slc15a-8

Overview
Nameslc15a-8 (AKN21494.1)
Smed IDSMED30020421
Length (bp)2098
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc15a-8 (SMED30020421) t-SNE clustered cells

Violin plots show distribution of expression levels for slc15a-8 (SMED30020421) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc15a-8 (SMED30020421) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc15a-8 (SMED30020421) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020421

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30020421SMESG000009956.1 dd_Smed_v4_11818_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020421SMESG000009956.1 dd_Smed_v4_11818_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30020421SMESG000033891.1 dd_Smed_v4_12826_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020421SMESG000033891.1 dd_Smed_v4_12826_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30020421SMESG000033891.1 dd_Smed_v4_12826_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc15a-8 vs. Ensembl Human
Match: SLC15A4 (solute carrier family 15 member 4 [Source:HGNC Symbol;Acc:HGNC:23090])

HSP 1 Score: 73.1738 bits (178), Expect = 9.597e-13
Identity = 76/258 (29.46%), Postives = 127/258 (49.22%), Query Frame = 2
Query:  791 PYGICDSQTRFAYQYQSNHMKIPNWNGSLSSLTRKSNFWPITLNCLTVILAYFVLILLKEMNKS-----QFIQMLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKY--LGIALFLAADGSGGFSDLFFTI------YTFYHESLENDLNNCHLDYIYFGLAGVAFFSWIISIILINRFPHRFTIVQSQKN 1525
            PY     Q +  Y  QS H++IP     +S++T   +  P     LT+  A  +L+L+   +K      +   +L SS+K +I  G   ++ S    GILE  RLN+      K +     + NQTIGN+ Y AADL+++  VPQ +L GISE+  +   +EF Y  + KS++   +G+  F +  GS   S L   +      +   H    N +N C+L+Y +F LA +   + ++ +I+  ++ H     +S+ N
Sbjct:  330 PYWTVYFQMQTTYVLQSLHLRIPE----ISNITTTPHTLPAAW--LTMFDAVLILLLIPLKDKLVDPILRRHGLLPSSLK-RIAVGMFFVMCSAFAAGILESKRLNLV-----KEK-----TINQTIGNVVYHAADLSLWWQVPQYLLIGISEIFASIAGLEFAYSAAPKSMQSAIMGLFFFFSGVGSFVGSGLLALVSIKAIGWMSSHTDFGN-INGCYLNYYFFLLAAIQGATLLLFLIISVKYDHHRDHQRSRAN 569          
BLAST of slc15a-8 vs. Ensembl Human
Match: SLC15A3 (solute carrier family 15 member 3 [Source:HGNC Symbol;Acc:HGNC:18068])

HSP 1 Score: 58.9214 bits (141), Expect = 5.798e-9
Identity = 39/152 (25.66%), Postives = 76/152 (50.00%), Query Frame = 2
Query: 1052 STTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAADGSG-----GFSDLFFTIYTFYHESLE-NDLNNCHLDYIYFGLAGVAFFSWIISIILINRF 1489
            S  + G+LE+ RL+ Y  ++         + +Q IG + Y AA L+++  +PQ +L GISE+  +   +EF Y ++ +S++   + +F    G G         L      + H   +  ++NNC +D  +F LAG+   + ++ + +  R+
Sbjct:   87 SVIVAGVLEMERLH-YIHHN--------ETVSQQIGEVLYNAAPLSIWWQIPQYLLIGISEIFASIPGLEFAYSEAPRSMQGAIMGIFFCLSGVGSLLGSSLVALLSLPGGWLHCPKDFGNINNCRMDLYFFLLAGIQAVTALLFVWIAGRY 229          
BLAST of slc15a-8 vs. Ensembl Human
Match: SLC15A3 (solute carrier family 15 member 3 [Source:HGNC Symbol;Acc:HGNC:18068])

HSP 1 Score: 59.3066 bits (142), Expect = 1.979e-8
Identity = 44/170 (25.88%), Postives = 83/170 (48.82%), Query Frame = 2
Query:  998 LFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAADGSG---GFS--DLFFTIYTFYHESLE-NDLNNCHLDYIYFGLAGVAFFSWIISIILINRF 1489
            L  S   ++  G      S  + G+LE+ RL+ Y  ++         + +Q IG + Y AA L+++  +PQ +L GISE+  +   +EF Y ++ +S++   + +F    G G   G S   L      + H   +  ++NNC +D  +F LAG+   + ++ + +  R+
Sbjct:  403 LLPSALQKMALGMFFGFTSVIVAGVLEMERLH-YIHHN--------ETVSQQIGEVLYNAAPLSIWWQIPQYLLIGISEIFASIPGLEFAYSEAPRSMQGAIMGIFFCLSGVGSLLGSSLVALLSLPGGWLHCPKDFGNINNCRMDLYFFLLAGIQAVTALLFVWIAGRY 563          
BLAST of slc15a-8 vs. Ensembl Zebrafish
Match: slc15a4 (solute carrier family 15 member 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1047])

HSP 1 Score: 68.9366 bits (167), Expect = 1.034e-11
Identity = 70/242 (28.93%), Postives = 111/242 (45.87%), Query Frame = 2
Query:  791 PYGICDSQTRFAYQYQSNHMKIPNWNGSLSSLTRKSNFWPITLNCLTVILAYFVLILLKEMNKS-----QFIQMLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAAD------GSG--GFSDLFFTIYTFYHESLENDLNNCHLDYIYFGLAGVAFFSWIISIIL 1477
            PY     Q +  Y  QS H+ IP      +S     N +      LT+  A  +L+L+   +K      +   +L SS+K +I  G   ++ S    GILE  RL+I  +  P   IP      Q++G + Y AADL ++  VPQ VL G+SE+  +   +EF Y  + +S++   + LF          GSG      L    +   H+   N +N C L+Y +F LA +   + +I +I+
Sbjct:  329 PYWTVYFQMQTTYYLQSLHLTIPG--ADPNSTDSHPNTFRFPAAWLTMFDAVLILMLIPLKDKVVDPILKRKGLLPSSLK-RIAVGMFFVMCSAVAAGILETKRLDIVRTRGP---IP------QSLGGVIYYAADLPIWWQVPQYVLIGVSEIFASIAGLEFAYSAAPRSMQSAIMGLFFFFSGIGSFVGSGLLAIVSLKAIGWMSSHQDFGN-INECRLNYYFFLLAAIQGITLLIFLIV 557          
BLAST of slc15a-8 vs. Ensembl Xenopus
Match: slc9a3r1 (SLC9A3 regulator 1 [Source:Xenbase;Acc:XB-GENE-487362])

HSP 1 Score: 63.929 bits (154), Expect = 5.980e-10
Identity = 78/261 (29.89%), Postives = 118/261 (45.21%), Query Frame = 2
Query:  791 PYGICDSQTRFAYQYQSNHMKIP---NWNGSLSSLTRKSNFWPITLNCLTVILAYFVLIL--LKEMNKSQFIQ---MLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAAD------GSG--GFSDLFFTIYTFYHESLENDLNNCHLDYIYFGLAGVAFFSWIISIILINRFPHRFTIVQSQKN 1525
            PY     Q +  Y  QS H+KIP   N N +L +       W      LT+  A  +LIL  LK+     F++   +L S +K +I  G   ++ S    GILE  RL I  +              Q IG +TY AA+L V+  +PQ +L GISE+  +   +EF Y  + KS++   + LF          GSG      +    +   H  L N +N C L+Y +F LA V   + I+ +I+  ++  +    QS+ N
Sbjct:  335 PYWTVYFQMQTTYVLQSLHLKIPPIFNNNHTLPAA------W------LTMFDAVLILILIPLKDKMVDPFLKKRGLLPSPLK-RIAVGMFFVMCSVLAAGILESKRLEIVKNDK----------IQQQIGGVTYYAANLAVWWQLPQYILIGISEIFASIAGLEFAYSAAPKSMQSAIMGLFFFFSGIGSFVGSGLLALVSIPQIGWMSNHSDLGN-INGCTLNYYFFLLAAVQAATLILFLIISVKYERQ----QSRAN 567          
BLAST of slc15a-8 vs. Ensembl Mouse
Match: Slc15a4 (solute carrier family 15, member 4 [Source:MGI Symbol;Acc:MGI:2140796])

HSP 1 Score: 74.3294 bits (181), Expect = 2.413e-13
Identity = 72/231 (31.17%), Postives = 107/231 (46.32%), Query Frame = 2
Query:  791 PYGICDSQTRFAYQYQSNHMKIPNWNGSLSSLTRKSNFWPITLNCLTVILAYFVLILLKEMNKS-----QFIQMLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAAD------GSG--GFSDLFFTIYTFYHESLENDLNNCHLDYIYFGLAGV 1444
            PY     Q +  Y  QS H+KIP     +SS+T   +  P     LT+  A  +L+L+   +K      +   +L SS+K +I  G   ++ S    GILE  RL++              + NQTIG + Y AADL ++  +PQ VL GISE+  +   +EF Y  + KS++   + LF          GSG      L    +   H    N +N+CHL Y +F LA +
Sbjct:  331 PYWTVYFQMQTTYALQSLHLKIPE----ISSITTTHHTLPAAW--LTMFDAVLILLLIPLKDKLVDPVLRRHGLLPSSLK-RIAVGMFFVMCSAFAAGILESKRLDLV----------KEKTINQTIGGVVYHAADLPIWWQIPQYVLIGISEIFASIAGLEFAYSAAPKSMQSAIMGLFFFFSGIGSFVGSGLLALVSLKAIGWMSSHTDFGN-INSCHLHYYFFLLAAI 543          
BLAST of slc15a-8 vs. Ensembl Mouse
Match: Slc15a3 (solute carrier family 15, member 3 [Source:MGI Symbol;Acc:MGI:1929691])

HSP 1 Score: 65.0846 bits (157), Expect = 1.945e-10
Identity = 67/262 (25.57%), Postives = 114/262 (43.51%), Query Frame = 2
Query:  791 PYGICDSQTRFAYQYQSNHMKIPN---WNGSLSSLTRK--SNFWPITLNCLTVILAYFVLILLKEMNKSQFIQMLFSSIKL------QIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAAD------GSGGFSDLFFTIYTFYHESLENDLNNCHLDYIYFGLAGVAFFSWIISIILINRFPHRFTIVQSQKN 1525
            PY +   Q +  Y  Q  H+ IPN    N ++S L R   SN+    +    ++LA   +IL+    K   I  L    KL      ++  G      S  + G+LE  RL           I +  +  Q IG   Y AA L+++  +PQ +L G+SE+  +   +EF Y ++ +S++   + +F          GSG  + L F     Y      ++NNC +D  +F LAG+   + ++ + +  R+        SQ++
Sbjct:  323 PYWMVYFQMQSTYVLQGLHLHIPNIFRTNPNISLLLRSDSSNY---RIPEAWLLLANVAVILILIPVKDHLIDPLLLRCKLLPSSLQKMALGMFFGFTSIIVAGVLEKERLQY---------IAANQTVPQLIGKDLYYAAPLSIWWQIPQYLLIGVSEIFASIPGLEFAYSEAPRSMQGAIMGIFFCLSGVGSLLGSGLVALLSFPGGWMYCPKDFGNINNCQMDRYFFLLAGIEAVTAVLFLWIAGRYERTRQDPASQRS 572          
BLAST of slc15a-8 vs. UniProt/SwissProt
Match: sp|Q91W98|S15A4_MOUSE (Solute carrier family 15 member 4 OS=Mus musculus OX=10090 GN=Slc15a4 PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.688e-12
Identity = 72/231 (31.17%), Postives = 107/231 (46.32%), Query Frame = 2
Query:  791 PYGICDSQTRFAYQYQSNHMKIPNWNGSLSSLTRKSNFWPITLNCLTVILAYFVLILLKEMNKS-----QFIQMLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAAD------GSG--GFSDLFFTIYTFYHESLENDLNNCHLDYIYFGLAGV 1444
            PY     Q +  Y  QS H+KIP     +SS+T   +  P     LT+  A  +L+L+   +K      +   +L SS+K +I  G   ++ S    GILE  RL++              + NQTIG + Y AADL ++  +PQ VL GISE+  +   +EF Y  + KS++   + LF          GSG      L    +   H    N +N+CHL Y +F LA +
Sbjct:  331 PYWTVYFQMQTTYALQSLHLKIPE----ISSITTTHHTLPAAW--LTMFDAVLILLLIPLKDKLVDPVLRRHGLLPSSLK-RIAVGMFFVMCSAFAAGILESKRLDLV----------KEKTINQTIGGVVYHAADLPIWWQIPQYVLIGISEIFASIAGLEFAYSAAPKSMQSAIMGLFFFFSGIGSFVGSGLLALVSLKAIGWMSSHTDFGN-INSCHLHYYFFLLAAI 543          
BLAST of slc15a-8 vs. UniProt/SwissProt
Match: sp|O09014|S15A4_RAT (Solute carrier family 15 member 4 OS=Rattus norvegicus OX=10116 GN=Slc15a4 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 3.805e-12
Identity = 73/231 (31.60%), Postives = 108/231 (46.75%), Query Frame = 2
Query:  791 PYGICDSQTRFAYQYQSNHMKIPNWNGSLSSLTRKSNFWPITLNCLTVILAYFVLILLKEMNKS-----QFIQMLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAAD------GSG--GFSDLFFTIYTFYHESLENDLNNCHLDYIYFGLAGV 1444
            PY     Q +  Y  QS H+KIP     +SS+T   +  P     LT+  A  +L+L+   +K      +   +L SS+K +I  G   +  S    GILE  RL++      K +     + NQTIG + Y AADL ++  +PQ VL GISE+  +   +EF Y  + KS++   + LF          GSG      L    +   H    N +N+CHL Y +F LA +
Sbjct:  329 PYWTVYFQMQTTYVLQSLHLKIPE----ISSITTTHHTLPAAW--LTMFDAVLILLLIPLKDKLVDPVLRRHGLLPSSLK-RIAVGMFFVTCSAFAAGILESKRLDLV-----KEK-----TINQTIGGVVYHAADLPIWWQIPQYVLIGISEIFASIAGLEFAYSAAPKSMQSAIMGLFFFFSGIGSFVGSGLLALVSLKAIGWMSSHTDFGN-INSCHLHYYFFLLAAI 541          
BLAST of slc15a-8 vs. UniProt/SwissProt
Match: sp|Q8N697|S15A4_HUMAN (Solute carrier family 15 member 4 OS=Homo sapiens OX=9606 GN=SLC15A4 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 4.609e-12
Identity = 76/258 (29.46%), Postives = 127/258 (49.22%), Query Frame = 2
Query:  791 PYGICDSQTRFAYQYQSNHMKIPNWNGSLSSLTRKSNFWPITLNCLTVILAYFVLILLKEMNKS-----QFIQMLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKY--LGIALFLAADGSGGFSDLFFTI------YTFYHESLENDLNNCHLDYIYFGLAGVAFFSWIISIILINRFPHRFTIVQSQKN 1525
            PY     Q +  Y  QS H++IP     +S++T   +  P     LT+  A  +L+L+   +K      +   +L SS+K +I  G   ++ S    GILE  RLN+      K +     + NQTIGN+ Y AADL+++  VPQ +L GISE+  +   +EF Y  + KS++   +G+  F +  GS   S L   +      +   H    N +N C+L+Y +F LA +   + ++ +I+  ++ H     +S+ N
Sbjct:  330 PYWTVYFQMQTTYVLQSLHLRIPE----ISNITTTPHTLPAAW--LTMFDAVLILLLIPLKDKLVDPILRRHGLLPSSLK-RIAVGMFFVMCSAFAAGILESKRLNLV-----KEK-----TINQTIGNVVYHAADLSLWWQVPQYLLIGISEIFASIAGLEFAYSAAPKSMQSAIMGLFFFFSGVGSFVGSGLLALVSIKAIGWMSSHTDFGN-INGCYLNYYFFLLAAIQGATLLLFLIISVKYDHHRDHQRSRAN 569          
BLAST of slc15a-8 vs. UniProt/SwissProt
Match: sp|A6QQL0|S15A4_BOVIN (Solute carrier family 15 member 4 OS=Bos taurus OX=9913 GN=SLC15A4 PE=2 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 1.829e-11
Identity = 72/231 (31.17%), Postives = 112/231 (48.48%), Query Frame = 2
Query:  791 PYGICDSQTRFAYQYQSNHMKIPNWNGSLSSLTRKSNFWPITLNCLTVILAYFVLILLKEMNKS-----QFIQMLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKY--LGIALFLAADGSGGFSDLFFTI------YTFYHESLENDLNNCHLDYIYFGLAGV 1444
            PY     Q +  Y  QS H+KIP     +SS+T   + +P     LT+  A  +L+L+   +K      +   +L SS+K +I  G   ++ S    GILE  RL++              + NQTIGN+ Y AADL ++  VPQ VL G+SE+  +   +EF Y  + KS++   +G+  F +  GS   S L   +      +   H    N +N C+L+Y +F LA +
Sbjct:  323 PYWTVYFQMQTTYVLQSLHLKIPE----ISSITTNPHTFPAAW--LTMFDAVLILLLIPLKDKLVDPILKRNGLLPSSLK-RIAVGMFFVMCSAFAAGILESKRLDLV----------KEKTINQTIGNVVYYAADLPIWWQVPQYVLIGVSEIFASIAGLEFAYSAAPKSMQSAIMGLFFFFSGVGSFVGSGLLALVSLKAIGWMSSHTDFGN-INGCYLNYYFFLLAAI 535          
BLAST of slc15a-8 vs. UniProt/SwissProt
Match: sp|Q68F72|S15A4_XENLA (Solute carrier family 15 member 4 OS=Xenopus laevis OX=8355 GN=slc15a4 PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 7.650e-10
Identity = 79/263 (30.04%), Postives = 121/263 (46.01%), Query Frame = 2
Query:  791 PYGICDSQTRFAYQYQSNHMKIP---NWNGSLSSLTRKSNFWPITLNCLTVILAYFVLIL--LKEMNKSQFIQ---MLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAAD------GSG--GFSDLFFTIYTFYHESLENDLNNCHLDYIYFGLAGVAFFSWIISIILINRFPHRFTIVQSQKNYE 1531
            PY     Q +  Y  QS H++IP   N N +L +       W      LT+  A  +LIL  LK+     F++   +L S +K +I  G   ++ S    GILE  RL I      + +I       Q IGN+TY AA+LTV+  +PQ +L GISE+  +   +EF Y  + KS++ + + LF          GSG      +    +   H  L N +N C L+Y +F LA V   + ++ +I+  ++       Q  K Y 
Sbjct:  334 PYWTVYFQMQTTYVLQSLHLRIPQIFNNNHTLPAA------W------LTMFDAVLILILIPLKDKLVDPFLKKRGLLPSPLK-RIAVGMFFVMCSVLAAGILESERLEIV----KRDKI------QQQIGNVTYYAANLTVWWQLPQYILIGISEIFASIAGLEFAYSAAPKSMQSVIMGLFFFFSGIGSFVGSGLLALVSIPQIGWMSNHSDLGN-INGCTLNYYFFLLAAVQAATLLLFLIISVKYER-----QQSKTYR 567          
BLAST of slc15a-8 vs. TrEMBL
Match: A0A0H3YJ38 (Slc15a-8 OS=Schmidtea mediterranea OX=79327 GN=slc15a-8 PE=2 SV=1)

HSP 1 Score: 858.981 bits (2218), Expect = 0.000e+0
Identity = 486/486 (100.00%), Postives = 486/486 (100.00%), Query Frame = 2
Query:   77 MNFQRNISXXXXXXXXXXIYTAFLHVQVNIQAGSLVSSFPKYTNVLLVAIESSSVLLIGLLATFVFPVYFXXXXXXXXXXXXXXFFTAVAFLNNTKDIQLRLNLGGIIMFGIFYGTFRLLLLCMILDQEQSHFIKRKIIGWLGVINFSFILVYMIPSPIQHPNLMLFPVXXXXXXXXXXXXXXXRKIYAVDSNIVNVFQLMKRFNWSEELLISEADINDSERNXXXXXXXXXXXXXXXPYGICDSQTRFAYQYQSNHMKIPNWNGSLSSLTRKSNFWPITLNCLTVILAYFVLILLKEMNKSQFIQMLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAADGSGGFSDLFFTIYTFYHESLENDLNNCHLDYIYFGLAGVAFFSWIISIILINRFPHRFTIVQSQKNYES 1534
            MNFQRNISFVFLLVVYFFIYTAFLHVQVNIQAGSLVSSFPKYTNVLLVAIESSSVLLIGLLATFVFPVYFLLIISLSSLMIGISFFTAVAFLNNTKDIQLRLNLGGIIMFGIFYGTFRLLLLCMILDQEQSHFIKRKIIGWLGVINFSFILVYMIPSPIQHPNLMLFPVSFSIIGIILLFFGKFRKIYAVDSNIVNVFQLMKRFNWSEELLISEADINDSERNLISISKSIIFFFLLIPYGICDSQTRFAYQYQSNHMKIPNWNGSLSSLTRKSNFWPITLNCLTVILAYFVLILLKEMNKSQFIQMLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAADGSGGFSDLFFTIYTFYHESLENDLNNCHLDYIYFGLAGVAFFSWIISIILINRFPHRFTIVQSQKNYES
Sbjct:    1 MNFQRNISFVFLLVVYFFIYTAFLHVQVNIQAGSLVSSFPKYTNVLLVAIESSSVLLIGLLATFVFPVYFLLIISLSSLMIGISFFTAVAFLNNTKDIQLRLNLGGIIMFGIFYGTFRLLLLCMILDQEQSHFIKRKIIGWLGVINFSFILVYMIPSPIQHPNLMLFPVSFSIIGIILLFFGKFRKIYAVDSNIVNVFQLMKRFNWSEELLISEADINDSERNLISISKSIIFFFLLIPYGICDSQTRFAYQYQSNHMKIPNWNGSLSSLTRKSNFWPITLNCLTVILAYFVLILLKEMNKSQFIQMLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAADGSGGFSDLFFTIYTFYHESLENDLNNCHLDYIYFGLAGVAFFSWIISIILINRFPHRFTIVQSQKNYES 486          
BLAST of slc15a-8 vs. TrEMBL
Match: A0A0H3YK61 (Slc15a-7 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc15a-7 PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.294e-33
Identity = 136/415 (32.77%), Postives = 221/415 (53.25%), Query Frame = 2
Query:  140 AFLHVQVNIQAGSLVSSFPKYTNVLLVAIESSSVLLIGLLATFVFPVYFXXXXXXXXXXXXXXFFTAVA-FLNNTKDIQLRLNLGGIIMFGIFYGTFRLLLLCMILDQEQSHFIKRKIIGWLGVINFSFILVYMIPSPIQHP----NLMLFPVXXXXXXXXXXXXXXXRKIYAVDSNIVNVFQLMKRFNWS------EELLISEADINDSERNXXXXXXXXXXXXXXXPYGICDSQTRFAYQYQSNHMKIPNWNGSLSSLTRKSNFWPITLNCLTVILAYFVLILLKEMNKSQFIQMLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAADGSGGFSDL 1351
            AF  +++NI       S+P YT ++LV ++  +++L G+LATF+    +         +    F   V   L  T      L     ++ G+ +G F+ + L  ++DQ    +IK  +  +L   +  +++VY             NL    ++ +  G IL+  G F K++  D+ ++ ++ +++ F         +  +++  +  D  + +ISISKS+I FFLLIPYGICDSQ  +AY++QSN +   N    L     KSNFW  T++  TV+    +L  ++  N+++F   ++S+IK +II GN LMI+ST I G LE +RL++ W+ +     P+    N  I N TY   D++VF MVPQ +L   SEV+I  TCIE++  +S+KS KYL I L  +A   GG SDL
Sbjct:   33 AFQFIKLNINT----MSYP-YTAMILVLVDCGTLILGGMLATFLIRAQY------LFYLSIGCFVIGVPILLFKTPFTDPTLYWVTHVLIGLSFGLFKFIYLVALIDQNDRRYIKFIVAFFLFTESICYLIVYTFTPNTDTVEKIWNLNYARLALAGFGAILVVIGCFLKLFEKDTEVIELYGIIQFFRQRRFAGNLDHSILNNTETVDFRKVIISISKSVIVFFLLIPYGICDSQEFYAYEFQSNSLNQSN----LLFNHFKSNFWCNTISAFTVMATLLILFAVRFCNENKF-DAIYSNIKTKIILGNSLMIISTLICGALETYRLSMLWTDNNSTLTPNYK--NVIIDNTTYHVVDISVFWMVPQNILLSFSEVLIVPTCIEYVIDKSEKSTKYLSIVLVFSAVNIGGISDL 429          
BLAST of slc15a-8 vs. TrEMBL
Match: K1RF99 (Solute carrier family 15 member 4 OS=Crassostrea gigas OX=29159 GN=CGI_10015896 PE=4 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.061e-14
Identity = 75/259 (28.96%), Postives = 118/259 (45.56%), Query Frame = 2
Query:  791 PYGICDSQTRFAYQYQSNHMKIPNWNGSLSSLTR---KSNFWPITLNCLTVILAYFVL-------ILLKEMNKSQFIQM----LFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIK---------YLGIALFLAADGSGGFSDLFFTIYTFYHESLENDLNN-------CHLDYIYFGLAGVAFFSWIISIIL 1477
            PY +   Q +  ++ Q  HMK+   N     +      S++ P +    T++ A+F L       ILL   ++  +  +    +   I  +I  G +   ++  + GI+ELFRL   W + P     S Y+ NQTIG+  Y+AAD++VF  +PQ  L GISEV  +   +EF Y+ + KS+K         + GI   L       F D +F    F + +     N        CHLDY +F LA + F    + II+
Sbjct:  345 PYWMVYFQMQTTFELQGLHMKLDISNVEKYKICHDMNSSSYSPESTKKSTLVAAWFSLFDVVFLIILLPLFDRVIYPYLKKRDMHVGIVCRISVGMMFATIAVLVAGIVELFRLRAVWKF-PNEECCS-YTINQTIGHTVYRAADMSVFWQIPQYALIGISEVFTSVAALEFAYQMAPKSMKGIIMGFFYLFTGIGSLLGTGTMFAFKDTWFFQEDFGNINCRMGCNTTGTFTKACHLDYYFFFLAVLEFTGMFVFIIV 601          
BLAST of slc15a-8 vs. TrEMBL
Match: A0A3Q0G0K3 (solute carrier family 15 member 4 isoform X2 OS=Alligator sinensis OX=38654 GN=SLC15A4 PE=4 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 7.083e-13
Identity = 71/248 (28.63%), Postives = 119/248 (47.98%), Query Frame = 2
Query:  791 PYGICDSQTRFAYQYQSNHMKIPNWNGSLSSLTRKSNFWPITLNCLTVILAYFVLILLKEMNKS-----QFIQMLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAAD------GSGGFSDLFFTIYTFYHESLE-NDLNNCHLDYIYFGLAGVAFFSWIISIILINRFPHR 1498
            PY     Q +  Y  QS H+KIP  + + + +      W      LT+  A  +LIL+   +K      +   +L SS+K +I  G   ++ S    GILE +RL          ++  + + NQTIGN+TY AADL V+  VPQ VL G SE+  +   +EF Y  + KS++   + LF          GSG  + +      +     +  ++N C+L+Y +F LA +   + ++ +I+  ++ H+
Sbjct:   33 PYWTVYFQMQTTYVLQSLHLKIPEISNATNPIHTFPAAW------LTMFDAVLILILIPVKDKLVDPVLKRHGLLPSSLK-RIAVGMFFVMCSAFAAGILESYRL----------KMVKVKTINQTIGNVTYHAADLPVWWQVPQYVLIGFSEIFASIAGLEFAYSAAPKSMQSAIMGLFFFFSGIGSFVGSGLLALVSIKAIGWMSNHTDFGNINGCYLNYYFFLLAAIQGATLLLFLIVSVKYDHQ 263          
BLAST of slc15a-8 vs. TrEMBL
Match: A0A2C9JM75 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106059735 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 7.875e-13
Identity = 55/182 (30.22%), Postives = 87/182 (47.80%), Query Frame = 2
Query: 1019 QIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAADGSGGF------SDLFFTIYTFYHESLEN-------------------DLNNCHLDYIYFGLAGVAFFSWIISIILINRF 1489
            +I+ G    +L+  +  I+E FRLN +W Y P     S    NQTIGN  Y+AAD+++   +PQ  L G+SEV  +   ++F    + KS+K +   L+    G G        S L ++   F  +   N                   D ++CHLDY ++ LAGV   + I+ +I+ N+F
Sbjct:   13 RILLGMFFAMLAMIVAAIVEHFRLNSFWPY-PDFPCQS-RGINQTIGNTVYQAADMSIVWQIPQYALIGVSEVFASVASLQFAVTVAPKSMKAVITGLYYFFSGVGSLLGTAIISTLSYSNTWFNSQDYGNINCRLPCNDSGHSNVTVYSDSDSCHLDYYFYLLAGVELLAMILFLIVANKF 192          
BLAST of slc15a-8 vs. Ensembl Cavefish
Match: slc15a4 (solute carrier family 15 member 4 [Source:NCBI gene;Acc:103028949])

HSP 1 Score: 73.559 bits (179), Expect = 3.395e-13
Identity = 71/230 (30.87%), Postives = 110/230 (47.83%), Query Frame = 2
Query:  791 PYGICDSQTRFAYQYQSNHMKIPNWNGSLS-SLTRKSNFWPITLNCLTVILAYFVLILLKEMNKSQFIQ---MLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAAD------GSG--GFSDLFFTIYTFYHESLENDLNNCHLDYIYFGLAGV 1444
            PY     Q +  Y  QS H++IP    +++ S T +  F    L     +L   +LI LK+      ++   +L SS+K +I  G   ++ S    GILE  RL I  S  P   I      +Q +G +TY AADL ++  +PQ VL GISE+  +   +EF Y  + +S++   + LF          GSG   F  + F  +   H+   N +N C L++ +F LAG+
Sbjct:  328 PYWTVYFQMQTTYYLQSLHLRIPGSEANVTDSQTMRFKFPAAWLTMFDAVL-ILMLIPLKDKLVDPILRRRGLLPSSLK-RIAVGMFFVMCSAVAAGILETKRLEIVNS--PHGVI------SQVLGGVTYYAADLPIWWQIPQYVLIGISEIFASIAGLEFAYSAAPRSMQSAIMGLFFFFSGIGSFVGSGLLAFVSVKFIGWMSSHKDFGN-INECKLNFYFFLLAGI 546          
BLAST of slc15a-8 vs. Ensembl Cavefish
Match: slc15a4 (solute carrier family 15 member 4 [Source:NCBI gene;Acc:103028949])

HSP 1 Score: 63.929 bits (154), Expect = 3.839e-10
Identity = 55/172 (31.98%), Postives = 85/172 (49.42%), Query Frame = 2
Query:  791 PYGICDSQTRFAYQYQSNHMKIPNWNGSLS-SLTRKSNFWPITLNCLTVILAYFVLILLKEMNKSQFIQ---MLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIK 1294
            PY     Q +  Y  QS H++IP    +++ S T +  F    L     +L   +LI LK+      ++   +L SS+K +I  G   ++ S    GILE  RL I  S  P   I      +Q +G +TY AADL ++  +PQ VL GISE+  +   +EF Y  + +S++
Sbjct:  328 PYWTVYFQMQTTYYLQSLHLRIPGSEANVTDSQTMRFKFPAAWLTMFDAVL-ILMLIPLKDKLVDPILRRRGLLPSSLK-RIAVGMFFVMCSAVAAGILETKRLEIVNS--PHGVI------SQVLGGVTYYAADLPIWWQIPQYVLIGISEIFASIAGLEFAYSAAPRSMQ 489          
BLAST of slc15a-8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005298.1 (pep scaffold:Pmarinus_7.0:GL477384:58393:77162:-1 gene:ENSPMAG00000004819.1 transcript:ENSPMAT00000005298.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.6178 bits (148), Expect = 5.888e-11
Identity = 63/223 (28.25%), Postives = 101/223 (45.29%), Query Frame = 2
Query:  812 QTRFAYQYQSNHMKIPN-WNGSLSSLTRKSNFWPITLNCLTVILAYFVLILLKEMNKSQFIQMLFSSIK----LQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAAD------GSGGFSDLFF-TIYTFYHESLENDLNNCHLDYIYFGLAGV 1444
            Q +  YQ QS H++IP  +N S S      NF        T+  A  +L  +   ++  F+ +     +    L++  G I  + S    G+LE  RLN         R+       Q IG+  Y+AA LTV+  +PQ +L G+SE++ +   +EF Y  + K ++   + LF          GSG  S +   +I           +N+CHLD+ +F LAG+
Sbjct:   10 QMQTTYQLQSLHLQIPKIFNTSSSGFPH--NF---PTAWFTLFDALLLLAFIPVADRVVFVWLARRGFRPSPVLRMAVGMIFSLSSAVAAGLLESERLN---------RVYRKEVVKQCIGHSEYEAARLTVWWQLPQFLLVGLSELLTSIGGLEFAYSAAPKHMQSAVMGLFFFFSGIGSFMGSGLLSLVSLPSIGWMDSHKDSGSINHCHLDFYFFLLAGI 218          
BLAST of slc15a-8 vs. Ensembl Nematostella
Match: EDO37372 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFZ9])

HSP 1 Score: 60.4622 bits (145), Expect = 1.341e-9
Identity = 52/192 (27.08%), Postives = 90/192 (46.88%), Query Frame = 2
Query:  926 LTVILAYFVLILLKEMNKSQFIQM----LFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAADGSGGFSDLFFTIYTFYHESLENDLNN-----CHLDYIYFGLAGVAFFSWIISII 1474
            LTV    FVL+L+  M+K  +  +    L  S+ ++I  G +  + +  + G +E  R N+            + + NQTI   T+ AADL++   +PQ  L G+SEV  +   +EF Y+++  S++   + LF      G  S L   +Y+F    L     +      HLD  +F L  +   SW++ ++
Sbjct:  332 LTVTDVIFVLLLIPVMDKLIYPWLDRRGLRVSVLMRISIGFLFAVAAMVVAGGVEYKRRNV----------EMLRTVNQTINQKTFIAADLSIMYQIPQYGLIGVSEVFASVGGLEFAYREAPPSMQSFVMGLFFFVQSIG--SLLGAALYSFAGHVLHWTTESFYTVGPHLDCYFFLLGAIMLVSWLVFVV 511          
BLAST of slc15a-8 vs. Ensembl Nematostella
Match: EDO33176 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSZ4])

HSP 1 Score: 59.6918 bits (143), Expect = 2.273e-9
Identity = 47/186 (25.27%), Postives = 93/186 (50.00%), Query Frame = 2
Query:  950 VLILLKEMNKSQFIQMLFSSIKL----QIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAADGSGGF-SDLFFTIYTFYHES-LENDLNNCHLDYIYFGLAGVAFFSWIISIILINRF 1489
            VL+L+  M+K  +  + +  ++     ++  G +    S  + G++E+ R  ++   D +    +++       N T+  +D+++F  VPQ +L G SEV  + T +EF Y Q+ + ++ L + +FL   G G + +     I T   +S    D N  HL+  +F LA +   ++II I++  R+
Sbjct:  361 VLLLIPLMDKVVYPLLRYCGVRFTPLRRVGVGMLFAAASVAVAGLVEIERKRMF--RDGQWHTSTMF-------NKTHNVSDMSIFYQVPQFMLIGTSEVFTSITGLEFAYSQAPRCLQGLVMGIFLVTSGLGNYLASALTNIVTSVDKSWYPTDPNTGHLENYFFLLAILMVANFIIYILVAMRY 537          
BLAST of slc15a-8 vs. Ensembl Medaka
Match: slc15a4 (solute carrier family 15 member 4 [Source:NCBI gene;Acc:101165813])

HSP 1 Score: 75.485 bits (184), Expect = 7.750e-14
Identity = 71/260 (27.31%), Postives = 122/260 (46.92%), Query Frame = 2
Query:  791 PYGICDSQTRFAYQYQSNHMKIPNWNGSLSSLTRKSNFWPITLNCLTVILAYFVLILLKEMNKS-----QFIQMLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAAD------GSGGFSDLFFTIYTFYHESLE-NDLNNCHLDYIYFGLAGVAFFSWIISIILINRFPHRFTIVQSQKNYES 1534
            PY     Q +  Y  Q  H++IP   G+ S++T +S+ +P     LT+  A  +L+L+   +K      +   +L SS+K +I  G   ++ S    GILE  RL I         + S  + NQ +GN+ Y  ADL ++  VPQ VL GISE+  +   +EF Y  + KS++   + LF          GSG  + +      +     +  ++N+C L Y +F LAG+   + ++ +I+  ++  +      Q    +
Sbjct:  319 PYWTVYFQMQTTYVLQGLHLRIP---GTSSNITTESHQFPAAW--LTMFDAVLILMLIPLKDKVVDPVLKRRGLLPSSLK-RIAVGMFFVMCSAVAAGILETKRLEI---------VKSNGTINQVLGNVIYYVADLPIWWQVPQYVLIGISEIFASIAGLEFAYSAAPKSMQSAIMGLFFFFSGIGSFVGSGLLAIVSLKAIGWMSSQKDFGNINDCSLHYYFFLLAGIQGVTLLVFLIISVKYDKQRGKAAGQPQRRA 563          
BLAST of slc15a-8 vs. Ensembl Medaka
Match: slc15a4 (solute carrier family 15 member 4 [Source:NCBI gene;Acc:101165813])

HSP 1 Score: 72.0182 bits (175), Expect = 1.003e-12
Identity = 68/261 (26.05%), Postives = 121/261 (46.36%), Query Frame = 2
Query:  791 PYGICDSQTRFAYQYQSNHMKIPNWNGSLSSLTRKSNF-WPITLNCLTVILAYFVLILLKEMNKS-----QFIQMLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAAD------GSGGFSDLFFTIYTFYHESLE-NDLNNCHLDYIYFGLAGVAFFSWIISIILINRFPHRFTIVQSQKNYES 1534
            PY     Q +  Y  Q  H++IP  + ++++ + +  F +P     LT+  A  +L+L+   +K      +   +L SS+K +I  G   ++ S    GILE  RL I         + S  + NQ +GN+ Y  ADL ++  VPQ VL GISE+  +   +EF Y  + KS++   + LF          GSG  + +      +     +  ++N+C L Y +F LAG+   + ++ +I+  ++  +      Q    +
Sbjct:  327 PYWTVYFQMQTTYVLQGLHLRIPGTSSNITTESHQMTFQFPAAW--LTMFDAVLILMLIPLKDKVVDPVLKRRGLLPSSLK-RIAVGMFFVMCSAVAAGILETKRLEI---------VKSNGTINQVLGNVIYYVADLPIWWQVPQYVLIGISEIFASIAGLEFAYSAAPKSMQSAIMGLFFFFSGIGSFVGSGLLAIVSLKAIGWMSSQKDFGNINDCSLHYYFFLLAGIQGVTLLVFLIISVKYDKQRGKAAGQPQRRA 575          
BLAST of slc15a-8 vs. Ensembl Medaka
Match: slc15a4 (solute carrier family 15 member 4 [Source:NCBI gene;Acc:101165813])

HSP 1 Score: 72.0182 bits (175), Expect = 1.003e-12
Identity = 68/261 (26.05%), Postives = 121/261 (46.36%), Query Frame = 2
Query:  791 PYGICDSQTRFAYQYQSNHMKIPNWNGSLSSLTRKSNF-WPITLNCLTVILAYFVLILLKEMNKS-----QFIQMLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAAD------GSGGFSDLFFTIYTFYHESLE-NDLNNCHLDYIYFGLAGVAFFSWIISIILINRFPHRFTIVQSQKNYES 1534
            PY     Q +  Y  Q  H++IP  + ++++ + +  F +P     LT+  A  +L+L+   +K      +   +L SS+K +I  G   ++ S    GILE  RL I         + S  + NQ +GN+ Y  ADL ++  VPQ VL GISE+  +   +EF Y  + KS++   + LF          GSG  + +      +     +  ++N+C L Y +F LAG+   + ++ +I+  ++  +      Q    +
Sbjct:  327 PYWTVYFQMQTTYVLQGLHLRIPGTSSNITTESHQMTFQFPAAW--LTMFDAVLILMLIPLKDKVVDPVLKRRGLLPSSLK-RIAVGMFFVMCSAVAAGILETKRLEI---------VKSNGTINQVLGNVIYYVADLPIWWQVPQYVLIGISEIFASIAGLEFAYSAAPKSMQSAIMGLFFFFSGIGSFVGSGLLAIVSLKAIGWMSSQKDFGNINDCSLHYYFFLLAGIQGVTLLVFLIISVKYDKQRGKAAGQPQRRA 575          
BLAST of slc15a-8 vs. Ensembl Medaka
Match: slc15a4 (solute carrier family 15 member 4 [Source:NCBI gene;Acc:101165813])

HSP 1 Score: 63.5438 bits (153), Expect = 4.046e-10
Identity = 52/187 (27.81%), Postives = 88/187 (47.06%), Query Frame = 2
Query:  995 MLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAAD------GSGGFSDLFFTIYTFYHESLE-NDLNNCHLDYIYFGLAGVAFFSWIISIILINRFPHRFTIVQSQKNYES 1534
            +L SS+K +I  G   ++ S    GILE  RL I         + S  + NQ +GN+ Y  ADL ++  VPQ VL GISE+  +   +EF Y  + KS++   + LF          GSG  + +      +     +  ++N+C L Y +F LAG+   + ++ +I+  ++  +      Q    +
Sbjct:  372 LLPSSLK-RIAVGMFFVMCSAVAAGILETKRLEI---------VKSNGTINQVLGNVIYYVADLPIWWQVPQYVLIGISEIFASIAGLEFAYSAAPKSMQSAIMGLFFFFSGIGSFVGSGLLAIVSLKAIGWMSSQKDFGNINDCSLHYYFFLLAGIQGVTLLVFLIISVKYDKQRGKAAGQPQRRA 548          
BLAST of slc15a-8 vs. Planmine SMEST
Match: SMESG000009956.1 (SMESG000009956.1)

HSP 1 Score: 827.009 bits (2135), Expect = 0.000e+0
Identity = 470/486 (96.71%), Postives = 474/486 (97.53%), Query Frame = 2
Query:   77 MNFQRNISXXXXXXXXXXIYTAFLHVQVNIQAGSLVSSFPKYTNVLLVAIESSSVLLIGLLATFVFPVYFXXXXXXXXXXXXXXFFTAVAFLNNTKDIQLRLNLGGIIMFGIFYGTFRLLLLCMILDQEQSHFIKRKIIGWLGVINFSFILVYMIPSPIQHPNLMLFPVXXXXXXXXXXXXXXXRKIYAVDSNIVNVFQLMKRFNWSEELLISEADINDSERNXXXXXXXXXXXXXXXPYGICDSQTRFAYQYQSNHMKIPNWNGSLSSLTRKSNFWPITLNCLTVILAYFVLILLKEMNKSQFIQMLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAADGSGGFSDLFFTIYTFYHESLENDLNNCHLDYIYFGLAGVAFFSWIISIILINRFPHRFTIVQSQKNYES 1534
            MNFQRNISFVFLLVVY FIYTAFL+VQVNIQA S+VSSFPKYTNVLLVAIESSSVLLIGLLATFVFPV+FLLIISLSSLMIGISFFTAVAFLNN +DIQL LNL GIIMFGIFYGTFRLLLLCMILDQEQSHFIKRKIIGWLGVINFSFILVYMIPSPIQHPNLMLFPVSFSIIGIILL FGKFRKIYAVDSNIVNVFQLMKRFNWSEELLI EADINDSERNLISISKSIIFFFLLIPYGICDSQTRFAYQYQSNHMKIPNWNGSLSSLTRKSNFWPITLNCLTVILAYFV ILLKEMNKSQFIQMLFSSIKLQIITGNILMILSTTIGGILELFRLNIYW  DPKA I SIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAADGSGGFSDLFFTIYTFYHESLENDLNNCHLDYIYFGLAGVAFFSWIISIILINRFPHRFTIVQSQKNYES
Sbjct:    1 MNFQRNISFVFLLVVYLFIYTAFLYVQVNIQADSMVSSFPKYTNVLLVAIESSSVLLIGLLATFVFPVFFLLIISLSSLMIGISFFTAVAFLNNKEDIQLTLNLCGIIMFGIFYGTFRLLLLCMILDQEQSHFIKRKIIGWLGVINFSFILVYMIPSPIQHPNLMLFPVSFSIIGIILLVFGKFRKIYAVDSNIVNVFQLMKRFNWSEELLIDEADINDSERNLISISKSIIFFFLLIPYGICDSQTRFAYQYQSNHMKIPNWNGSLSSLTRKSNFWPITLNCLTVILAYFVFILLKEMNKSQFIQMLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWRNDPKAGIQSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAADGSGGFSDLFFTIYTFYHESLENDLNNCHLDYIYFGLAGVAFFSWIISIILINRFPHRFTIVQSQKNYES 486          
BLAST of slc15a-8 vs. Planmine SMEST
Match: SMESG000009956.1 (SMESG000009956.1)

HSP 1 Score: 787.334 bits (2032), Expect = 0.000e+0
Identity = 439/452 (97.12%), Postives = 442/452 (97.79%), Query Frame = 2
Query:  179 LVSSFPKYTNVLLVAIESSSVLLIGLLATFVFPVYFXXXXXXXXXXXXXXFFTAVAFLNNTKDIQLRLNLGGIIMFGIFYGTFRLLLLCMILDQEQSHFIKRKIIGWLGVINFSFILVYMIPSPIQHPNLMLFPVXXXXXXXXXXXXXXXRKIYAVDSNIVNVFQLMKRFNWSEELLISEADINDSERNXXXXXXXXXXXXXXXPYGICDSQTRFAYQYQSNHMKIPNWNGSLSSLTRKSNFWPITLNCLTVILAYFVLILLKEMNKSQFIQMLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAADGSGGFSDLFFTIYTFYHESLENDLNNCHLDYIYFGLAGVAFFSWIISIILINRFPHRFTIVQSQKNYES 1534
            +VSSFPKYTNVLLVAIESSSVLLIGLLATFVFPV+FLLIISLSSLMIGISFFTAVAFLNN +DIQL LNL GIIMFGIFYGTFRLLLLCMILDQEQSHFIKRKIIGWLGVINFSFILVYMIPSPIQHPNLMLFPVSFSIIGIILL FGKFRKIYAVDSNIVNVFQLMKRFNWSEELLI EADINDSERNLISISKSIIFFFLLIPYGICDSQTRFAYQYQSNHMKIPNWNGSLSSLTRKSNFWPITLNCLTVILAYFV ILLKEMNKSQFIQMLFSSIKLQIITGNILMILSTTIGGILELFRLNIYW  DPKA I SIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAADGSGGFSDLFFTIYTFYHESLENDLNNCHLDYIYFGLAGVAFFSWIISIILINRFPHRFTIVQSQKNYES
Sbjct:    1 MVSSFPKYTNVLLVAIESSSVLLIGLLATFVFPVFFLLIISLSSLMIGISFFTAVAFLNNKEDIQLTLNLCGIIMFGIFYGTFRLLLLCMILDQEQSHFIKRKIIGWLGVINFSFILVYMIPSPIQHPNLMLFPVSFSIIGIILLVFGKFRKIYAVDSNIVNVFQLMKRFNWSEELLIDEADINDSERNLISISKSIIFFFLLIPYGICDSQTRFAYQYQSNHMKIPNWNGSLSSLTRKSNFWPITLNCLTVILAYFVFILLKEMNKSQFIQMLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWRNDPKAGIQSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAADGSGGFSDLFFTIYTFYHESLENDLNNCHLDYIYFGLAGVAFFSWIISIILINRFPHRFTIVQSQKNYES 452          
BLAST of slc15a-8 vs. Planmine SMEST
Match: SMESG000009967.1 (SMESG000009967.1)

HSP 1 Score: 172.94 bits (437), Expect = 1.928e-46
Identity = 139/385 (36.10%), Postives = 224/385 (58.18%), Query Frame = 2
Query:  239 VLLIGLLATFVFPVYFXXXXXXXXXXXXXXFFTAVAFLNNTKDIQLRLNLGGIIMFGIFYGTFRLLLLCMILDQE-----------QSHFIKRKIIGWLGVINFSFILVYM-IPSPIQH-PNLMLFPVXXXXXXXXXXXXXXXRKIYAVDSNIVNVFQLMKRFNWSEELLISEADINDSERNXXXXXXXXXXXXXXXPYGICDSQTRFAYQYQSNHMKIPNWNGSLSSLTRKSNFWPITLNCLTVILAYFVLILLKEMNKSQFIQMLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAADGSGGFSDLF 1354
            V+L G+LATFV P   L   S++ L I +  F    F  N + ++  +++  +++  IF+G FRL+   +I  Q+            S  +KR+I  WL ++N + ++V   +P P  + PNL +  +    +GIIL+  GK+   Y  DS I ++FQL++     +    S  D+   ++ LI +SK+II  FLLIPY  CD Q ++ Y YQ  HMK PN   S   ++ + +  P  +N L+ IL     I+L E N   +++  F ++K  II G ++MIL+T I G++E FRL I+W+++ K+ +PS  + NQT G  TY+AA+LT F MV  IVL+ +SEV+++ +C++F+++Q   SIKYL I+++L   G G F +LF
Sbjct:   50 VILSGILATFVIPSKILFAFSIAVLSISLLIFEIGEFNENLQKLK-SISMANLVLNSIFFGIFRLICQILIYHQKTLNENLENSDVNSGNVKREICIWLVILNVTEVIVLAAMPLPTDNNPNLSIVCILSVTLGIILIITGKYYNFYKFDSEIGDIFQLIRNLKKPKGRFFS-VDL-QGKQFLIDLSKTIIVLFLLIPYSACDVQNKYGYVYQWLHMKWPN---STLYISDRISSIPKIINGLSTILFAVFYIILTE-NNVTYLKAFFRNMKWNIIVGILIMILATLISGVIETFRLEIFWNWNSKSLVPSPDAINQTSGTETYRAANLTAFVMVLPIVLNALSEVLVSVSCLDFLFRQ---SIKYLSISMYLGVIGHGAFGELF 424          
BLAST of slc15a-8 vs. Planmine SMEST
Match: SMESG000023324.1 (SMESG000023324.1)

HSP 1 Score: 151.369 bits (381), Expect = 5.010e-39
Identity = 146/462 (31.60%), Postives = 244/462 (52.81%), Query Frame = 2
Query:  200 YTNVLLVAIESSSVLLIGLLATFVFPVYFXXXXXXXXXXXXXXFFTAVAFLNNTKDIQLRLNLGGI-----IMFGIFYGTFRLLLLCMILDQEQSHFIKRKIIGWLGVINFSFILVYMIPS---PIQHPNLMLFPVXXXXXXXXXXXXXXXRKIYAVDSNIVNVFQLMK------RFNWSEELLISEADINDSERNXXXXXXXXXXXXXXXPYGICDSQTRFAYQYQSNHMKIPNWNGSLSSLTRKSNFWPITLNCLTVILAYFVLILLKEMNKSQFIQMLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAADGSGGFSDLFFTIYTFYH----ESLENDLNNCHLDYIYFGLAGVAFFSWIISIILINRFPHRFTIVQSQKNYE 1531
            Y +++  ++  S++LL G+LATF+   ++L  +S    ++GI+ F   A   +          GG      ++ GI  G F+ L +  ++DQ    +IK  +  +L    F +++VY   S     ++          +++G IL+  G F K +  +S ++ ++ ++K       F  SE  +I+       ++ +ISISKS+I F LLIPYGICDSQ  +AY YQSN ++ P+ N   +S     +FW  T+  + VI+   +L+  + +N+  F   L+S +K +II GNI MI+ST I G LE FRL+  W+ +  + + S Y  N TI   TY   +++V  M+PQ +L   SE+++  TCIE++  +S+KS KY  +AL ++    GG SD    I  F +    +   N      LDY+ + ++ V+  S +ISI+L+ RF   FT+ +  K  E
Sbjct:   43 YDSIVFDSVCCSTLLLGGILATFLIRAHYLFYLSFGCFLLGIAIFEWKAPFTD----------GGFYWTVELLIGISLGLFKFLYIVALIDQNDRKYIKFNVAFFLFSDCFCYLIVYTFTSNKASDENNTKTYVRRVLAVLGTILVVIGIFVKRFERNSEVIELYGIIKFIRQRKSFYESEYEMINNVGAVHYKKVIISISKSVIVFLLLIPYGICDSQQLYAYAYQSNSLRPPHGNRYFTS-----DFWSNTITSMIVIMTLLILLSARFLNEKAF-DKLYSKMKAKIILGNIFMIISTLICGALETFRLSTRWTAN-NSSVTSNYK-NMTIDKKTY--INMSVLCMIPQSILLSFSEILVIPTCIEYVILESEKSTKYFAVALIVSVVNIGGISDFLTVIMEFKNITPSDFDSNKKATIRLDYLMYIISSVSVISLVISILLMVRFKKYFTLDEFNKMEE 484          
BLAST of slc15a-8 vs. Planmine SMEST
Match: SMESG000023325.1 (SMESG000023325.1)

HSP 1 Score: 147.132 bits (370), Expect = 7.150e-38
Identity = 133/399 (33.33%), Postives = 215/399 (53.88%), Query Frame = 2
Query:  188 SFPKYTNVLLVAIESSSVLLIGLLATFVFPVYFXXXXXXXXXXXXXXFFTAVA-FLNNTKDIQLRLNLGGIIMFGIFYGTFRLLLLCMILDQEQSHFIKRKIIGWLGVINFSFILVYMIPSPIQHP----NLMLFPVXXXXXXXXXXXXXXXRKIYAVDSNIVNVFQLMKRFNWS------EELLISEADINDSERNXXXXXXXXXXXXXXXPYGICDSQTRFAYQYQSNHMKIPNWNGSLSSLTRKSNFWPITLNCLTVILAYFVLILLKEMNKSQFIQMLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARIPSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQSKKSIKYLGIALFLAADGSGGFSDL 1351
            S+P YT ++LV ++  +++L G+LATF+    +         +    F   V   L  T      L     ++ G+ +G F+ + L  ++DQ    +IK  +  +L   +  +++VY             NL    ++ +  G IL+  G F K++  D+ ++ ++ +++ F         +  +++  +  D  + +ISISKS+I FFLLIPYGICDSQ  +AY++QSN +   N    L     KSNFW  T++  TV+ A  +L  ++  N+++F   ++S+IK +II GN LMI+ST I G LE +RL++ W+ +     P+    N  I N TY   D++VF MVPQ +L   SEV+I  TCIE++  +S+KS KYL I L  +A   GG SDL
Sbjct:    2 SYP-YTAMILVLVDCGTLILGGMLATFLIRAQY------LFYLSIGCFVIGVPILLFKTPFTDPTLYWVTHVLIGLSFGLFKFIYLVALIDQNDRRYIKFIVAFFLFTESICYLIVYTFTPNTDTVEKIWNLNYARLALAGFGAILVVIGCFLKLFEKDTEVIEIYGIIQFFRQRRFAANLDHSILNNTETVDFRKVIISISKSVIVFFLLIPYGICDSQEFYAYEFQSNSLNQSN----LLFNHFKSNFWCNTISAFTVMAALLILFAVRFCNENKF-DAIYSNIKTKIILGNSLMIISTLICGALETYRLSMLWTDNNSTLTPNYK--NVIIDNTTYHVVDISVFWMVPQNILLSFSEVLIVPTCIEYVIDKSEKSTKYLSIVLVFSAVNIGGISDL 386          
The following BLAST results are available for this feature:
BLAST of slc15a-8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SLC15A49.597e-1329.46solute carrier family 15 member 4 [Source:HGNC Sym... [more]
SLC15A35.798e-925.66solute carrier family 15 member 3 [Source:HGNC Sym... [more]
SLC15A31.979e-825.88solute carrier family 15 member 3 [Source:HGNC Sym... [more]
back to top
BLAST of slc15a-8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc15a-8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc15a-8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc15a41.034e-1128.93solute carrier family 15 member 4 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc15a-8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc9a3r15.980e-1029.89SLC9A3 regulator 1 [Source:Xenbase;Acc:XB-GENE-487... [more]
back to top
BLAST of slc15a-8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Slc15a42.413e-1331.17solute carrier family 15, member 4 [Source:MGI Sym... [more]
Slc15a31.945e-1025.57solute carrier family 15, member 3 [Source:MGI Sym... [more]
back to top
BLAST of slc15a-8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91W98|S15A4_MOUSE1.688e-1231.17Solute carrier family 15 member 4 OS=Mus musculus ... [more]
sp|O09014|S15A4_RAT3.805e-1231.60Solute carrier family 15 member 4 OS=Rattus norveg... [more]
sp|Q8N697|S15A4_HUMAN4.609e-1229.46Solute carrier family 15 member 4 OS=Homo sapiens ... [more]
sp|A6QQL0|S15A4_BOVIN1.829e-1131.17Solute carrier family 15 member 4 OS=Bos taurus OX... [more]
sp|Q68F72|S15A4_XENLA7.650e-1030.04Solute carrier family 15 member 4 OS=Xenopus laevi... [more]
back to top
BLAST of slc15a-8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJ380.000e+0100.00Slc15a-8 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YK611.294e-3332.77Slc15a-7 (Fragment) OS=Schmidtea mediterranea OX=7... [more]
K1RF992.061e-1428.96Solute carrier family 15 member 4 OS=Crassostrea g... [more]
A0A3Q0G0K37.083e-1328.63solute carrier family 15 member 4 isoform X2 OS=Al... [more]
A0A2C9JM757.875e-1330.22Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of slc15a-8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc15a43.395e-1330.87solute carrier family 15 member 4 [Source:NCBI gen... [more]
slc15a43.839e-1031.98solute carrier family 15 member 4 [Source:NCBI gen... [more]
back to top
BLAST of slc15a-8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005298.15.888e-1128.25pep scaffold:Pmarinus_7.0:GL477384:58393:77162:-1 ... [more]
back to top
BLAST of slc15a-8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc15a-8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO373721.341e-927.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331762.273e-925.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc15a-8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc15a47.750e-1427.31solute carrier family 15 member 4 [Source:NCBI gen... [more]
slc15a41.003e-1226.05solute carrier family 15 member 4 [Source:NCBI gen... [more]
slc15a41.003e-1226.05solute carrier family 15 member 4 [Source:NCBI gen... [more]
slc15a44.046e-1027.81solute carrier family 15 member 4 [Source:NCBI gen... [more]
back to top
BLAST of slc15a-8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009956.10.000e+096.71SMESG000009956.1[more]
SMESG000009956.10.000e+097.12SMESG000009956.1[more]
SMESG000009967.11.928e-4636.10SMESG000009967.1[more]
SMESG000023324.15.010e-3931.60SMESG000023324.1[more]
SMESG000023325.17.150e-3833.33SMESG000023325.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30020421
GenBankAKN21494.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020421 ID=SMED30020421|Name=slc15a-8|organism=Schmidtea mediterranea sexual|type=transcript|length=2098bp
TAGATACTTTGAACTCGTTTATTTATGATATTTTAAAATTTTATTTTATT
CCACAAATGCTAATTTTATTAATAAAATGAATTTTCAAAGAAATATCTCA
TTTGTCTTTTTACTAGTTGTCTATTTTTTTATTTACACAGCCTTTCTACA
TGTCCAAGTGAACATCCAGGCCGGCTCTTTGGTATCCTCTTTTCCCAAAT
ATACAAATGTCCTACTGGTCGCAATTGAAAGTTCATCAGTTTTGCTAATA
GGCCTTTTGGCGACTTTTGTCTTTCCAGTATATTTCCTCCTAATTATTTC
ATTGTCTTCACTAATGATCGGAATTTCTTTTTTTACGGCTGTCGCTTTTC
TAAATAATACGAAAGATATCCAGTTGAGGCTAAACTTAGGCGGCATCATT
ATGTTTGGCATATTTTATGGGACTTTCAGACTTTTATTGCTATGTATGAT
TTTGGATCAGGAACAGTCGCATTTTATCAAAAGAAAAATAATCGGATGGC
TTGGAGTTATCAACTTTTCCTTTATTCTTGTCTACATGATTCCCAGCCCG
ATACAACACCCGAATTTAATGCTTTTCCCAGTATCTTTCTCTATTATTGG
AATTATTTTATTATTTTTTGGAAAATTCAGAAAAATATATGCAGTTGACT
CAAATATTGTTAATGTATTTCAGCTTATGAAACGTTTTAATTGGTCTGAA
GAGTTACTTATAAGTGAAGCTGACATTAATGATAGTGAGAGAAATCTCAT
TTCGATTTCTAAGTCAATTATATTCTTTTTTTTGTTAATTCCTTACGGAA
TATGCGATTCACAAACTCGGTTTGCTTATCAGTATCAATCCAATCACATG
AAAATTCCTAATTGGAACGGATCTCTAAGTTCATTGACAAGGAAATCAAA
TTTCTGGCCGATAACCTTGAACTGTTTGACGGTGATCCTAGCATATTTTG
TGCTCATATTATTGAAAGAAATGAACAAATCTCAATTTATACAAATGCTA
TTTTCTTCTATCAAGTTGCAAATAATAACTGGGAATATTTTAATGATACT
TTCAACAACAATTGGAGGAATCCTGGAATTATTTCGACTGAACATATATT
GGAGTTATGATCCAAAGGCTCGAATCCCGTCCATATATTCTTTTAATCAA
ACAATCGGAAATATAACTTATAAAGCTGCAGATCTTACCGTTTTTGCAAT
GGTTCCACAGATTGTCCTGGATGGAATAAGTGAAGTTATAATAACCACCA
CATGTATTGAATTTATGTACAAACAGTCGAAAAAGTCTATAAAATATTTG
GGTATTGCTTTATTCTTAGCTGCCGATGGGTCTGGCGGTTTTTCAGATTT
GTTTTTTACAATATATACATTTTATCATGAATCTCTGGAAAATGATTTAA
ACAATTGTCACCTTGATTATATTTACTTTGGTCTCGCGGGGGTGGCTTTT
TTTTCTTGGATTATTAGCATAATTCTTATCAATCGGTTTCCTCACAGGTT
TACAATTGTTCAGTCACAGAAAAATTATGAATCTTAACCGACGTGATGTA
CAATAAATCTGTTTCTAATAAAACTTAATTATTTTGATATTACAATTCCG
AAAAATACATACATACACACACATTTAACCATCCCTGTCAGAAAAAAATT
AACAGCACATATATTAATAAAAGGAGGTTGCTATTATTAAATGTTACAAA
GTAGAGCAAATAAATATTACATAATTGAAAATAATTATTTAAAAATCATG
TTATTTTTTTATGTTATATATATATTTTTAAATTCACCGCCCTTTCATCT
GACTTTTTAGACCGACCCACCGGAAATTAGCCAGTTGTCCCACCGGTTCA
GTCCGCTGCTGGGAAAACTGTCAATCTGTTTTAAAGAAGAATTAAATTTA
AACAAAAACTTATCAAAAATATTAACTAATATATGAGCTTACAAGATATG
ATGTTAGATTGGATGACATTTGAGCATGATTTTCTCTTTCATTACCGGTT
AAGTCTATTGCTCATTTTTATTATTCAGGTTTTTTGATTTACATTTTATT
TAAATATAAACTTTAATTTTCCACGGGTTCCATGTTCTAATTAGTAAT
back to top

protein sequence of SMED30020421-orf-1

>SMED30020421-orf-1 ID=SMED30020421-orf-1|Name=SMED30020421-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=487bp
MNFQRNISFVFLLVVYFFIYTAFLHVQVNIQAGSLVSSFPKYTNVLLVAI
ESSSVLLIGLLATFVFPVYFLLIISLSSLMIGISFFTAVAFLNNTKDIQL
RLNLGGIIMFGIFYGTFRLLLLCMILDQEQSHFIKRKIIGWLGVINFSFI
LVYMIPSPIQHPNLMLFPVSFSIIGIILLFFGKFRKIYAVDSNIVNVFQL
MKRFNWSEELLISEADINDSERNLISISKSIIFFFLLIPYGICDSQTRFA
YQYQSNHMKIPNWNGSLSSLTRKSNFWPITLNCLTVILAYFVLILLKEMN
KSQFIQMLFSSIKLQIITGNILMILSTTIGGILELFRLNIYWSYDPKARI
PSIYSFNQTIGNITYKAADLTVFAMVPQIVLDGISEVIITTTCIEFMYKQ
SKKSIKYLGIALFLAADGSGGFSDLFFTIYTFYHESLENDLNNCHLDYIY
FGLAGVAFFSWIISIILINRFPHRFTIVQSQKNYES*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0005215transporter activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006810transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR000109POT_fam
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 7..477
e-value: 9.0E-23
score: 82.1
NoneNo IPR availablePANTHERPTHR11654:SF64SOLUTE CARRIER FAMILY 15 (OLIGOPEPTIDE TRANSPORTER), MEMBER 4coord: 73..466
NoneNo IPR availableCDDcd17348MFS_SLC15A3_4coord: 223..456
e-value: 3.06197E-17
score: 81.7596
NoneNo IPR availableTMHMMTMhelixcoord: 407..429
NoneNo IPR availableTMHMMTMhelixcoord: 165..182
NoneNo IPR availableTMHMMTMhelixcoord: 68..90
NoneNo IPR availableTMHMMTMhelixcoord: 44..66
NoneNo IPR availableTMHMMTMhelixcoord: 138..155
NoneNo IPR availableTMHMMTMhelixcoord: 274..296
NoneNo IPR availableTMHMMTMhelixcoord: 449..471
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 100..122
NoneNo IPR availableTMHMMTMhelixcoord: 316..338
IPR000109Proton-dependent oligopeptide transporter familyPANTHERPTHR11654OLIGOPEPTIDE TRANSPORTER-RELATEDcoord: 73..466