Ankyrin repeat domain-containing protein 6

Overview
NameAnkyrin repeat domain-containing protein 6
Smed IDSMED30020418
Length (bp)307
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020418

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30020418SMESG000034407.1 SmedASXL_014344SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30020418SMESG000034407.1 Contig34143newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020418SMESG000034407.1 Contig34143uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30020418SMESG000034407.1 dd_Smed_v6_17293_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30020418SMESG000034407.1 dd_Smed_v4_17293_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ankyrin repeat domain-containing protein 6 vs. Ensembl Human
Match: POTEB3 (POTE ankyrin domain family member B3 [Source:HGNC Symbol;Acc:HGNC:51240])

HSP 1 Score: 44.2838 bits (103), Expect = 6.510e-6
Identity = 25/54 (46.30%), Postives = 35/54 (64.81%), Query Frame = 3
Query:  126 YDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAV 287
            Y A I+++N+ GLTPL+  V   +Q VV+ LI+ K +L   D R G TAL +AV
Sbjct:  261 YGADIESKNKCGLTPLLLGVHEQKQQVVKFLIKKKANLNALD-RYGRTALILAV 313          
BLAST of Ankyrin repeat domain-containing protein 6 vs. Ensembl Human
Match: POTEC (POTE ankyrin domain family member C [Source:HGNC Symbol;Acc:HGNC:33894])

HSP 1 Score: 44.2838 bits (103), Expect = 6.510e-6
Identity = 25/54 (46.30%), Postives = 35/54 (64.81%), Query Frame = 3
Query:  126 YDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAV 287
            Y A I+++N+ GLTPL+  V   +Q VV+ LI+ K +L   D R G TAL +AV
Sbjct:  261 YGADIESKNKCGLTPLLLGVHEQKQQVVKFLIKKKANLNALD-RYGRTALILAV 313          
BLAST of Ankyrin repeat domain-containing protein 6 vs. Ensembl Human
Match: POTEB3 (POTE ankyrin domain family member B3 [Source:HGNC Symbol;Acc:HGNC:51240])

HSP 1 Score: 44.2838 bits (103), Expect = 6.573e-6
Identity = 25/54 (46.30%), Postives = 35/54 (64.81%), Query Frame = 3
Query:  126 YDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAV 287
            Y A I+++N+ GLTPL+  V   +Q VV+ LI+ K +L   D R G TAL +AV
Sbjct:  261 YGADIESKNKCGLTPLLLGVHEQKQEVVKFLIKKKANLNALD-RYGRTALILAV 313          
BLAST of Ankyrin repeat domain-containing protein 6 vs. Ensembl Human
Match: AC136352.4 (POTE ankyrin domain family member B-like [Source:NCBI gene;Acc:102723502])

HSP 1 Score: 44.2838 bits (103), Expect = 6.573e-6
Identity = 25/54 (46.30%), Postives = 35/54 (64.81%), Query Frame = 3
Query:  126 YDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAV 287
            Y A I+++N+ GLTPL+  V   +Q VV+ LI+ K +L   D R G TAL +AV
Sbjct:  261 YGADIESKNKCGLTPLLLGVHEQKQEVVKFLIKKKANLNALD-RYGRTALILAV 313          
BLAST of Ankyrin repeat domain-containing protein 6 vs. Ensembl Human
Match: POTEI (POTE ankyrin domain family member I [Source:HGNC Symbol;Acc:HGNC:37093])

HSP 1 Score: 44.2838 bits (103), Expect = 6.625e-6
Identity = 25/54 (46.30%), Postives = 35/54 (64.81%), Query Frame = 3
Query:  126 YDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAV 287
            Y A I+++N+ GLTPL+  V   +Q VV+ LI+ K +L   D R G TAL +AV
Sbjct:  261 YGADIESKNKHGLTPLLLGVHEQKQQVVKFLIKKKANLNALD-RYGRTALILAV 313          
BLAST of Ankyrin repeat domain-containing protein 6 vs. UniProt/SwissProt
Match: sp|Q4JHE0|XB36_ORYSJ (Probable E3 ubiquitin-protein ligase XBOS36 OS=Oryza sativa subsp. japonica OX=39947 GN=XBOS36 PE=2 SV=1)

HSP 1 Score: 47.3654 bits (111), Expect = 2.592e-6
Identity = 21/57 (36.84%), Postives = 37/57 (64.91%), Query Frame = 3
Query:  132 ARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYV 302
            A ++A+N +G TPLM+A  +    VVQ L+  +C++++ +  +G TALH+A    +V
Sbjct:   69 ADVNARNIYGQTPLMQACRFGHWEVVQTLLVFRCNVWRVENLSGRTALHMAAAGGHV 125          
BLAST of Ankyrin repeat domain-containing protein 6 vs. TrEMBL
Match: A0A267FMN2 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034199g1 PE=4 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.102e-23
Identity = 43/58 (74.14%), Postives = 53/58 (91.38%), Query Frame = 3
Query:  129 DARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYV 302
            +AR+DAQNQWGLTPLMEAVSY+Q+ VV  LI+ +CDLYKRD+RTGDT+LH+AV+KNY 
Sbjct:  234 EARVDAQNQWGLTPLMEAVSYNQKEVVAALIKHRCDLYKRDFRTGDTSLHIAVKKNYT 291          
BLAST of Ankyrin repeat domain-containing protein 6 vs. TrEMBL
Match: A0A267FMI3 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034199g2 PE=4 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.109e-23
Identity = 43/58 (74.14%), Postives = 53/58 (91.38%), Query Frame = 3
Query:  129 DARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYV 302
            +AR+DAQNQWGLTPLMEAVSY+Q+ VV  LI+ +CDLYKRD+RTGDT+LH+AV+KNY 
Sbjct:  234 EARVDAQNQWGLTPLMEAVSYNQKEVVAALIKHRCDLYKRDFRTGDTSLHIAVKKNYT 291          
BLAST of Ankyrin repeat domain-containing protein 6 vs. TrEMBL
Match: A0A1I8GY03 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 2.967e-23
Identity = 43/57 (75.44%), Postives = 53/57 (92.98%), Query Frame = 3
Query:  129 DARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNY 299
            +AR+DAQNQWGLTPLMEAVSY+Q+ VV  LI+ +CDLYKRD+RTGDT+LH+AV+KNY
Sbjct:  214 EARVDAQNQWGLTPLMEAVSYNQKEVVAALIKHRCDLYKRDFRTGDTSLHIAVKKNY 270          
BLAST of Ankyrin repeat domain-containing protein 6 vs. TrEMBL
Match: A0A1I8I5G8 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 3.370e-23
Identity = 43/57 (75.44%), Postives = 53/57 (92.98%), Query Frame = 3
Query:  129 DARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNY 299
            +AR+DAQNQWGLTPLMEAVSY+Q+ VV  LI+ +CDLYKRD+RTGDT+LH+AV+KNY
Sbjct:  214 EARVDAQNQWGLTPLMEAVSYNQKEVVAALIKHRCDLYKRDFRTGDTSLHIAVKKNY 270          
BLAST of Ankyrin repeat domain-containing protein 6 vs. TrEMBL
Match: A0A3P8IV69 (ANK_REP_REGION domain-containing protein (Fragment) OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS4749 PE=4 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 9.609e-19
Identity = 38/63 (60.32%), Postives = 53/63 (84.13%), Query Frame = 3
Query:  120 FQYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSK-CDLYKRDYRTGDTALHVAVRKNYVH 305
             + ++R++AQNQ GLTPLME+VSY+Q+  V +LI+ +  DLYKRD+ TGDTALH+AV+KNY+H
Sbjct:  100 IKAESRLNAQNQIGLTPLMESVSYNQREAVSLLIKQRDIDLYKRDFCTGDTALHIAVKKNYIH 162          
BLAST of Ankyrin repeat domain-containing protein 6 vs. Ensembl Nematostella
Match: EDO28023 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7M5])

HSP 1 Score: 42.743 bits (99), Expect = 9.861e-7
Identity = 23/59 (38.98%), Postives = 36/59 (61.02%), Query Frame = 3
Query:  111 NLNFQYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAV 287
            N+ F Y   ++A++  G TPLM A    +  VVQ+LI+ K D+  R+ + G TAL +A+
Sbjct:   33 NIGFSYS--LEAEDWRGNTPLMTAAGRGRDRVVQVLIQHKADVTARNAK-GMTALDIAI 88          
BLAST of Ankyrin repeat domain-containing protein 6 vs. Ensembl Nematostella
Match: EDO41101 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5D3])

HSP 1 Score: 42.743 bits (99), Expect = 1.280e-6
Identity = 23/59 (38.98%), Postives = 36/59 (61.02%), Query Frame = 3
Query:  111 NLNFQYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAV 287
            N+ F Y   ++A++  G TPLM A    +  VVQ+LI+ K D+  R+ + G TAL +A+
Sbjct:   33 NIGFSYS--LEAEDWRGNTPLMTAAGRGRDRVVQVLIQHKADVTARNAK-GMTALDIAI 88          
BLAST of Ankyrin repeat domain-containing protein 6 vs. Ensembl Nematostella
Match: EDO41104 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5D3])

HSP 1 Score: 42.743 bits (99), Expect = 1.280e-6
Identity = 23/59 (38.98%), Postives = 36/59 (61.02%), Query Frame = 3
Query:  111 NLNFQYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAV 287
            N+ F Y   ++A++  G TPLM A    +  VVQ+LI+ K D+  R+ + G TAL +A+
Sbjct:   33 NIGFSYS--LEAEDWRGNTPLMTAAGRGRDRVVQVLIQHKADVTARNAK-GMTALDIAI 88          
BLAST of Ankyrin repeat domain-containing protein 6 vs. Ensembl Medaka
Match: ankrd44 (ankyrin repeat domain 44 [Source:NCBI gene;Acc:101173198])

HSP 1 Score: 45.4394 bits (106), Expect = 1.660e-6
Identity = 30/86 (34.88%), Postives = 42/86 (48.84%), Query Frame = 3
Query:   39 SPLQSLMIFILALISEFLIPNLHMNLNFQYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKN 296
            +PL +      A I+E LI +          AR++A++    TPL  AV+   Q  VQ+LIR   D+  RD +   T LHVA   N
Sbjct:   43 TPLHAAAFLGDAEITELLILS---------GARVNAKDNMWFTPLHRAVASRSQDAVQVLIRHSADVNARD-KNWQTPLHVAAANN 118          
BLAST of Ankyrin repeat domain-containing protein 6 vs. Ensembl Medaka
Match: ankrd44 (ankyrin repeat domain 44 [Source:NCBI gene;Acc:101173198])

HSP 1 Score: 45.4394 bits (106), Expect = 1.661e-6
Identity = 30/86 (34.88%), Postives = 42/86 (48.84%), Query Frame = 3
Query:   39 SPLQSLMIFILALISEFLIPNLHMNLNFQYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKN 296
            +PL +      A I+E LI +          AR++A++    TPL  AV+   Q  VQ+LIR   D+  RD +   T LHVA   N
Sbjct:   18 TPLHAAAFLGDAEITELLILS---------GARVNAKDNMWFTPLHRAVASRSQDAVQVLIRHSADVNARD-KNWQTPLHVAAANN 93          
BLAST of Ankyrin repeat domain-containing protein 6 vs. Ensembl Medaka
Match: ankrd44 (ankyrin repeat domain 44 [Source:NCBI gene;Acc:101173198])

HSP 1 Score: 45.4394 bits (106), Expect = 1.661e-6
Identity = 30/86 (34.88%), Postives = 42/86 (48.84%), Query Frame = 3
Query:   39 SPLQSLMIFILALISEFLIPNLHMNLNFQYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKN 296
            +PL +      A I+E LI +          AR++A++    TPL  AV+   Q  VQ+LIR   D+  RD +   T LHVA   N
Sbjct:   43 TPLHAAAFLGDAEITELLILS---------GARVNAKDNMWFTPLHRAVASRSQDAVQVLIRHSADVNARD-KNWQTPLHVAAANN 118          
BLAST of Ankyrin repeat domain-containing protein 6 vs. Ensembl Medaka
Match: ankrd44 (ankyrin repeat domain 44 [Source:NCBI gene;Acc:101173198])

HSP 1 Score: 45.4394 bits (106), Expect = 1.663e-6
Identity = 30/86 (34.88%), Postives = 42/86 (48.84%), Query Frame = 3
Query:   39 SPLQSLMIFILALISEFLIPNLHMNLNFQYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKN 296
            +PL +      A I+E LI +          AR++A++    TPL  AV+   Q  VQ+LIR   D+  RD +   T LHVA   N
Sbjct:   43 TPLHAAAFLGDAEITELLILS---------GARVNAKDNMWFTPLHRAVASRSQDAVQVLIRHSADVNARD-KNWQTPLHVAAANN 118          
BLAST of Ankyrin repeat domain-containing protein 6 vs. Planmine SMEST
Match: SMESG000034407.1 (SMESG000034407.1)

HSP 1 Score: 130.183 bits (326), Expect = 2.400e-37
Identity = 60/62 (96.77%), Postives = 61/62 (98.39%), Query Frame = 3
Query:  120 FQYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVH 305
             +YDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVH
Sbjct:  207 LKYDARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYVH 268          
BLAST of Ankyrin repeat domain-containing protein 6 vs. Planmine SMEST
Match: SMESG000063648.1 (SMESG000063648.1)

HSP 1 Score: 47.3654 bits (111), Expect = 2.605e-7
Identity = 24/52 (46.15%), Postives = 32/52 (61.54%), Query Frame = 3
Query:  132 ARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAV 287
            A I AQN++G TPL   V Y    V +ILI    D+ +R+ + GDTALH+A 
Sbjct:  178 ADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRN-QNGDTALHIAA 228          
BLAST of Ankyrin repeat domain-containing protein 6 vs. Planmine SMEST
Match: SMESG000063648.1 (SMESG000063648.1)

HSP 1 Score: 47.3654 bits (111), Expect = 2.615e-7
Identity = 24/52 (46.15%), Postives = 32/52 (61.54%), Query Frame = 3
Query:  132 ARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAV 287
            A I AQN++G TPL   V Y    V +ILI    D+ +R+ + GDTALH+A 
Sbjct:  211 ADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRN-QNGDTALHIAA 261          
BLAST of Ankyrin repeat domain-containing protein 6 vs. Planmine SMEST
Match: SMESG000063648.1 (SMESG000063648.1)

HSP 1 Score: 47.3654 bits (111), Expect = 2.616e-7
Identity = 24/52 (46.15%), Postives = 32/52 (61.54%), Query Frame = 3
Query:  132 ARIDAQNQWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAV 287
            A I AQN++G TPL   V Y    V +ILI    D+ +R+ + GDTALH+A 
Sbjct:  211 ADISAQNRFGDTPLHTGVRYGHAGVSRILISVSTDINQRN-QNGDTALHIAA 261          
The following BLAST results are available for this feature:
BLAST of Ankyrin repeat domain-containing protein 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
POTEB36.510e-646.30POTE ankyrin domain family member B3 [Source:HGNC ... [more]
POTEC6.510e-646.30POTE ankyrin domain family member C [Source:HGNC S... [more]
POTEB36.573e-646.30POTE ankyrin domain family member B3 [Source:HGNC ... [more]
AC136352.46.573e-646.30POTE ankyrin domain family member B-like [Source:N... [more]
POTEI6.625e-646.30POTE ankyrin domain family member I [Source:HGNC S... [more]
back to top
BLAST of Ankyrin repeat domain-containing protein 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ankyrin repeat domain-containing protein 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ankyrin repeat domain-containing protein 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ankyrin repeat domain-containing protein 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ankyrin repeat domain-containing protein 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ankyrin repeat domain-containing protein 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q4JHE0|XB36_ORYSJ2.592e-636.84Probable E3 ubiquitin-protein ligase XBOS36 OS=Ory... [more]
back to top
BLAST of Ankyrin repeat domain-containing protein 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FMN21.102e-2374.14Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267FMI31.109e-2374.14Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8GY032.967e-2375.44ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A1I8I5G83.370e-2375.44ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A3P8IV699.609e-1960.32ANK_REP_REGION domain-containing protein (Fragment... [more]
back to top
BLAST of Ankyrin repeat domain-containing protein 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ankyrin repeat domain-containing protein 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ankyrin repeat domain-containing protein 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ankyrin repeat domain-containing protein 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO280239.861e-738.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411011.280e-638.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411041.280e-638.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ankyrin repeat domain-containing protein 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ankrd441.660e-634.88ankyrin repeat domain 44 [Source:NCBI gene;Acc:101... [more]
ankrd441.661e-634.88ankyrin repeat domain 44 [Source:NCBI gene;Acc:101... [more]
ankrd441.661e-634.88ankyrin repeat domain 44 [Source:NCBI gene;Acc:101... [more]
ankrd441.663e-634.88ankyrin repeat domain 44 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Ankyrin repeat domain-containing protein 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000034407.12.400e-3796.77SMESG000034407.1[more]
SMESG000063648.12.605e-746.15SMESG000063648.1[more]
SMESG000063648.12.615e-746.15SMESG000063648.1[more]
SMESG000063648.12.616e-746.15SMESG000063648.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020418 ID=SMED30020418|Name=Ankyrin repeat domain-containing protein 6|organism=Schmidtea mediterranea sexual|type=transcript|length=307bp
TTCTTATAAACTTTCCACAGTGTAAGTCTAGTGATACAAGTCCGTTACAG
TCTCTAATGATCTTCATTTTAGCACTTATTTCCGAGTTTTTAATTCCAAA
TTTACATATGAATTTGAATTTCCAGTACGATGCCAGAATAGATGCTCAGA
ATCAGTGGGGTCTCACCCCCCTTATGGAGGCGGTGTCATACAGCCAGCAA
TCTGTCGTTCAAATTCTCATCCGCAGCAAGTGTGATCTGTATAAGCGAGA
CTATAGAACAGGGGACACTGCATTGCATGTAGCGGTGAGAAAGAATTATG
TCCATTA
back to top

protein sequence of SMED30020418-orf-1

>SMED30020418-orf-1 ID=SMED30020418-orf-1|Name=SMED30020418-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=101bp
LINFPQCKSSDTSPLQSLMIFILALISEFLIPNLHMNLNFQYDARIDAQN
QWGLTPLMEAVSYSQQSVVQILIRSKCDLYKRDYRTGDTALHVAVRKNYV
H
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR020683Ankyrin_rpt-contain_dom
IPR002110Ankyrin_rpt
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 42..99
e-value: 7.7E-8
score: 32.8
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 40..101
score: 14.796
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 8..101
e-value: 7.2E-13
score: 50.6
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 38..99
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 52..84
score: 8.683
NoneNo IPR availableTMHMMTMhelixcoord: 15..37