFGLGVFSIVFDVVFFIQHFCLYRKRPGLQAARTGSGSRLRQ 229          
BLAST of Cystinosin homolog-like Protein vs. Ensembl Human
Match: CTNS (cystinosin, lysosomal cystine transporter [Source:HGNC Symbol;Acc:HGNC:2518])

HSP 1 Score: 102.064 bits (253), Expect = 7.076e-24
Identity = 46/75 (61.33%), Postives = 58/75 (77.33%), Query Frame = 1
Query: 1726 KAVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYR 1950
            +A MN+  KST GWSIGN+ LDFTGG  S++QM + SYNN+ W   F DPTKFGLG+FSI FD++F +QH+ LYR
Sbjct:  137 QAYMNFYYKSTEGWSIGNVLLDFTGGSFSLLQMFLQSYNNDQWTLIFGDPTKFGLGVFSIVFDVVFFIQHFCLYR 211          
BLAST of Cystinosin homolog-like Protein vs. Ensembl Human
Match: CTNS (cystinosin, lysosomal cystine transporter [Source:HGNC Symbol;Acc:HGNC:2518])

HSP 1 Score: 102.834 bits (255), Expect = 7.568e-23
Identity = 46/75 (61.33%), Postives = 58/75 (77.33%), Query Frame = 1
Query: 1726 KAVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYR 1950
            +A MN+  KST GWSIGN+ LDFTGG  S++QM + SYNN+ W   F DPTKFGLG+FSI FD++F +QH+ LYR
Sbjct:  284 QAYMNFYYKSTEGWSIGNVLLDFTGGSFSLLQMFLQSYNNDQWTLIFGDPTKFGLGVFSIVFDVVFFIQHFCLYR 358          
BLAST of Cystinosin homolog-like Protein vs. Ensembl Human
Match: CTNS (cystinosin, lysosomal cystine transporter [Source:HGNC Symbol;Acc:HGNC:2518])

HSP 1 Score: 102.834 bits (255), Expect = 7.568e-23
Identity = 46/75 (61.33%), Postives = 58/75 (77.33%), Query Frame = 1
Query: 1726 KAVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYR 1950
            +A MN+  KST GWSIGN+ LDFTGG  S++QM + SYNN+ W   F DPTKFGLG+FSI FD++F +QH+ LYR
Sbjct:  284 QAYMNFYYKSTEGWSIGNVLLDFTGGSFSLLQMFLQSYNNDQWTLIFGDPTKFGLGVFSIVFDVVFFIQHFCLYR 358          
BLAST of Cystinosin homolog-like Protein vs. Ensembl Celegans
Match: ctns-1 (Cystinosin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q09500])

HSP 1 Score: 116.701 bits (291), Expect = 6.076e-28
Identity = 54/78 (69.23%), Postives = 63/78 (80.77%), Query Frame = 1
Query: 1726 KAVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYRGAE 1959
            +A  NY RKSTVGWSIGNI LDFTGG L I+QMI+ + N NDW +F+A+P KFGLG  SIFFDI+F+VQHYVLY  AE
Sbjct:  286 QAYFNYTRKSTVGWSIGNIMLDFTGGTLDILQMILQAVNVNDWSAFYANPVKFGLGFVSIFFDIIFMVQHYVLYPNAE 363          
BLAST of Cystinosin homolog-like Protein vs. Ensembl Celegans
Match: ctns-1 (Cystinosin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q09500])

HSP 1 Score: 116.701 bits (291), Expect = 9.215e-28
Identity = 54/78 (69.23%), Postives = 63/78 (80.77%), Query Frame = 1
Query: 1726 KAVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYRGAE 1959
            +A  NY RKSTVGWSIGNI LDFTGG L I+QMI+ + N NDW +F+A+P KFGLG  SIFFDI+F+VQHYVLY  AE
Sbjct:  286 QAYFNYTRKSTVGWSIGNIMLDFTGGTLDILQMILQAVNVNDWSAFYANPVKFGLGFVSIFFDIIFMVQHYVLYPNAE 363          
BLAST of Cystinosin homolog-like Protein vs. Ensembl Fly
Match: CG17119 (gene:FBgn0039045 transcript:FBtr0084357)

HSP 1 Score: 117.087 bits (292), Expect = 8.125e-28
Identity = 52/78 (66.67%), Postives = 65/78 (83.33%), Query Frame = 1
Query: 1726 KAVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYRGAE 1959
            +A+MNYRRKST GWSIGNI LDFTGG LS++QMI+ ++N +DW S F DPTKFGLGLFS+ FD+ F++QHYV YR + 
Sbjct:  289 QALMNYRRKSTSGWSIGNILLDFTGGTLSMLQMILNAHNYDDWVSIFGDPTKFGLGLFSVLFDVFFMLQHYVFYRHSR 366          
BLAST of Cystinosin homolog-like Protein vs. Ensembl Fly
Match: CG17119 (gene:FBgn0039045 transcript:FBtr0344299)

HSP 1 Score: 117.087 bits (292), Expect = 8.125e-28
Identity = 52/78 (66.67%), Postives = 65/78 (83.33%), Query Frame = 1
Query: 1726 KAVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYRGAE 1959
            +A+MNYRRKST GWSIGNI LDFTGG LS++QMI+ ++N +DW S F DPTKFGLGLFS+ FD+ F++QHYV YR + 
Sbjct:  289 QALMNYRRKSTSGWSIGNILLDFTGGTLSMLQMILNAHNYDDWVSIFGDPTKFGLGLFSVLFDVFFMLQHYVFYRHSR 366          
BLAST of Cystinosin homolog-like Protein vs. Ensembl Zebrafish
Match: ctns (cystinosin, lysosomal cystine transporter [Source:ZFIN;Acc:ZDB-GENE-050522-352])

HSP 1 Score: 129.798 bits (325), Expect = 5.053e-32
Identity = 58/96 (60.42%), Postives = 73/96 (76.04%), Query Frame = 1
Query: 1726 KAVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYRGAEPIIYAVFENDDELRSTSS 2013
            +A MNYRRKST GWSIGN+ LDFTGG  S++QM + +YNN+ WR  F DPTKFGLG+FSIFFDILF++QHY LYR  EP+   + E +D+  S  +
Sbjct:  289 QAHMNYRRKSTEGWSIGNVLLDFTGGSFSLIQMFLEAYNNDKWRFIFGDPTKFGLGVFSIFFDILFIIQHYCLYRNREPMYQDLDEQNDQHSSVKT 384          
BLAST of Cystinosin homolog-like Protein vs. Ensembl Zebrafish
Match: CABZ01030006.1 (pep scaffold:GRCz11:KN150258.1:33006:36502:-1 gene:ENSDARG00000114113.1 transcript:ENSDART00000182402.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01030006.1)

HSP 1 Score: 52.7582 bits (125), Expect = 7.717e-7
Identity = 29/74 (39.19%), Postives = 44/74 (59.46%), Query Frame = 3
Query:  633 FSSHYHHQSNGQIERQFRTLKNWISCLEEKQFKTLEEALPQIEFEINSTIQSSIKVSLAEVVYGRKVYKEHFKI 854
             ++ YH Q+N   ER  RTLK+ I+   E   KT +  LP++ F +NS IQ SI ++ AE+  GRK++    K+
Sbjct:  127 LTTAYHPQTN-MTERVNRTLKSMIAGFVEDNHKTWDTYLPELRFALNSAIQESIGMTPAELHLGRKIHSPMDKL 199          
BLAST of Cystinosin homolog-like Protein vs. Ensembl Xenopus
Match: klhl24 (kelch like family member 24 [Source:Xenbase;Acc:XB-GENE-1000313])

HSP 1 Score: 117.087 bits (292), Expect = 3.459e-27
Identity = 53/75 (70.67%), Postives = 62/75 (82.67%), Query Frame = 1
Query: 1726 KAVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYR 1950
            +A MN+RRKST GWSIGN+ LDFTGG  SIVQM I SYNN++W   F DPTKFGLG+FSI FDI+F++QHY LYR
Sbjct:  385 QAYMNFRRKSTEGWSIGNVLLDFTGGSFSIVQMFIQSYNNDEWNLIFGDPTKFGLGVFSIGFDIVFIIQHYCLYR 459          
BLAST of Cystinosin homolog-like Protein vs. Ensembl Mouse
Match: Ctns (cystinosis, nephropathic [Source:MGI Symbol;Acc:MGI:1932872])

HSP 1 Score: 100.138 bits (248), Expect = 3.882e-22
Identity = 45/75 (60.00%), Postives = 58/75 (77.33%), Query Frame = 1
Query: 1726 KAVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYR 1950
            +A MN+  KST GWSIG + LDFTGG  S++QM + SYNN+ W   F DPTKFGLG+F+IFFD++F +QH+ LYR
Sbjct:  284 QAYMNFYYKSTKGWSIGGVLLDFTGGSFSLLQMFLQSYNNDQWTLIFGDPTKFGLGVFTIFFDVVFFIQHFYLYR 358          
BLAST of Cystinosin homolog-like Protein vs. Ensembl Mouse
Match: Ctns (cystinosis, nephropathic [Source:MGI Symbol;Acc:MGI:1932872])

HSP 1 Score: 100.138 bits (248), Expect = 3.882e-22
Identity = 45/75 (60.00%), Postives = 58/75 (77.33%), Query Frame = 1
Query: 1726 KAVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYR 1950
            +A MN+  KST GWSIG + LDFTGG  S++QM + SYNN+ W   F DPTKFGLG+F+IFFD++F +QH+ LYR
Sbjct:  284 QAYMNFYYKSTKGWSIGGVLLDFTGGSFSLLQMFLQSYNNDQWTLIFGDPTKFGLGVFTIFFDVVFFIQHFYLYR 358          
BLAST of Cystinosin homolog-like Protein vs. UniProt/SwissProt
Match: sp|Q9VCR7|CTNS_DROME (Cystinosin homolog OS=Drosophila melanogaster OX=7227 GN=CG17119 PE=1 SV=2)

HSP 1 Score: 117.087 bits (292), Expect = 8.144e-27
Identity = 52/78 (66.67%), Postives = 65/78 (83.33%), Query Frame = 1
Query: 1726 KAVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYRGAE 1959
            +A+MNYRRKST GWSIGNI LDFTGG LS++QMI+ ++N +DW S F DPTKFGLGLFS+ FD+ F++QHYV YR + 
Sbjct:  289 QALMNYRRKSTSGWSIGNILLDFTGGTLSMLQMILNAHNYDDWVSIFGDPTKFGLGLFSVLFDVFFMLQHYVFYRHSR 366          
BLAST of Cystinosin homolog-like Protein vs. UniProt/SwissProt
Match: sp|Q09500|CTNS_CAEEL (Cystinosin homolog OS=Caenorhabditis elegans OX=6239 GN=ctns-1 PE=3 SV=2)

HSP 1 Score: 116.701 bits (291), Expect = 1.172e-26
Identity = 54/78 (69.23%), Postives = 63/78 (80.77%), Query Frame = 1
Query: 1726 KAVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYRGAE 1959
            +A  NY RKSTVGWSIGNI LDFTGG L I+QMI+ + N NDW +F+A+P KFGLG  SIFFDI+F+VQHYVLY  AE
Sbjct:  286 QAYFNYTRKSTVGWSIGNIMLDFTGGTLDILQMILQAVNVNDWSAFYANPVKFGLGFVSIFFDIIFMVQHYVLYPNAE 363          
BLAST of Cystinosin homolog-like Protein vs. UniProt/SwissProt
Match: sp|A8WN56|CTNS_CAEBR (Cystinosin homolog OS=Caenorhabditis briggsae OX=6238 GN=ctns-1 PE=3 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 7.544e-26
Identity = 51/78 (65.38%), Postives = 63/78 (80.77%), Query Frame = 1
Query: 1726 KAVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYRGAE 1959
            +A  NY+RKSTVGWSIGNI LDFTGG L I+QM++ + N NDW +F+A+P KFGLG  SIFFDI+F++QHY LY  AE
Sbjct:  285 QAYFNYQRKSTVGWSIGNILLDFTGGSLDILQMVLQAINVNDWSAFYANPVKFGLGFVSIFFDIIFMIQHYALYPDAE 362          
BLAST of Cystinosin homolog-like Protein vs. UniProt/SwissProt
Match: sp|A7MB63|CTNS_BOVIN (Cystinosin OS=Bos taurus OX=9913 GN=CTNS PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.204e-22
Identity = 46/75 (61.33%), Postives = 58/75 (77.33%), Query Frame = 1
Query: 1726 KAVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYR 1950
            +A MN+  KST GWSIGN+ LDFTGG  S++QM + SYNN+ W   F DPTKFGLG+FSI FD++F +QH+ LYR
Sbjct:  284 QAYMNFHYKSTEGWSIGNVLLDFTGGSFSLLQMFLQSYNNDQWTLIFGDPTKFGLGIFSIIFDVVFFIQHFCLYR 358          
BLAST of Cystinosin homolog-like Protein vs. UniProt/SwissProt
Match: sp|O60931|CTNS_HUMAN (Cystinosin OS=Homo sapiens OX=9606 GN=CTNS PE=1 SV=2)

HSP 1 Score: 102.834 bits (255), Expect = 3.634e-22
Identity = 46/75 (61.33%), Postives = 58/75 (77.33%), Query Frame = 1
Query: 1726 KAVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYR 1950
            +A MN+  KST GWSIGN+ LDFTGG  S++QM + SYNN+ W   F DPTKFGLG+FSI FD++F +QH+ LYR
Sbjct:  284 QAYMNFYYKSTEGWSIGNVLLDFTGGSFSLLQMFLQSYNNDQWTLIFGDPTKFGLGVFSIVFDVVFFIQHFCLYR 358          
BLAST of Cystinosin homolog-like Protein vs. TrEMBL
Match: A0A2S2NF29 (Cystinosin (Fragment) OS=Schizaphis graminum OX=13262 GN=g.117536 PE=4 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 4.977e-31
Identity = 62/97 (63.92%), Postives = 72/97 (74.23%), Query Frame = 1
Query: 1726 KAVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYRGAEPIIYAVFENDDELRSTSSI 2016
            + VMNY+RKST+GWSIGNIFLDFTGG LSI+QMII +YN NDW S F DPTKFGLGL S+ FDILF +QHYV Y G     Y  FEN +E+     +
Sbjct:   57 QVVMNYKRKSTIGWSIGNIFLDFTGGLLSILQMIINAYNYNDWASVFGDPTKFGLGLLSVIFDILFFLQHYVFYSGVN---YTEFENYNEVEEDDEV 150          
BLAST of Cystinosin homolog-like Protein vs. TrEMBL
Match: A0A2S2NG50 (Cystinosin OS=Schizaphis graminum OX=13262 GN=g.117526 PE=4 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.662e-30
Identity = 61/94 (64.89%), Postives = 71/94 (75.53%), Query Frame = 1
Query: 1735 MNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYRGAEPIIYAVFENDDELRSTSSI 2016
            MNY+RKST+GWSIGNIFLDFTGG LSI+QMII +YN NDW S F DPTKFGLGL S+ FDILF +QHYV Y G   + Y  FEN +E+     +
Sbjct:    1 MNYKRKSTIGWSIGNIFLDFTGGLLSILQMIINAYNYNDWASVFGDPTKFGLGLLSVIFDILFFLQHYVFYSG---VNYTEFENYNEVEEDDEV 91          
BLAST of Cystinosin homolog-like Protein vs. TrEMBL
Match: A0A0B6XXL7 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF2887 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 3.702e-30
Identity = 59/93 (63.44%), Postives = 74/93 (79.57%), Query Frame = 1
Query: 1726 KAVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYRGAEPIIYAVFENDDELRS 2004
            +A MN+RRKST+GWSIGN+ LD TGG LS++QM +LSYN++DW S F DPTKFGLGLFSI FDILF+VQHY LYRG  P    + ++ DE+ +
Sbjct:   29 QAYMNFRRKSTLGWSIGNVLLDCTGGSLSLLQMFLLSYNSDDWGSIFGDPTKFGLGLFSILFDILFIVQHYCLYRGKVP-YEQIQDSSDEITA 120          
BLAST of Cystinosin homolog-like Protein vs. TrEMBL
Match: A0A1J1HME6 (CLUMA_CG002366, isoform A OS=Clunio marinus OX=568069 GN=putative Cystinosin homolog PE=4 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 2.794e-29
Identity = 62/90 (68.89%), Postives = 73/90 (81.11%), Query Frame = 1
Query: 1726 KAVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYRGAEPIIYAVFENDDE 1995
            +AVMNYRRKSTVGWSIGNI LDFTGG LS++QMI+ SYN NDW+S F DPTKFGLGLFS+ FDI+F++QHYV YR   P  Y +  + DE
Sbjct:  292 QAVMNYRRKSTVGWSIGNIILDFTGGLLSMLQMILNSYNYNDWQSIFGDPTKFGLGLFSVLFDIVFMLQHYVFYRNLLP--YQLIPDSDE 379          
BLAST of Cystinosin homolog-like Protein vs. TrEMBL
Match: A0A1L8DDP2 (Putative cystine transporter cystinosin (Fragment) OS=Nyssomyia neivai OX=330878 PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 6.694e-29
Identity = 57/79 (72.15%), Postives = 69/79 (87.34%), Query Frame = 1
Query: 1726 KAVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYRGAEP 1962
            +A+MNYRRKSTVGWSIGNI LDFTGG LS++QM++ +YN +DW S F DPTKFGLGLFS+ FDI+F++QHYVLYR A P
Sbjct:  170 QALMNYRRKSTVGWSIGNILLDFTGGILSMLQMMLNAYNYDDWDSIFGDPTKFGLGLFSVAFDIVFIIQHYVLYRNATP 248          
BLAST of Cystinosin homolog-like Protein vs. Ensembl Cavefish
Match: ctns (cystinosin, lysosomal cystine transporter [Source:NCBI gene;Acc:103043999])

HSP 1 Score: 121.709 bits (304), Expect = 2.050e-29
Identity = 54/89 (60.67%), Postives = 69/89 (77.53%), Query Frame = 1
Query: 1726 KAVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYRGAEPIIYAVFENDD 1992
            +A MNY+RKST GWSIGN+ LDFTGG  S++QM + SYNN++W+  F DPTKFGLGLFSIFFD++F++QHY LYR   P  Y V   ++
Sbjct:  289 QAYMNYKRKSTEGWSIGNVLLDFTGGSFSLLQMFLQSYNNDEWKLIFGDPTKFGLGLFSIFFDVIFIIQHYCLYRNKGP-EYQVLSTEE 376          
BLAST of Cystinosin homolog-like Protein vs. Ensembl Cavefish
Match: ctns (cystinosin, lysosomal cystine transporter [Source:NCBI gene;Acc:103043999])

HSP 1 Score: 121.709 bits (304), Expect = 2.050e-29
Identity = 54/89 (60.67%), Postives = 69/89 (77.53%), Query Frame = 1
Query: 1726 KAVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYRGAEPIIYAVFENDD 1992
            +A MNY+RKST GWSIGN+ LDFTGG  S++QM + SYNN++W+  F DPTKFGLGLFSIFFD++F++QHY LYR   P  Y V   ++
Sbjct:  289 QAYMNYKRKSTEGWSIGNVLLDFTGGSFSLLQMFLQSYNNDEWKLIFGDPTKFGLGLFSIFFDVIFIIQHYCLYRNKGP-EYQVLSTEE 376          
BLAST of Cystinosin homolog-like Protein vs. Ensembl Nematostella
Match: EDO46894 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNQ1])

HSP 1 Score: 115.931 bits (289), Expect = 5.506e-29
Identity = 54/74 (72.97%), Postives = 62/74 (83.78%), Query Frame = 1
Query: 1726 KAVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLY 1947
            +A MNYRRKSTVGWSIGN+ LDFTGG  S++QM +L+YNN+DWRS F D TKFGLG  SI FDILF+VQHY LY
Sbjct:  179 QAYMNYRRKSTVGWSIGNVLLDFTGGSFSLLQMFLLAYNNDDWRSIFGDFTKFGLGFISIVFDILFIVQHYALY 252          
BLAST of Cystinosin homolog-like Protein vs. Ensembl Nematostella
Match: EDO34987 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMR9])

HSP 1 Score: 72.0182 bits (175), Expect = 6.038e-14
Identity = 37/95 (38.95%), Postives = 54/95 (56.84%), Query Frame = 1
Query: 1735 MNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYRGAEPIIYAVFENDDELRSTSSIK 2019
            +NYRRK T G+ IG + LDF+GG LS++QM I     +  + F  +  K  LG+ ++ F+I  V+QHY+LY G  P + A     D    T  +K
Sbjct:  170 LNYRRKCTEGFHIGGVLLDFSGGILSLLQMNIYCALEHSTKQFTGNIPKLVLGILTLVFNITLVLQHYMLYMGNPPPVLA----PDSTEKTDLMK 260          
BLAST of Cystinosin homolog-like Protein vs. Ensembl Nematostella
Match: EDO31571 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXI3])

HSP 1 Score: 67.0106 bits (162), Expect = 6.717e-14
Identity = 31/71 (43.66%), Postives = 46/71 (64.79%), Query Frame = 1
Query: 1735 MNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLY 1947
            +NYRRK T G+ IG + LDF+GG LS++QM I     +  + F  +  K  LG+ ++ F+I  V+QHY+LY
Sbjct:   10 LNYRRKCTEGFHIGGVLLDFSGGILSLLQMNIYCALEHSTKQFTGNIPKLVLGILTLVFNITLVLQHYMLY 80          
BLAST of Cystinosin homolog-like Protein vs. Ensembl Medaka
Match: ctns (cystinosin, lysosomal cystine transporter [Source:NCBI gene;Acc:101155673])

HSP 1 Score: 125.946 bits (315), Expect = 4.282e-30
Identity = 55/75 (73.33%), Postives = 64/75 (85.33%), Query Frame = 1
Query: 1726 KAVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYR 1950
            +A MNYRRKST GWSIGN+ LDFTGG LSI+QMI+ SYNN++WR  F DPTKFGLGLFS+ FDI+F+ QHY LYR
Sbjct:  413 QAYMNYRRKSTEGWSIGNVLLDFTGGVLSILQMIVQSYNNDEWRLIFGDPTKFGLGLFSVLFDIIFITQHYCLYR 487          
BLAST of Cystinosin homolog-like Protein vs. Planmine SMEST
Match: SMESG000079054.1 (SMESG000079054.1)

HSP 1 Score: 200.675 bits (509), Expect = 9.894e-58
Identity = 97/98 (98.98%), Postives = 98/98 (100.00%), Query Frame = 1
Query: 1726 KAVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYRGAEPIIYAVFENDDELRSTSSIK 2019
            +AVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYRGAEPIIYAVFENDDELRSTSSIK
Sbjct:  251 QAVMNYRRKSTVGWSIGNIFLDFTGGFLSIVQMIILSYNNNDWRSFFADPTKFGLGLFSIFFDILFVVQHYVLYRGAEPIIYAVFENDDELRSTSSIK 348          
BLAST of Cystinosin homolog-like Protein vs. Planmine SMEST
Match: SMESG000080238.1 (SMESG000080238.1)

HSP 1 Score: 164.851 bits (416), Expect = 3.485e-53
Identity = 86/112 (76.79%), Postives = 94/112 (83.93%), Query Frame = 3
Query:  633 FSSHYHHQSNGQIERQFRTLKNWISC-LEEKQFKTLEEALPQIEFEINSTIQSSIKVSLAEVVYGRKVYKEHFKIGTETNNKESRKNEILINIKSVNRINNYNQENRTHRSF 965
            +S  YHHQSN QIERQFRTL++WISC LEEK+FKT EEAL  IEF I+ST+QSSIKVS AEVVY RK+ KE F   TE NNKESRKNE+L NIKSVNRINNYNQENRTHRS 
Sbjct:  348 YSCPYHHQSNDQIERQFRTLRDWISCCLEEKEFKTWEEALHHIEFAISSTMQSSIKVSSAEVVYRRKLCKEFFTYDTEANNKESRKNEMLNNIKSVNRINNYNQENRTHRSL 459          

HSP 2 Score: 64.3142 bits (155), Expect = 3.485e-53
Identity = 36/55 (65.45%), Postives = 40/55 (72.73%), Query Frame = 1
Query:  472 KAVRKQGEKTLFNNVLSSCILKFVPLKEIYFDKRKCFDSNSFRNRALKYQMKIFF 636
            KAVR   +KTL NNVLSS   KF+    I+ DK KCFDSNS RN ALKYQMKIF+
Sbjct:  299 KAVRTPDKKTLVNNVLSS--WKFIL---IHVDKEKCFDSNSLRNMALKYQMKIFY 348          
BLAST of Cystinosin homolog-like Protein vs. Planmine SMEST
Match: SMESG000034332.1 (SMESG000034332.1)

HSP 1 Score: 157.147 bits (396), Expect = 7.165e-45
Identity = 86/120 (71.67%), Postives = 97/120 (80.83%), Query Frame = 3
Query:  780 IQSSIKVSLAEVVYGRKVYKEHFKIGTETNNKESRKNEILINIKSVNRINNYNQENRTHRSFCVGEFVLVREVVRNKKDNRYCGLF*IIEKD*KNYYLLKDLNGKFLKRNVE*LKPF*AR 1139
            +QSSIKVS AEVVYGR++ KE F IG+E  N  SRKNEIL  IKSVNRINNYNQENRTH SF VGE V V+E VRNK++NRYCG F +IEKD K+ YLLKDLN KF+KRNVE LK F A+
Sbjct:    1 MQSSIKVSPAEVVYGRRLCKERFTIGSEAKNNVSRKNEILNIIKSVNRINNYNQENRTHGSFSVGELVNVKEDVRNKQENRYCGPFELIEKDHKHSYLLKDLNRKFMKRNVEWLKQFKAK 120          
BLAST of Cystinosin homolog-like Protein vs. Planmine SMEST
Match: SMESG000058507.1 (SMESG000058507.1)

HSP 1 Score: 125.946 bits (315), Expect = 4.836e-40
Identity = 72/122 (59.02%), Postives = 83/122 (68.03%), Query Frame = 3
Query:  645 YHHQSNGQIERQFRTLKNWISCLEEKQFKTLEEALPQIEFEINSTIQSSIKVSLAEVVYGRKVYKEHFKIGTETNNKESRKNEILINIKSVNRINNYNQENRTHRSFCVGEFVLVREVVRNK 1010
            + +QSNG+I            CLEE QFKT EEAL  I F INST+QSSI +S  EVVY RK+  +HF I T+ NNKE R+NEIL NI+SVNRIN Y QENRTHRS  VGE V  +E  RNK
Sbjct:  166 FTNQSNGKI-----------CCLEENQFKTCEEALTHIGFAINSTMQSSINISTTEVVYRRKLCIKHFIIDTQPNNKELRRNEILNNIESVNRINIYYQENRTHRSLSVGELVFNKEDFRNK 276          

HSP 2 Score: 58.9214 bits (141), Expect = 4.836e-40
Identity = 31/55 (56.36%), Postives = 38/55 (69.09%), Query Frame = 1
Query:  472 KAVRKQGEKTLFNNVLSSCILKFVPLKEIYFDKRKCFDSNSFRNRALKYQMKIFF 636
            KA+R   E+T  +NVLSS ILKF   KEI+ DKRKC D NS    A+KYQ+K+ F
Sbjct:  112 KALRTHDEETRVDNVLSSWILKFGSPKEIHVDKRKCSDFNSLSTIAIKYQIKMVF 166          
BLAST of Cystinosin homolog-like Protein vs. Planmine SMEST
Match: SMESG000027570.1 (SMESG000027570.1)

HSP 1 Score: 127.487 bits (319), Expect = 1.296e-34
Identity = 63/84 (75.00%), Postives = 72/84 (85.71%), Query Frame = 3
Query:  630 IFSSHYHHQSNGQIERQFRTLKNWISC-LEEKQFKTLEEALPQIEFEINSTIQSSIKVSLAEVVYGRKVYKEHFKIGTETNNKE 878
            + SS +H+QSNGQIERQFRTL++WISC LEEKQFKT EEALP IEF INS++QSSIKVS AEVVYGRK+ KE F  GTE NNK+
Sbjct:   12 VHSSPFHYQSNGQIERQFRTLRDWISCCLEEKQFKTWEEALPHIEFAINSSMQSSIKVSPAEVVYGRKLCKERFTYGTEANNKK 95          
The following BLAST results are available for this feature:
BLAST of Cystinosin homolog-like Protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CTNS3.206e-2561.33cystinosin, lysosomal cystine transporter [Source:... [more]
CTNS6.691e-2452.69cystinosin, lysosomal cystine transporter [Source:... [more]
CTNS7.076e-2461.33cystinosin, lysosomal cystine transporter [Source:... [more]
CTNS7.568e-2361.33cystinosin, lysosomal cystine transporter [Source:... [more]
CTNS7.568e-2361.33cystinosin, lysosomal cystine transporter [Source:... [more]
back to top
BLAST of Cystinosin homolog-like Protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ctns-16.076e-2869.23Cystinosin homolog [Source:UniProtKB/Swiss-Prot;A... [more]
ctns-19.215e-2869.23Cystinosin homolog [Source:UniProtKB/Swiss-Prot;A... [more]
back to top
BLAST of Cystinosin homolog-like Protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG171198.125e-2866.67gene:FBgn0039045 transcript:FBtr0084357[more]
CG171198.125e-2866.67gene:FBgn0039045 transcript:FBtr0344299[more]
back to top
BLAST of Cystinosin homolog-like Protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ctns5.053e-3260.42cystinosin, lysosomal cystine transporter [Source:... [more]
CABZ01030006.17.717e-739.19pep scaffold:GRCz11:KN150258.1:33006:36502:-1 gene... [more]
back to top
BLAST of Cystinosin homolog-like Protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
klhl243.459e-2770.67kelch like family member 24 [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of Cystinosin homolog-like Protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ctns3.882e-2260.00cystinosis, nephropathic [Source:MGI Symbol;Acc:MG... [more]
Ctns3.882e-2260.00cystinosis, nephropathic [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Cystinosin homolog-like Protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VCR7|CTNS_DROME8.144e-2766.67Cystinosin homolog OS=Drosophila melanogaster OX=7... [more]
sp|Q09500|CTNS_CAEEL1.172e-2669.23Cystinosin homolog OS=Caenorhabditis elegans OX=62... [more]
sp|A8WN56|CTNS_CAEBR7.544e-2665.38Cystinosin homolog OS=Caenorhabditis briggsae OX=6... [more]
sp|A7MB63|CTNS_BOVIN1.204e-2261.33Cystinosin OS=Bos taurus OX=9913 GN=CTNS PE=2 SV=1[more]
sp|O60931|CTNS_HUMAN3.634e-2261.33Cystinosin OS=Homo sapiens OX=9606 GN=CTNS PE=1 SV... [more]
back to top
BLAST of Cystinosin homolog-like Protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2S2NF294.977e-3163.92Cystinosin (Fragment) OS=Schizaphis graminum OX=13... [more]
A0A2S2NG501.662e-3064.89Cystinosin OS=Schizaphis graminum OX=13262 GN=g.11... [more]
A0A0B6XXL73.702e-3063.44Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
A0A1J1HME62.794e-2968.89CLUMA_CG002366, isoform A OS=Clunio marinus OX=568... [more]
A0A1L8DDP26.694e-2972.15Putative cystine transporter cystinosin (Fragment)... [more]
back to top
BLAST of Cystinosin homolog-like Protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ctns2.050e-2960.67cystinosin, lysosomal cystine transporter [Source:... [more]
ctns2.050e-2960.67cystinosin, lysosomal cystine transporter [Source:... [more]
back to top
BLAST of Cystinosin homolog-like Protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cystinosin homolog-like Protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cystinosin homolog-like Protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO468945.506e-2972.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349876.038e-1438.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO315716.717e-1443.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cystinosin homolog-like Protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ctns4.282e-3073.33cystinosin, lysosomal cystine transporter [Source:... [more]
back to top
BLAST of Cystinosin homolog-like Protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079054.19.894e-5898.98SMESG000079054.1[more]
SMESG000080238.13.485e-5376.79SMESG000080238.1[more]
SMESG000034332.17.165e-4571.67SMESG000034332.1[more]
SMESG000058507.14.836e-4059.02SMESG000058507.1[more]
SMESG000027570.11.296e-3475.00SMESG000027570.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020423 ID=SMED30020423|Name=Cystinosin homolog-like Protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2235bp
ATTTTTGTTTATTCTGGGTCGAGTTGTCTCACTTTTGAATGTACTGGATT
GCCATATGTGATGATTGCGTGTTCTGTTGTGCGGATTGAATTTTCATCAA
ATTTTACCGGTTCTGTTATTTTGTCGTATTTTTTAGTATTGCTGTTATTT
CTGGGCCATGGCCGATTATTCTGGTTTGTTTATTGTTTCGCGTATCAGTC
TGGATTACTCCGATATCAATTTATATGCAGTGCATTGGTTTTCTTTGATT
GGTTTTATGATTCTGCTCTTGGATTGTCCTTAATTGTCTTTCTATCTATC
TATTTGTTTGATGATGATATGGACTTACAAAACAACTTAATACCTAGCTT
CTTTGTGAATTCTTTGATTCCTGATTTGAACGCCTTCCCGAAATCAATTT
TTATATCCTTTTGTCAACTAAATCTCAAAATCTAATAATTGACCATTTTA
GTAAATACATAGTTAGTTCTAAAAGCAGTAAGAAAGCAGGGTGAAAAAAC
GCTTTTCAACAATGTGTTAAGTTCGTGTATTTTGAAATTTGTTCCACTGA
AAGAAATTTACTTTGATAAAAGAAAATGTTTTGATTCGAATAGTTTTAGG
AACAGGGCACTAAAATATCAAATGAAGATATTTTTTCAAGCCATTATCAT
CATCAATCCAATGGCCAAATTGAAAGACAATTTCGAACACTGAAAAACTG
GATTTCTTGTTTGGAAGAAAAACAATTTAAGACATTGGAAGAAGCATTAC
CTCAAATAGAGTTTGAAATTAATTCAACAATTCAATCAAGTATAAAAGTT
AGTCTAGCTGAAGTAGTTTATGGAAGAAAAGTGTATAAAGAGCATTTTAA
AATTGGTACAGAAACTAACAATAAAGAATCAAGAAAAAATGAAATTTTAA
TTAATATCAAATCTGTTAATCGTATAAATAACTATAATCAAGAAAATAGA
ACTCATAGATCTTTTTGTGTTGGAGAATTTGTACTCGTCAGGGAAGTTGT
TAGAAATAAAAAAGACAATAGATATTGTGGTCTATTTTAAATAATAGAAA
AAGATTAAAAAAATTATTATTTGTTGAAGGATTTAAATGGAAAATTTCTG
AAAAGAAATGTAGAATGACTAAAGCCATTTTAAGCGAGGGGTGGGGTGTA
ATTGTATTAGTATAATTGATATCCCTGTCTCTTATTTAATCTTAATACAC
TAGATATTTTTTACGATCCCTTTCATCTATTATATTCTAGGAAAATTGTC
ATCGGAAAGTTCAAATGTCAGAGCAAGGTCGTTTTAAGCCTCAAAGTGTT
ATAGTTTATTGAGGGAATAAAATTAAAATGAAGGCTTAAGGGGCAAAATT
ACCATATTATTTCTGTACCACAGTTTAGTATATAAACCAAGAATCACCAT
TTTTCACGTTTAAAGATTTAATAACAAATAACGATGACAAGCGCACTTAA
GCAAGAAAAATGCTAGTCTTCCATTTGAAAATTAATTAGGTGTTGATCTT
TTTATGATGATTATTGAATGTTTGATAAACTGGATCCAGGTAATGTCAAT
TTTTAATTATGTATAATAAAGATTATTGAAGAGATTATTGTGTGGGAAAT
TATTTTTATTTGTATAACGATAGTTAATTACAATTTCTATTTTTATATAT
GGTTACTAATATTTTGATTAGTATAGTGATAAATACCTTATCTTTAGGTA
CATAAGGAAATTATTATTTTGATTTAAAGCTGTTATGAACTACAGAAGGA
AAAGCACTGTTGGATGGAGTATTGGGAATATATTTTTGGATTTTACAGGC
GGATTTCTTAGCATTGTTCAAATGATAATTCTTTCATACAATAACAATGA
TTGGAGAAGTTTTTTTGCAGATCCCACAAAATTTGGCTTGGGCCTGTTCT
CAATATTCTTTGACATTTTATTCGTGGTTCAACACTATGTGTTGTATCGT
GGTGCTGAACCTATAATTTATGCAGTTTTTGAAAATGATGACGAGTTGCG
TTCAACAAGTAGCATAAAATAAAGATAATAGATTCATGTGATATTGTGAA
ATATTTTAATTTTTATAATATTGTTTATAACATAAAGTATTTGATAGTTA
ATTGTATCAAATACTTTTATGGATTTCATAATAGTTTATCCAATAGATTT
TGTTTTAGAAAATGGTTAATTTAACATTACCAAGATTTCAAATTTCAGCA
TTTGTAAGAGTTTAAATTAAATAAAAATAATTTGA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR006603PQ-loop_rpt
IPR012337RNaseH-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane