Small conductance calcium-activated potassium channel protein

Overview
NameSmall conductance calcium-activated potassium channel protein
Smed IDSMED30020416
Length (bp)1511
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Small conductance calcium-activated potassium channel protein (SMED30020416) t-SNE clustered cells

Violin plots show distribution of expression levels for Small conductance calcium-activated potassium channel protein (SMED30020416) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Small conductance calcium-activated potassium channel protein (SMED30020416) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Small conductance calcium-activated potassium channel protein (SMED30020416) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020416

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30020416h1SMcG0016257 dd_Smed_v4_8396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30020416h1SMcG0016257 dd_Smed_v4_8396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30020416h1SMcG0016257 dd_Smed_v4_8396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Human
Match: KCNN2 (potassium calcium-activated channel subfamily N member 2 [Source:HGNC Symbol;Acc:HGNC:6291])

HSP 1 Score: 211.846 bits (538), Expect = 4.354e-61
Identity = 140/407 (34.40%), Postives = 244/407 (59.95%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDY------HVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCE-------VTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQ---INARSSLDEISRD----LYHIETNLQSL 1417
            +   L  RR LF  R+ ++ + L+ G+FG+ + +++ ++S          K  + S  +K  I+L+T++L+ LI+VYH  ++++ M      DW++A+   RI     EI++C+  P+P +Y       +  S   S      D I++I M LR YL+ARV++L S L  D S++S  A+N+ + NT+F+ K+ MT+    +L+   I ++I  +W    CE       VT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+     +  D  K +  ++R+ L  I Q+R+++ E+R L D + +++++++ Q    +  S L+E S D    +  +ET L++L
Sbjct:  117 IGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWG-----AYDKASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAK-VRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETL 517          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Human
Match: KCNN3 (potassium calcium-activated channel subfamily N member 3 [Source:HGNC Symbol;Acc:HGNC:6292])

HSP 1 Score: 212.616 bits (540), Expect = 2.339e-60
Identity = 137/414 (33.09%), Postives = 248/414 (59.90%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDY------HVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCE-------VTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQ---------INARSSLDEISRDLYHIETNLQSLRDKLN 1432
            +   L  RR LF  R+ ++ + L+ G+FG+ + +++ ++S          K+ + S  +K  I+L+T++L+ LI+ YH  ++++ +      DW++A+   RI+    E+++C+  P+P +Y       +  S   S  +   D I++I M LR YL+ARV++L S L  D S++S  A+N+ + NT+F+ K+ MT+    +L+   I ++I  +W   VCE       VT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+     +  D  K +  ++R+ L  I Q+R+++ E+R L D + +++++S+ Q         +N RS  +++ + +  +E+ L+ L    N
Sbjct:  266 IGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGLYS-----KDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAK-VRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRS--EDLEKQIGSLESKLEHLTASFN 671          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Human
Match: KCNN2 (potassium calcium-activated channel subfamily N member 2 [Source:HGNC Symbol;Acc:HGNC:6291])

HSP 1 Score: 209.92 bits (533), Expect = 2.352e-60
Identity = 138/409 (33.74%), Postives = 244/409 (59.66%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDY------HVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCE-------VTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKR--QLLYNIRQVRAIRTERRHLLDSSISILEVSRAQ---INARSSLDEISRD----LYHIETNLQSL 1417
            +   L  RR LF  R+ ++ + L+ G+FG+ + +++ ++S          K  + S  +K  I+L+T++L+ LI+VYH  ++++ M      DW++A+   RI     EI++C+  P+P +Y       +  S   S      D I++I M LR YL+ARV++L S L  D S++S  A+N+ + NT+F+ K+ MT+    +L+   I ++I  +W    CE       VT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+     +  D  K   + ++  Q ++  R++R+++ E+R L D + +++++++ Q    +  S L+E S D    +  +ET L++L
Sbjct:  130 IGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWG-----AYDKASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQARKLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETL 533          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Human
Match: KCNN1 (potassium calcium-activated channel subfamily N member 1 [Source:HGNC Symbol;Acc:HGNC:6290])

HSP 1 Score: 206.838 bits (525), Expect = 1.318e-59
Identity = 129/409 (31.54%), Postives = 238/409 (58.19%), Query Frame = 2
Query:  251 STVAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDY------HVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVC-------EVTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKR--QLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLRDKLN 1432
            S V   L  RR LF  R+ ++ + L+ G+FG+ + + + ++S          K  + SF +K  I+L+T +L+ L+V+YH  ++++ M      DW++A+   R+     E+ +C+  P+P  Y       +  +   S  +   D +++I M LR YLL RV++L S +  D S++S  A+N+ + NT+F+ K+ MT+    +L+   I  +I  +W   VC       EVT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+     +  D+ +   + ++  Q ++ ++++R+++ E+  L D + ++ ++++ Q      + E+      +E  L +L  +L+
Sbjct:   87 SNVGHRLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSWGVY-----TKESLYSFALKCLISLSTAILLGLVVLYHAREIQLFMVDNGADDWRIAMTCERVFLISLELAVCAIHPVPGHYRFTWTARLAFTYAPSVAEADVDVLLSIPMFLRLYLLGRVMLLHSKIFTDASSRSIGALNKITFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQARVRKHQRKFLQAIHQVQRLRSVKIEQGKLNDQANTLTDLAKTQTVMYDLVSELHAQHEELEARLATLESRLD 490          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Human
Match: KCNN2 (potassium calcium-activated channel subfamily N member 2 [Source:HGNC Symbol;Acc:HGNC:6291])

HSP 1 Score: 211.075 bits (536), Expect = 2.003e-59
Identity = 140/407 (34.40%), Postives = 244/407 (59.95%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDY------HVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCE-------VTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQ---INARSSLDEISRD----LYHIETNLQSL 1417
            +   L  RR LF  R+ ++ + L+ G+FG+ + +++ ++S          K  + S  +K  I+L+T++L+ LI+VYH  ++++ M      DW++A+   RI     EI++C+  P+P +Y       +  S   S      D I++I M LR YL+ARV++L S L  D S++S  A+N+ + NT+F+ K+ MT+    +L+   I ++I  +W    CE       VT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+     +  D  K +  ++R+ L  I Q+R+++ E+R L D + +++++++ Q    +  S L+E S D    +  +ET L++L
Sbjct:  329 IGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYD-----KASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAK-VRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETL 729          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Celegans
Match: kcnl-2 (KCNN (Potassium K ChaNNel, calcium activated)-Like [Source:UniProtKB/TrEMBL;Acc:G5EDA9])

HSP 1 Score: 194.512 bits (493), Expect = 8.191e-55
Identity = 125/392 (31.89%), Postives = 227/392 (57.91%), Query Frame = 2
Query:  278 RRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDY--HVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCEVTFTFSD---------SMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLR 1420
            R  L   RR ++   L   + G+ L I++N++   Y    G      +S ++KF I  TT  L+  +  +H +++++ M      DW +AL+ RR  +   E++IC   PLP+++    +N   + +  Y  +  ++I+M  R Y L RV++L S +  D S++S + +N+ + N +FI K+ MT+    +L+    F++I   W   +CE  +   D         S+WL A+TFLS+GYGDI+P T CGR++A++TG LG   +++VVA+++ KLELT+ EK++HNF++D++L +QLKH +AN+++  W +++ R   +  D GK +  ++R+ L  I ++R +R ++R L ++ +S+ +V++   N      E+  D++  +  L SLR
Sbjct:  207 REILHEKRRHVSDRALAFAIMGIILMIIENELRTAYVIRPGSS----LSHLLKFFIIFTTTALLSFVGYFHVIEIQLFMNANAADDWMVALSFRRTCQIGLELLICMLCPLPIEFIAPFMNDRFHDKTLYAVNVFLSIMMFFRLYWLCRVMLLHSRVFTDASSRSIAGLNRVNFNARFILKTLMTICPGTMLMIFTAFLWIIAGWILRLCEREYMTPDKYNDINYVNSIWLVAITFLSVGYGDIVPKTNCGRSMAIVTGILGTCASSMVVAVIARKLELTRAEKHVHNFMQDTQLTKQLKHSAANVLRETWFIFKFRKLVEKPDFGK-IRKHQRKFLLAIYEMRRVRRDQRKLAENLVSLGDVAKTSSNTY----ELVHDVHSTQEGL-SLR 588          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Celegans
Match: kcnl-2 (KCNN (Potassium K ChaNNel, calcium activated)-Like [Source:UniProtKB/TrEMBL;Acc:G5EDA9])

HSP 1 Score: 194.512 bits (493), Expect = 1.008e-54
Identity = 125/392 (31.89%), Postives = 227/392 (57.91%), Query Frame = 2
Query:  278 RRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDY--HVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCEVTFTFSD---------SMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLR 1420
            R  L   RR ++   L   + G+ L I++N++   Y    G      +S ++KF I  TT  L+  +  +H +++++ M      DW +AL+ RR  +   E++IC   PLP+++    +N   + +  Y  +  ++I+M  R Y L RV++L S +  D S++S + +N+ + N +FI K+ MT+    +L+    F++I   W   +CE  +   D         S+WL A+TFLS+GYGDI+P T CGR++A++TG LG   +++VVA+++ KLELT+ EK++HNF++D++L +QLKH +AN+++  W +++ R   +  D GK +  ++R+ L  I ++R +R ++R L ++ +S+ +V++   N      E+  D++  +  L SLR
Sbjct:  214 REILHEKRRHVSDRALAFAIMGIILMIIENELRTAYVIRPGSS----LSHLLKFFIIFTTTALLSFVGYFHVIEIQLFMNANAADDWMVALSFRRTCQIGLELLICMLCPLPIEFIAPFMNDRFHDKTLYAVNVFLSIMMFFRLYWLCRVMLLHSRVFTDASSRSIAGLNRVNFNARFILKTLMTICPGTMLMIFTAFLWIIAGWILRLCEREYMTPDKYNDINYVNSIWLVAITFLSVGYGDIVPKTNCGRSMAIVTGILGTCASSMVVAVIARKLELTRAEKHVHNFMQDTQLTKQLKHSAANVLRETWFIFKFRKLVEKPDFGK-IRKHQRKFLLAIYEMRRVRRDQRKLAENLVSLGDVAKTSSNTY----ELVHDVHSTQEGL-SLR 595          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Celegans
Match: kcnl-2 (KCNN (Potassium K ChaNNel, calcium activated)-Like [Source:UniProtKB/TrEMBL;Acc:G5EDA9])

HSP 1 Score: 194.512 bits (493), Expect = 1.391e-54
Identity = 125/392 (31.89%), Postives = 227/392 (57.91%), Query Frame = 2
Query:  278 RRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDY--HVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCEVTFTFSD---------SMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLR 1420
            R  L   RR ++   L   + G+ L I++N++   Y    G      +S ++KF I  TT  L+  +  +H +++++ M      DW +AL+ RR  +   E++IC   PLP+++    +N   + +  Y  +  ++I+M  R Y L RV++L S +  D S++S + +N+ + N +FI K+ MT+    +L+    F++I   W   +CE  +   D         S+WL A+TFLS+GYGDI+P T CGR++A++TG LG   +++VVA+++ KLELT+ EK++HNF++D++L +QLKH +AN+++  W +++ R   +  D GK +  ++R+ L  I ++R +R ++R L ++ +S+ +V++   N      E+  D++  +  L SLR
Sbjct:  234 REILHEKRRHVSDRALAFAIMGIILMIIENELRTAYVIRPGSS----LSHLLKFFIIFTTTALLSFVGYFHVIEIQLFMNANAADDWMVALSFRRTCQIGLELLICMLCPLPIEFIAPFMNDRFHDKTLYAVNVFLSIMMFFRLYWLCRVMLLHSRVFTDASSRSIAGLNRVNFNARFILKTLMTICPGTMLMIFTAFLWIIAGWILRLCEREYMTPDKYNDINYVNSIWLVAITFLSVGYGDIVPKTNCGRSMAIVTGILGTCASSMVVAVIARKLELTRAEKHVHNFMQDTQLTKQLKHSAANVLRETWFIFKFRKLVEKPDFGK-IRKHQRKFLLAIYEMRRVRRDQRKLAENLVSLGDVAKTSSNTY----ELVHDVHSTQEGL-SLR 615          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Celegans
Match: kcnl-2 (KCNN (Potassium K ChaNNel, calcium activated)-Like [Source:UniProtKB/TrEMBL;Acc:G5EDA9])

HSP 1 Score: 194.126 bits (492), Expect = 1.452e-54
Identity = 125/392 (31.89%), Postives = 227/392 (57.91%), Query Frame = 2
Query:  278 RRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDY--HVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCEVTFTFSD---------SMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLR 1420
            R  L   RR ++   L   + G+ L I++N++   Y    G      +S ++KF I  TT  L+  +  +H +++++ M      DW +AL+ RR  +   E++IC   PLP+++    +N   + +  Y  +  ++I+M  R Y L RV++L S +  D S++S + +N+ + N +FI K+ MT+    +L+    F++I   W   +CE  +   D         S+WL A+TFLS+GYGDI+P T CGR++A++TG LG   +++VVA+++ KLELT+ EK++HNF++D++L +QLKH +AN+++  W +++ R   +  D GK +  ++R+ L  I ++R +R ++R L ++ +S+ +V++   N      E+  D++  +  L SLR
Sbjct:  214 REILHEKRRHVSDRALAFAIMGIILMIIENELRTAYVIRPGSS----LSHLLKFFIIFTTTALLSFVGYFHVIEIQLFMNANAADDWMVALSFRRTCQIGLELLICMLCPLPIEFIAPFMNDRFHDKTLYAVNVFLSIMMFFRLYWLCRVMLLHSRVFTDASSRSIAGLNRVNFNARFILKTLMTICPGTMLMIFTAFLWIIAGWILRLCEREYMTPDKYNDINYVNSIWLVAITFLSVGYGDIVPKTNCGRSMAIVTGILGTCASSMVVAVIARKLELTRAEKHVHNFMQDTQLTKQLKHSAANVLRETWFIFKFRKLVEKPDFGK-IRKHQRKFLLAIYEMRRVRRDQRKLAENLVSLGDVAKTSSNTY----ELVHDVHSTQEGL-SLR 595          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Celegans
Match: kcnl-2 (KCNN (Potassium K ChaNNel, calcium activated)-Like [Source:UniProtKB/TrEMBL;Acc:G5EDA9])

HSP 1 Score: 194.126 bits (492), Expect = 1.787e-54
Identity = 125/392 (31.89%), Postives = 227/392 (57.91%), Query Frame = 2
Query:  278 RRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDY--HVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCEVTFTFSD---------SMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLR 1420
            R  L   RR ++   L   + G+ L I++N++   Y    G      +S ++KF I  TT  L+  +  +H +++++ M      DW +AL+ RR  +   E++IC   PLP+++    +N   + +  Y  +  ++I+M  R Y L RV++L S +  D S++S + +N+ + N +FI K+ MT+    +L+    F++I   W   +CE  +   D         S+WL A+TFLS+GYGDI+P T CGR++A++TG LG   +++VVA+++ KLELT+ EK++HNF++D++L +QLKH +AN+++  W +++ R   +  D GK +  ++R+ L  I ++R +R ++R L ++ +S+ +V++   N      E+  D++  +  L SLR
Sbjct:  214 REILHEKRRHVSDRALAFAIMGIILMIIENELRTAYVIRPGSS----LSHLLKFFIIFTTTALLSFVGYFHVIEIQLFMNANAADDWMVALSFRRTCQIGLELLICMLCPLPIEFIAPFMNDRFHDKTLYAVNVFLSIMMFFRLYWLCRVMLLHSRVFTDASSRSIAGLNRVNFNARFILKTLMTICPGTMLMIFTAFLWIIAGWILRLCEREYMTPDKYNDINYVNSIWLVAITFLSVGYGDIVPKTNCGRSMAIVTGILGTCASSMVVAVIARKLELTRAEKHVHNFMQDTQLTKQLKHSAANVLRETWFIFKFRKLVEKPDFGK-IRKHQRKFLLAIYEMRRVRRDQRKLAENLVSLGDVAKTSSNTY----ELVHDVHSTQEGL-SLR 595          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Fly
Match: SK (gene:FBgn0029761 transcript:FBtr0301949)

HSP 1 Score: 206.838 bits (525), Expect = 3.771e-60
Identity = 136/406 (33.50%), Postives = 241/406 (59.36%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYHVVNSLVYSEKQYT-------YDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCEVTFTFSD--------SMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLRDKL 1429
            V   L  R+ LF  R+ ++ + LV+G+FG+ + +++N++S          K    S  +K  I+++TV+L+ LIV YH +++++ M      DW++A+  +RI +   E+ IC+  P+P +Y+   +   + K  T       YD  +++ M LR YL+ RV++L S L  D S++S  A+N+ + NT+F+ K+ MT+    +L+  ++ ++I  SW    CE    F D        SMWLTA+TFL +GYGDI+P T CGR + +  G +GAGCTAL+VA+VS KLELT+ EK++HNF+ D++L ++LK+ +AN+++  W +Y+     +  + G+   + +R+ L  I  +R ++ ++R L+D++ +I ++++ Q      + ++S     IE  L +L DK+
Sbjct:   63 VGYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENELS----SAGVYTKASFYSTALKTLISVSTVILLGLIVAYHALEVQLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEYYFQWTTKLANKNKTIGTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCE---RFHDEEHANLLNSMWLTAITFLCVGYGDIVPNTYCGRGITLTCGMVGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTH-QRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIISDMSSRQDAIEERLTNLEDKM 460          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Fly
Match: SK (gene:FBgn0029761 transcript:FBtr0301952)

HSP 1 Score: 206.453 bits (524), Expect = 1.542e-59
Identity = 136/406 (33.50%), Postives = 241/406 (59.36%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYHVVNSLVYSEKQYT-------YDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCEVTFTFSD--------SMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLRDKL 1429
            V   L  R+ LF  R+ ++ + LV+G+FG+ + +++N++S          K    S  +K  I+++TV+L+ LIV YH +++++ M      DW++A+  +RI +   E+ IC+  P+P +Y+   +   + K  T       YD  +++ M LR YL+ RV++L S L  D S++S  A+N+ + NT+F+ K+ MT+    +L+  ++ ++I  SW    CE    F D        SMWLTA+TFL +GYGDI+P T CGR + +  G +GAGCTAL+VA+VS KLELT+ EK++HNF+ D++L ++LK+ +AN+++  W +Y+     +  + G+   + +R+ L  I  +R ++ ++R L+D++ +I ++++ Q      + ++S     IE  L +L DK+
Sbjct:   63 VGYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENELS----SAGVYTKASFYSTALKTLISVSTVILLGLIVAYHALEVQLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEYYFQWTTKLANKNKTIGTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCE---RFHDEEHANLLNSMWLTAITFLCVGYGDIVPNTYCGRGITLTCGMVGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTH-QRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIISDMSSRQDAIEERLTNLEDKM 460          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Fly
Match: SK (gene:FBgn0029761 transcript:FBtr0301954)

HSP 1 Score: 206.068 bits (523), Expect = 1.554e-58
Identity = 138/407 (33.91%), Postives = 244/407 (59.95%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYHVVNSLVYSEKQYT-------YDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCEVTFTFSD--------SMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYR-LRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLRDKL 1429
            V   L  R+ LF  R+ ++ + LV+G+FG+ + +++N++S          K    S  +K  I+++TV+L+ LIV YH +++++ M      DW++A+  +RI +   E+ IC+  P+P +Y+   +   + K  T       YD  +++ M LR YL+ RV++L S L  D S++S  A+N+ + NT+F+ K+ MT+    +L+  ++ ++I  SW    CE    F D        SMWLTA+TFL +GYGDI+P T CGR + +  G +GAGCTAL+VA+VS KLELT+ EK++HNF+ D++L ++LK+ +AN+++  W +Y+  R  K++ + G+   + +R+ L  I  +R ++ ++R L+D++ +I ++++ Q      + ++S     IE  L +L DK+
Sbjct:  226 VGYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENELS----SAGVYTKASFYSTALKTLISVSTVILLGLIVAYHALEVQLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEYYFQWTTKLANKNKTIGTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCE---RFHDEEHANLLNSMWLTAITFLCVGYGDIVPNTYCGRGITLTCGMVGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRV-NPGRVRTH-QRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIISDMSSRQDAIEERLTNLEDKM 623          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Fly
Match: SK (gene:FBgn0029761 transcript:FBtr0300467)

HSP 1 Score: 201.445 bits (511), Expect = 4.407e-58
Identity = 136/408 (33.33%), Postives = 244/408 (59.80%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYN--ISDWKLALNIRRIIKFITEIVICSCQPLPVDYHVVNSLVYSEKQYT-------YDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCEVTFTFSD--------SMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLRDKL 1429
            V   L  R+ LF  R+ ++ + LV+G+FG+ + +++N++S          K    S  +K  I+++TV+L+ LIV YH +++++ +   +    DW++A+  +RI +   E+ IC+  P+P +Y+   +   + K  T       YD  +++ M LR YL+ RV++L S L  D S++S  A+N+ + NT+F+ K+ MT+    +L+  ++ ++I  SW    CE    F D        +MWL A+TFLS+G+GDI+P T CGR +AV TG +GAGCTAL+VA+VS KLELT+ EK++HNF+ D++L ++LK+ +AN+++  W +Y+     +  + G+   + +R+ L  I  +R ++ ++R L+D++ +I ++++ Q      + ++S     IE  L +L DK+
Sbjct:   63 VGYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENELS----SAGVYTKASFYSTALKTLISVSTVILLGLIVAYHALEVQVRLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEYYFQWTTKLANKNKTIGTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCE---RFHDEEHANLLNAMWLIAITFLSVGFGDIVPNTYCGRGIAVSTGIMGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTH-QRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIISDMSSRQDAIEERLTNLEDKM 462          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Fly
Match: SK (gene:FBgn0029761 transcript:FBtr0344557)

HSP 1 Score: 204.527 bits (519), Expect = 1.432e-57
Identity = 139/409 (33.99%), Postives = 245/409 (59.90%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLN--YNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYHVVNSLVYSEKQYT-------YDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCEVTFTFSD--------SMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYR-LRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLRDKL 1429
            V   L  R+ LF  R+ ++ + LV+G+FG+ + +++N++S    Y       K    S  +K  I+++TV+L+ LIV YH +++++ M      DW++A+  +RI +   E+ IC+  P+P +Y+   +   + K  T       YD  +++ M LR YL+ RV++L S L  D S++S  A+N+ + NT+F+ K+ MT+    +L+  ++ ++I  SW    CE    F D        SMWLTA+TFL +GYGDI+P T CGR + +  G +GAGCTAL+VA+VS KLELT+ EK++HNF+ D++L ++LK+ +AN+++  W +Y+  R  K++ + G+   + +R+ L  I  +R ++ ++R L+D++ +I ++++ Q      + ++S     IE  L +L DK+
Sbjct:   63 VGYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENELSSAGVYT------KASFYSTALKTLISVSTVILLGLIVAYHALEVQLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEYYFQWTTKLANKNKTIGTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCE---RFHDEEHANLLNSMWLTAITFLCVGYGDIVPNTYCGRGITLTCGMVGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRV-NPGRVRTH-QRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIISDMSSRQDAIEERLTNLEDKM 460          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Zebrafish
Match: kcnn1b (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1b [Source:ZFIN;Acc:ZDB-GENE-060503-397])

HSP 1 Score: 213.386 bits (542), Expect = 3.314e-62
Identity = 139/413 (33.66%), Postives = 244/413 (59.08%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDY------HVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVC-------EVTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQ---------INARSSLDEISRDLYHIETNLQSLRDKL 1429
            +   L  RR LF  R+ ++ + L+ G+FG+ + + + ++S          K    SF +K  I+L+TV+L+ LI++YH  ++++ M      DW++A+   RI+  + E+++C+  P+P  Y       +  +   S      D I++I M LR YL+ RV++L S L  D S++S  A+N+ + NT+F+ K+ MT+    +L+   I  +I  +W   VC       EVT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+     +  D  K +  ++R+ L  I Q+R+++ E+R L D + +++++++ Q         +  RS  +E+ + + H+ET L S+   L
Sbjct:   78 IGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSWGVY-----TKESSYSFALKCLISLSTVILLCLIIMYHAREIQLFMVDNGADDWRIAMTYERILFIVLELLVCAIHPIPGQYVFTWTARLAFTYTPSVADADVDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVHVCERYHDKVEVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAK-VRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLVSELQERS--EELEKRIGHLETKLDSINSSL 482          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Zebrafish
Match: kcnn1a (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1a [Source:ZFIN;Acc:ZDB-GENE-070912-703])

HSP 1 Score: 211.46 bits (537), Expect = 1.481e-61
Identity = 136/405 (33.58%), Postives = 240/405 (59.26%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDY------HVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVC-------EVTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLRDKLN 1432
            +   L  RR LF  R+ ++ + L+ G+FG+ + + + ++S          K    SF +K  I+L+TV+L+ LI++YH  ++++ M      DW++A+   RI   + E+++C+  P+P  Y       +  + V S      D I++I M LR YL+ RV++L S L  D S++S  A+N+ + NT+F+ K+ MT+    +L+   I  +I  +W   VC       EVT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+     +  D  K +  ++R+ L  I Q+R+++ E+R L D + +++++++ Q      + E+      ++  + +L DKL+
Sbjct:   77 IGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSWGVYT-----KESSYSFALKCLISLSTVILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFIVLELLVCAIHPIPGQYVFTWTARLAFTYVPSVADADVDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAK-VRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLVSELQERSEELDKRIGTLEDKLD 475          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Zebrafish
Match: kcnn1b (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1b [Source:ZFIN;Acc:ZDB-GENE-060503-397])

HSP 1 Score: 210.305 bits (534), Expect = 5.474e-61
Identity = 136/415 (32.77%), Postives = 244/415 (58.80%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDY------HVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVC-------EVTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKR--QLLYNIRQVRAIRTERRHLLDSSISILEVSRAQ---------INARSSLDEISRDLYHIETNLQSLRDKL 1429
            +   L  RR LF  R+ ++ + L+ G+FG+ + + + ++S          K    SF +K  I+L+TV+L+ LI++YH  ++++ M      DW++A+   RI+  + E+++C+  P+P  Y       +  +   S      D I++I M LR YL+ RV++L S L  D S++S  A+N+ + NT+F+ K+ MT+    +L+   I  +I  +W   VC       EVT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+     +  D  K   + ++  Q ++  +++R+++ E+R L D + +++++++ Q         +  RS  +E+ + + H+ET L S+   L
Sbjct:   78 IGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSWGVY-----TKESSYSFALKCLISLSTVILLCLIIMYHAREIQLFMVDNGADDWRIAMTYERILFIVLELLVCAIHPIPGQYVFTWTARLAFTYTPSVADADVDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVHVCERYHDKVEVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAKVRKHQRKFLQAIHQAQKLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLVSELQERS--EELEKRIGHLETKLDSINSSL 485          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Zebrafish
Match: kcnn3 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 3 [Source:ZFIN;Acc:ZDB-GENE-100921-56])

HSP 1 Score: 207.994 bits (528), Expect = 1.233e-58
Identity = 134/415 (32.29%), Postives = 250/415 (60.24%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDY------HVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCE-------VTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYR-LRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQ---------INARSSLDEISRDLYHIETNLQSLRDKLN 1432
            +   L  RR LF  R+ ++ + L+ G+FG+ + +++ ++S          K+ + S  +K  I+L+T++L+ LI+ YH  ++++ +      DW++A+ + R++    E+++ +  P+P D+       +  S   S+ +   D ++++ M LR YL+ARV++L S L  D S++S  A+N+   NT+F+ K+ MT+    +L+   I ++I  +W   VCE       VT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+  +  K+I D  + +  ++R+ L  I Q+R+++ E+R L D + +++++S+ Q         +N RS  +++ R +  +E  ++ L    N
Sbjct:  293 IGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGVYS-----KSSMYSLALKCLISLSTIILLGLIIAYHAREVQLFVIDNGADDWRIAMTMERVLLIALELIVSAVHPVPGDFKFMWRARLAFSYAPSQAEADLDMVLSVPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKVHFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDAQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLMKKI-DHSR-VRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQSVMYELMSELNDRS--EDLERQMLSLEQRVERLTAGFN 698          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Zebrafish
Match: kcnn3 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 3 [Source:ZFIN;Acc:ZDB-GENE-100921-56])

HSP 1 Score: 207.994 bits (528), Expect = 1.233e-58
Identity = 134/415 (32.29%), Postives = 250/415 (60.24%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDY------HVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCE-------VTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYR-LRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQ---------INARSSLDEISRDLYHIETNLQSLRDKLN 1432
            +   L  RR LF  R+ ++ + L+ G+FG+ + +++ ++S          K+ + S  +K  I+L+T++L+ LI+ YH  ++++ +      DW++A+ + R++    E+++ +  P+P D+       +  S   S+ +   D ++++ M LR YL+ARV++L S L  D S++S  A+N+   NT+F+ K+ MT+    +L+   I ++I  +W   VCE       VT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+  +  K+I D  + +  ++R+ L  I Q+R+++ E+R L D + +++++S+ Q         +N RS  +++ R +  +E  ++ L    N
Sbjct:  293 IGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGVYS-----KSSMYSLALKCLISLSTIILLGLIIAYHAREVQLFVIDNGADDWRIAMTMERVLLIALELIVSAVHPVPGDFKFMWRARLAFSYAPSQAEADLDMVLSVPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKVHFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDAQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLMKKI-DHSR-VRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQSVMYELMSELNDRS--EDLERQMLSLEQRVERLTAGFN 698          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Xenopus
Match: KCNN2 (potassium channel, calcium activated intermediate/small conductance subfamily N alpha, member 2 [Source:NCBI gene;Acc:100145581])

HSP 1 Score: 210.305 bits (534), Expect = 5.880e-60
Identity = 140/408 (34.31%), Postives = 245/408 (60.05%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLN-YNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDY------HVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCE-------VTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQ---INARSSLDEISRDLYH----IETNLQSL 1417
            +   L  RR LF  R+ ++ + L+ G+FG+ + +++ ++S   Y+      K  + S  +K  I+L+T++L+ LI+VYH  ++++ M      DW++A+   RI     EI++C+  P+P +Y       +  S   S      D I++I M LR YL+ARV++L S L  D S++S  A+N+ + NT+F+ K+ MT+    +L+   I ++I  +W    CE       VT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+     +  D  + +  ++R+ L  I Q+R+++ E+R L D + +++++++ Q    +  S L+E S D       +ET L++L
Sbjct:  199 IGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYD------KGSLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYTPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAR-VRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVVLETKLETL 599          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Xenopus
Match: KCNN2 (potassium channel, calcium activated intermediate/small conductance subfamily N alpha, member 2 [Source:NCBI gene;Acc:100145581])

HSP 1 Score: 209.92 bits (533), Expect = 2.305e-59
Identity = 140/408 (34.31%), Postives = 245/408 (60.05%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLN-YNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDY------HVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCE-------VTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQ---INARSSLDEISRDLYH----IETNLQSL 1417
            +   L  RR LF  R+ ++ + L+ G+FG+ + +++ ++S   Y+      K  + S  +K  I+L+T++L+ LI+VYH  ++++ M      DW++A+   RI     EI++C+  P+P +Y       +  S   S      D I++I M LR YL+ARV++L S L  D S++S  A+N+ + NT+F+ K+ MT+    +L+   I ++I  +W    CE       VT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+     +  D  + +  ++R+ L  I Q+R+++ E+R L D + +++++++ Q    +  S L+E S D       +ET L++L
Sbjct:  278 IGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYD------KGSLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYTPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAR-VRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVVLETKLETL 678          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Xenopus
Match: KCNN2 (potassium channel, calcium activated intermediate/small conductance subfamily N alpha, member 2 [Source:NCBI gene;Acc:100145581])

HSP 1 Score: 209.534 bits (532), Expect = 3.245e-59
Identity = 140/408 (34.31%), Postives = 245/408 (60.05%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLN-YNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDY------HVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCE-------VTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQ---INARSSLDEISRDLYH----IETNLQSL 1417
            +   L  RR LF  R+ ++ + L+ G+FG+ + +++ ++S   Y+      K  + S  +K  I+L+T++L+ LI+VYH  ++++ M      DW++A+   RI     EI++C+  P+P +Y       +  S   S      D I++I M LR YL+ARV++L S L  D S++S  A+N+ + NT+F+ K+ MT+    +L+   I ++I  +W    CE       VT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+     +  D  + +  ++R+ L  I Q+R+++ E+R L D + +++++++ Q    +  S L+E S D       +ET L++L
Sbjct:  289 IGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYD------KGSLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYTPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAR-VRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVVLETKLETL 689          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Xenopus
Match: wdr17 (WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-1000178])

HSP 1 Score: 203.756 bits (517), Expect = 1.226e-58
Identity = 142/426 (33.33%), Postives = 242/426 (56.81%), Query Frame = 2
Query:  203 GKPYESQQSSIDVSLFSTVAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYHV--VNSLVY----SEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVC-------EVTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQ---INARSSLDEISRDLYHIETNLQSLRDKLN 1432
            G    SQ++         V   L  RR LF  R+ ++ + L+ G+FG+ + + + ++S          K    SF +K  I+L+T +L+ LI++YH  ++++ M      DW++A+   RI     E+ +C+  P+P  Y       L +    S      D I++I M LR YL+ RV++L S L  D S++S  A+N+ + NT+F+ K+ MT+    +L+   I  +I  +W   VC       EVT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L++++K+ +AN+++  W +Y+     +  D  K +  ++R+ L  I  +R+++ E+R L D + +++++++ Q    +  S L E + DL      L++  D LN
Sbjct:   61 GVEEGSQEAPRGQKKNQNVGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSWGVYT-----KESSYSFALKCLISLSTAILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFITLELTVCAIHPIPGQYSFTWTARLAFFYTTSVANADIDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLSKRVKNAAANVLRETWLIYKHTKLVRKIDHAK-VRKHQRKFLQAIHLLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLMSELQERNEDLEKRIITLETKIDSLN 480          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Xenopus
Match: wdr17 (WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-1000178])

HSP 1 Score: 203.371 bits (516), Expect = 2.097e-58
Identity = 139/408 (34.07%), Postives = 237/408 (58.09%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYHV--VNSLVY----SEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVC-------EVTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQ---INARSSLDEISRDLYHIETNLQSLRDKLN 1432
            V   L  RR LF  R+ ++ + L+ G+FG+ + + + ++S          K    SF +K  I+L+T +L+ LI++YH  ++++ M      DW++A+   RI     E+ +C+  P+P  Y       L +    S      D I++I M LR YL+ RV++L S L  D S++S  A+N+ + NT+F+ K+ MT+    +L+   I  +I  +W   VC       EVT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L++++K+ +AN+++  W +Y+     +  D  K +  ++R+ L  I  +R+++ E+R L D + +++++++ Q    +  S L E + DL      L++  D LN
Sbjct:   71 VGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSWGVYT-----KESSYSFALKCLISLSTAILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFITLELTVCAIHPIPGQYSFTWTARLAFFYTTSVANADIDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLSKRVKNAAANVLRETWLIYKHTKLVRKIDHAK-VRKHQRKFLQAIHLLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLMSELQERNEDLEKRIITLETKIDSLN 472          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Mouse
Match: Kcnn1 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1 [Source:MGI Symbol;Acc:MGI:1933993])

HSP 1 Score: 222.631 bits (566), Expect = 9.906e-66
Identity = 138/407 (33.91%), Postives = 246/407 (60.44%), Query Frame = 2
Query:  251 STVAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYH------VVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVC-------EVTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLRDKLN 1432
             TV+  L  RR LF  R+ ++ + L+ G+FG+ + + + ++S          K  + SF +K  I+L+TV+L+ L+++YH  ++++ +      DW++A+   R+     E+V+C+  P+P  Y       +  SLV S  +   D +++I M LR YLLARV++L S +  D S++S  A+N+ + NT+F+ K+ MT+    +L+   +  +I  +W   VC       EVT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+     +  D+G+ +  ++R+ L  I Q+R+++ E+  + D + ++ E+++AQ  A   + E+      +E  L +L  +L+
Sbjct:   85 PTVSHRLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSWGVY-----TKESLCSFALKCLISLSTVILLGLVILYHAREIQLFLVDNGADDWRIAMTWERVSLISLELVVCAIHPVPGHYRFTWTARLAFSLVPSAAEADLDVLLSIPMFLRLYLLARVMLLHSRIFTDASSRSIGALNRVTFNTRFVTKTLMTICPGTVLLVFSVSSWIVAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQGR-VRKHQRKFLQAIHQLRSVKIEQGKVNDQANTLAELAKAQSIAYEVVSELQAQQEELEARLAALESRLD 485          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Mouse
Match: Kcnn1 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1 [Source:MGI Symbol;Acc:MGI:1933993])

HSP 1 Score: 222.631 bits (566), Expect = 9.906e-66
Identity = 138/407 (33.91%), Postives = 246/407 (60.44%), Query Frame = 2
Query:  251 STVAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYH------VVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVC-------EVTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLRDKLN 1432
             TV+  L  RR LF  R+ ++ + L+ G+FG+ + + + ++S          K  + SF +K  I+L+TV+L+ L+++YH  ++++ +      DW++A+   R+     E+V+C+  P+P  Y       +  SLV S  +   D +++I M LR YLLARV++L S +  D S++S  A+N+ + NT+F+ K+ MT+    +L+   +  +I  +W   VC       EVT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+     +  D+G+ +  ++R+ L  I Q+R+++ E+  + D + ++ E+++AQ  A   + E+      +E  L +L  +L+
Sbjct:   85 PTVSHRLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSWGVY-----TKESLCSFALKCLISLSTVILLGLVILYHAREIQLFLVDNGADDWRIAMTWERVSLISLELVVCAIHPVPGHYRFTWTARLAFSLVPSAAEADLDVLLSIPMFLRLYLLARVMLLHSRIFTDASSRSIGALNRVTFNTRFVTKTLMTICPGTVLLVFSVSSWIVAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQGR-VRKHQRKFLQAIHQLRSVKIEQGKVNDQANTLAELAKAQSIAYEVVSELQAQQEELEARLAALESRLD 485          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Mouse
Match: Kcnn1 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1 [Source:MGI Symbol;Acc:MGI:1933993])

HSP 1 Score: 219.55 bits (558), Expect = 1.534e-64
Identity = 135/409 (33.01%), Postives = 246/409 (60.15%), Query Frame = 2
Query:  251 STVAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYH------VVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVC-------EVTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKR--QLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLRDKLN 1432
             TV+  L  RR LF  R+ ++ + L+ G+FG+ + + + ++S          K  + SF +K  I+L+TV+L+ L+++YH  ++++ +      DW++A+   R+     E+V+C+  P+P  Y       +  SLV S  +   D +++I M LR YLLARV++L S +  D S++S  A+N+ + NT+F+ K+ MT+    +L+   +  +I  +W   VC       EVT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+     +  D+G+   + ++  Q ++  +++R+++ E+  + D + ++ E+++AQ  A   + E+      +E  L +L  +L+
Sbjct:   85 PTVSHRLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSWGVY-----TKESLCSFALKCLISLSTVILLGLVILYHAREIQLFLVDNGADDWRIAMTWERVSLISLELVVCAIHPVPGHYRFTWTARLAFSLVPSAAEADLDVLLSIPMFLRLYLLARVMLLHSRIFTDASSRSIGALNRVTFNTRFVTKTLMTICPGTVLLVFSVSSWIVAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQGRVRKHQRKFLQAIHQAQKLRSVKIEQGKVNDQANTLAELAKAQSIAYEVVSELQAQQEELEARLAALESRLD 488          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Mouse
Match: Kcnn1 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1 [Source:MGI Symbol;Acc:MGI:1933993])

HSP 1 Score: 219.55 bits (558), Expect = 1.534e-64
Identity = 135/409 (33.01%), Postives = 246/409 (60.15%), Query Frame = 2
Query:  251 STVAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYH------VVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVC-------EVTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKR--QLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLRDKLN 1432
             TV+  L  RR LF  R+ ++ + L+ G+FG+ + + + ++S          K  + SF +K  I+L+TV+L+ L+++YH  ++++ +      DW++A+   R+     E+V+C+  P+P  Y       +  SLV S  +   D +++I M LR YLLARV++L S +  D S++S  A+N+ + NT+F+ K+ MT+    +L+   +  +I  +W   VC       EVT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+     +  D+G+   + ++  Q ++  +++R+++ E+  + D + ++ E+++AQ  A   + E+      +E  L +L  +L+
Sbjct:   85 PTVSHRLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSWGVY-----TKESLCSFALKCLISLSTVILLGLVILYHAREIQLFLVDNGADDWRIAMTWERVSLISLELVVCAIHPVPGHYRFTWTARLAFSLVPSAAEADLDVLLSIPMFLRLYLLARVMLLHSRIFTDASSRSIGALNRVTFNTRFVTKTLMTICPGTVLLVFSVSSWIVAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQGRVRKHQRKFLQAIHQAQKLRSVKIEQGKVNDQANTLAELAKAQSIAYEVVSELQAQQEELEARLAALESRLD 488          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Mouse
Match: Kcnn1 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1 [Source:MGI Symbol;Acc:MGI:1933993])

HSP 1 Score: 219.55 bits (558), Expect = 1.534e-64
Identity = 135/409 (33.01%), Postives = 246/409 (60.15%), Query Frame = 2
Query:  251 STVAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYH------VVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVC-------EVTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKR--QLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLRDKLN 1432
             TV+  L  RR LF  R+ ++ + L+ G+FG+ + + + ++S          K  + SF +K  I+L+TV+L+ L+++YH  ++++ +      DW++A+   R+     E+V+C+  P+P  Y       +  SLV S  +   D +++I M LR YLLARV++L S +  D S++S  A+N+ + NT+F+ K+ MT+    +L+   +  +I  +W   VC       EVT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+     +  D+G+   + ++  Q ++  +++R+++ E+  + D + ++ E+++AQ  A   + E+      +E  L +L  +L+
Sbjct:   85 PTVSHRLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSWGVY-----TKESLCSFALKCLISLSTVILLGLVILYHAREIQLFLVDNGADDWRIAMTWERVSLISLELVVCAIHPVPGHYRFTWTARLAFSLVPSAAEADLDVLLSIPMFLRLYLLARVMLLHSRIFTDASSRSIGALNRVTFNTRFVTKTLMTICPGTVLLVFSVSSWIVAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQGRVRKHQRKFLQAIHQAQKLRSVKIEQGKVNDQANTLAELAKAQSIAYEVVSELQAQQEELEARLAALESRLD 488          
BLAST of Small conductance calcium-activated potassium channel protein vs. UniProt/SwissProt
Match: sp|Q9EQR3|KCNN1_MOUSE (Small conductance calcium-activated potassium channel protein 1 OS=Mus musculus OX=10090 GN=Kcnn1 PE=1 SV=2)

HSP 1 Score: 219.55 bits (558), Expect = 1.095e-63
Identity = 135/409 (33.01%), Postives = 246/409 (60.15%), Query Frame = 2
Query:  251 STVAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYH------VVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVC-------EVTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKR--QLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLRDKLN 1432
             TV+  L  RR LF  R+ ++ + L+ G+FG+ + + + ++S          K  + SF +K  I+L+TV+L+ L+++YH  ++++ +      DW++A+   R+     E+V+C+  P+P  Y       +  SLV S  +   D +++I M LR YLLARV++L S +  D S++S  A+N+ + NT+F+ K+ MT+    +L+   +  +I  +W   VC       EVT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+     +  D+G+   + ++  Q ++  +++R+++ E+  + D + ++ E+++AQ  A   + E+      +E  L +L  +L+
Sbjct:   84 PTVSHRLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSWGVY-----TKESLCSFALKCLISLSTVILLGLVILYHAREIQLFLVDNGADDWRIAMTWERVSLISLELVVCAIHPVPGHYRFTWTARLAFSLVPSAAEADLDVLLSIPMFLRLYLLARVMLLHSRIFTDASSRSIGALNRVTFNTRFVTKTLMTICPGTVLLVFSVSSWIVAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQGRVRKHQRKFLQAIHQAQKLRSVKIEQGKVNDQANTLAELAKAQSIAYEVVSELQAQQEELEARLAALESRLD 487          
BLAST of Small conductance calcium-activated potassium channel protein vs. UniProt/SwissProt
Match: sp|P70606|KCNN1_RAT (Small conductance calcium-activated potassium channel protein 1 OS=Rattus norvegicus OX=10116 GN=Kcnn1 PE=1 SV=2)

HSP 1 Score: 212.616 bits (540), Expect = 3.522e-61
Identity = 133/409 (32.52%), Postives = 243/409 (59.41%), Query Frame = 2
Query:  251 STVAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYH------VVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVC-------EVTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKR--QLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLRDKLN 1432
             TV+  L  RR LF  R+ ++ + L+ G+FG+ + + + ++S          K  + SF +K  I+L+TV+L+ L+++YH  ++++ +      DW++A+   R+     E+ +C+  P+P  Y       +  SLV S  +   D +++I M LR YLLARV++L S +  D S++S  A+N+ + NT+F+ K+ MT+    +L+   I  +I  +W   VC       EVT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+     +  D+ +   + ++  Q ++  +++R ++ E+  + D + ++ ++++AQ  A   + E+      +E  L +L  +L+
Sbjct:   83 PTVSHRLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSWGVY-----TKESLCSFALKCLISLSTVILLGLVILYHAREIQLFLVDNGADDWRIAMTWERVSLISLELAVCAIHPVPGHYRFTWTARLAFSLVPSAAEADVDVLLSIPMFLRLYLLARVMLLHSRIFTDASSRSIGALNRVTFNTRFVTKTLMTICPGTVLLVFSISSWIVAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQSRVRKHQRKFLQAIHQAQKLRTVKIEQGKVNDQANTLADLAKAQSIAYEVVSELQAQQEELEARLAALESRLD 486          
BLAST of Small conductance calcium-activated potassium channel protein vs. UniProt/SwissProt
Match: sp|Q9H2S1|KCNN2_HUMAN (Small conductance calcium-activated potassium channel protein 2 OS=Homo sapiens OX=9606 GN=KCNN2 PE=1 SV=2)

HSP 1 Score: 211.846 bits (538), Expect = 2.091e-60
Identity = 140/407 (34.40%), Postives = 244/407 (59.95%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDY------HVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCE-------VTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQ---INARSSLDEISRD----LYHIETNLQSL 1417
            +   L  RR LF  R+ ++ + L+ G+FG+ + +++ ++S          K  + S  +K  I+L+T++L+ LI+VYH  ++++ M      DW++A+   RI     EI++C+  P+P +Y       +  S   S      D I++I M LR YL+ARV++L S L  D S++S  A+N+ + NT+F+ K+ MT+    +L+   I ++I  +W    CE       VT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+     +  D  K +  ++R+ L  I Q+R+++ E+R L D + +++++++ Q    +  S L+E S D    +  +ET L++L
Sbjct:  117 IGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWG-----AYDKASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAK-VRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETL 517          
BLAST of Small conductance calcium-activated potassium channel protein vs. UniProt/SwissProt
Match: sp|P70604|KCNN2_RAT (Small conductance calcium-activated potassium channel protein 2 OS=Rattus norvegicus OX=10116 GN=Kcnn2 PE=1 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 2.490e-60
Identity = 140/407 (34.40%), Postives = 244/407 (59.95%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDY------HVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCE-------VTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQ---INARSSLDEISRD----LYHIETNLQSL 1417
            +   L  RR LF  R+ ++ + L+ G+FG+ + +++ ++S          K  + S  +K  I+L+T++L+ LI+VYH  ++++ M      DW++A+   RI     EI++C+  P+P +Y       +  S   S      D I++I M LR YL+ARV++L S L  D S++S  A+N+ + NT+F+ K+ MT+    +L+   I ++I  +W    CE       VT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+     +  D  K +  ++R+ L  I Q+R+++ E+R L D + +++++++ Q    +  S L+E S D    +  +ET L++L
Sbjct:  118 IGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWG-----AYDKASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAK-VRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETL 518          
BLAST of Small conductance calcium-activated potassium channel protein vs. UniProt/SwissProt
Match: sp|P58391|KCNN3_MOUSE (Small conductance calcium-activated potassium channel protein 3 OS=Mus musculus OX=10090 GN=Kcnn3 PE=1 SV=2)

HSP 1 Score: 213.772 bits (543), Expect = 5.111e-60
Identity = 138/414 (33.33%), Postives = 247/414 (59.66%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDY------HVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCE-------VTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQ---------INARSSLDEISRDLYHIETNLQSLRDKLN 1432
            +   L  RR LF  R+ ++ + L+ G+FG+ + +++ ++S          K+ + S  +K  I+L+TV+L+ LI+ YH  ++++ +      DW++A+   RI+    E+++C+  P+P +Y       +  S   S  +   D I++I M LR YL+ARV++L S L  D S++S  A+N+ + NT+F+ K+ MT+    +L+   I ++I  +W   VCE       VT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+     +  D  K +  ++R+ L  I Q+R ++ E+R L D + +++++S+ Q         +N RS  +++ + +  +E+ L+ L    N
Sbjct:  267 IGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGLYS-----KDSMFSLALKCLISLSTVILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAK-VRKHQRKFLQAIHQLRGVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRS--EDLEKQIGSLESKLEHLTASFN 672          
BLAST of Small conductance calcium-activated potassium channel protein vs. TrEMBL
Match: A0A1I8FZC7 (CaMBD domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020603g1 PE=4 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 1.096e-73
Identity = 166/443 (37.47%), Postives = 260/443 (58.69%), Query Frame = 2
Query:  155 KKSICSSRSYGS-IYEVGKPYESQQSSIDVSLFSTVAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISL----NYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYHVVNSLVYSEKQ-------YTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCEVTF-----TFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLRDKLN 1432
            K    +  SYGS + E  K Y+          +  V   L  R++LF  R+ +A   L   + G+ L I++ ++ +    N  QP         S ++K  I++TT +L+  I  YH +D+++ M   +I DW+LA+ + R      E+++C+  P+P   H V  LVY + +          D I ++ M LRFYL+ RV++L S L+QD S+QS  A+N+   N +FIFKS M LY  Y+L  + +F+FIW SWA   CE+        F +SMW+TA+TFL++GYGDI+P + CGR +AVLTG  G G TALVVA+++ KLEL++ EKY+HNFV D +L++Q+KH +ANI+K  W  Y+    K+  + GK+L + +R LL++I ++R +R +++ L DSS+S+ E+ R Q    +SL  +      +E+ L  + DKL+
Sbjct:   21 KGGSMNGSSYGSSVGEQPKTYK----------YENVGARLARRKELFVRRKLIADLSLFFAMLGIVLMIVETELCMANVFNKGQPG--------SIIVKSLISITTAILLGFITWYHYLDIKVFMIDNSIDDWRLAITMSRGFHLALELLVCAVHPIP-GQHEVQMLVYDDTKRVRLLQVIPIDVIFSLPMFLRFYLVCRVMMLHSRLYQDASSQSLGALNRIHFNFRFIFKSLMNLYPEYVLTVMALFLFIWASWAVRACEMYHGQEHRNFLNSMWMTAITFLTVGYGDIVPASYCGRGIAVLTGLFGTGVTALVVAVLARKLELSRAEKYVHNFVIDIELDKQVKHAAANILKEGWLSYKY---KKAGNTGKTLKHQRR-LLHSIHRIRDLRGDQKRLADSSVSLTEMHRNQAFMMTSLTTVQSRSREMESRLARIEDKLD 440          
BLAST of Small conductance calcium-activated potassium channel protein vs. TrEMBL
Match: A0A267GF91 (CaMBD domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023081g1 PE=4 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 4.243e-68
Identity = 152/421 (36.10%), Postives = 249/421 (59.14%), Query Frame = 2
Query:  212 YESQQSSIDVSLFSTVAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLN--YNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYHVVNSLVYSE-------KQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCEVTF-----TFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLRDKLN 1432
            Y S         +  V   L  R++LF  R+ +A   L   + G+ + I++ ++ +   +N+          S V+K  I+++T +L+  I  YH +D+++ M   ++ DW+LA+ + R      E+++C+  P+P   H+V  L Y         +    D I ++ M LRFYL+ RV++L S L+QD S+QS  A+N+   N +FIFKS M LY  Y+L  + +F+FIW SWA   CE+        F +SMW+TA+TFL++GYGDI+P + CGR +AVLTG  G G TALVVA+++ KLEL++ EKY+HNFV D +L++Q+KH +ANI+K  W  Y+    K+  +  K+L  ++R+LL++I ++R +R +++ L DSS+S+ E+ R Q    + L  +       + +LQ + +KL+
Sbjct:   40 YGSSSGPTKTFKYENVGARLARRKELFVRRKLIADLSLFFAMLGIVMMIIETELCIAGIFNKAGAG------SIVMKSLISVSTAILLGFISWYHYLDIKVFMIDNSMDDWRLAITLSRGFHLAMELLVCAIHPIP-GQHMVQMLAYDNTNSVRLMQAIPIDVIFSLPMFLRFYLVCRVMMLHSRLYQDASSQSLGALNRIHFNFRFIFKSLMNLYPEYVLTVMALFLFIWASWAVRACEMYHGPEHRNFLNSMWMTAITFLTVGYGDIVPASYCGRGIAVLTGLFGTGVTALVVAVLARKLELSRAEKYVHNFVIDIELDKQVKHAAANILKEGWLSYK---YKRAGNATKTL-KHQRRLLHSIHRIRELRNDQKRLADSSVSLTEMYRNQGFMLTGLASVQAKAKETDAHLQRIEEKLD 449          
BLAST of Small conductance calcium-activated potassium channel protein vs. TrEMBL
Match: K1QLY9 (Small conductance calcium-activated potassium channel protein OS=Crassostrea gigas OX=29159 GN=CGI_10001824 PE=4 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 4.649e-67
Identity = 156/432 (36.11%), Postives = 255/432 (59.03%), Query Frame = 2
Query:  206 KPYESQQSSIDVSLFSTVAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLN--YNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYHVVNSLVYSEKQY------TYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCEVTFTFSDS--------MWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEI-------SRDLYHIETNLQSLRDKLN 1432
            K  E++        F TV   L  R++LF  R+  +   L+  LFG+ L +   +++    Y++ + P      S ++K  IT +TV L+  + +YH +D+++ +    + DW++ L  RRII+   EI++CS  P+P D+        +E ++        D I+ + M LR +L+ R ++L S L++D S+QS  A+N+   N +FIFKS MT+Y  Y+L  ++I  FI  SW   +CE++ T  +S        MWL A+TFLS+GYGDI P+T CGR +AV+TG +GAGCTALVVA+++ KLEL+++EKY+H+FV D  L+++LK+ +AN++K  W +Y+ R  K  S    S      + +YNIRQ++A    +R L+D+SI++ EV++ Q  A  S++ I          + ++E+ + SL DK+N
Sbjct:   23 KTLENEAGDSPPGRFETVGSRLARRKELFVKRKRSSDVALIFALFGILLMVTQTELTAAKVYHRSSLP------SHLMKMAITASTVALLIFLGIYHRLDIQLFIVNNCVDDWRIPLTARRIIQITFEIIVCSIHPIPGDFDTTWPATVAEGEHYRKLRVPLDTILALPMFLRLFLVCRFIMLHSKLYEDASSQSLGALNRIHFNFRFIFKSLMTMYPDYVLTIIMIVSFIIASWVLRLCEMSDTADESVHSNLLNTMWLVAITFLSVGYGDIKPSTYCGRGIAVITGMMGAGCTALVVAVLARKLELSRSEKYVHDFVLDVNLDKRLKNEAANVMKSGWFIYKFRKLKANSSMALSYQTKLLEAIYNIRQIKA---AQRRLVDASITMTEVNKTQNEASRSIEIIRCKQLTLEEKVDNLESKIMSLHDKIN 445          
BLAST of Small conductance calcium-activated potassium channel protein vs. TrEMBL
Match: A0A1I8IEB4 (CaMBD domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 1.967e-63
Identity = 142/380 (37.37%), Postives = 234/380 (61.58%), Query Frame = 2
Query:  335 LFGLSLAILDNQISLN--YNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYHVVNSLVYSE-------KQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCEVTF-----TFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLRDKLN 1432
            + G+ + I++ ++ +   +N+          S V+K  I+++T +L+  I  YH +D+++ M   ++ DW+LA+ + R      E+++C+  P+P   H+V  L Y         +    D I ++ M LRFYL+ RV++L S L+QD S+QS  A+N+   N +FIFKS M LY  Y+L  + +F+FIW SWA   CE+        F +SMW+TA+TFL++GYGDI+P + CGR +AVLTG  G G TALVVA+++ KLEL++ EKY+HNFV D +L++Q+KH +ANI+K  W  Y+    K+  +  K+L  ++R+LL++I ++R +R +++ L DSS+S+ E+ R Q    + L  +       + +LQ + +KL+
Sbjct:    1 MLGIVMMIIETELCIAGIFNKAGAG------SIVMKSLISVSTAILLGFISWYHYLDIKVFMIDNSMDDWRLAITLSRGFHLAMELLVCAIHPIP-GQHMVQMLAYDNTNSVRLMQAIPIDVIFSLPMFLRFYLVCRVMMLHSRLYQDASSQSLGALNRIHFNFRFIFKSLMNLYPEYVLTVMALFLFIWASWAVRACEMYHGPEHRNFLNSMWMTAITFLTVGYGDIVPASYCGRGIAVLTGLFGTGVTALVVAVLARKLELSRAEKYVHNFVIDIELDKQVKHAAANILKEGWLSYK---YKRAGNATKTL-KHQRRLLHSIHRIRELRNDQKRLADSSVSLTEMYRNQGFMLTGLASVQAKAKETDAHLQRIEEKLD 369          
BLAST of Small conductance calcium-activated potassium channel protein vs. TrEMBL
Match: A0A1I8J573 (CaMBD domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 3.553e-63
Identity = 143/390 (36.67%), Postives = 238/390 (61.03%), Query Frame = 2
Query:  308 MAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYHVVNSLVYSEKQ----------YTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCEV-----TFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLRDKLN 1432
            +A   L+  L G++L + + ++ +        +K+   S ++K  I+L+T +L+  IV+YH +DL++ M   ++ +++L L+  R+ +   E+ +C+  P P +      L+    Q            +D I+ + M LRFYL+ RVL+L S L QD S+QS  A+N+   N +FIFKS M++Y  Y+L +  + +FIW SWAT  CE+        F +SMWLTA+TFL++GYGD++P T C R VAVLTG  G G TALVVA+++ +LEL++ EKY+HNFV D++L+++++H +ANI+K  W  Y+ R      D   SL  ++R+LL++I Q+R +R+++R L D+SI +LEV + Q    + + ++   +   E  + ++ DKL+
Sbjct:    2 LADLSLLFALLGVALMVAEAELCM----AGTLRKDQAGSAILKSFISLSTAILLGFIVLYHWLDLQVFMIDNSMENYRLVLDAGRVFRLALELAVCAVHPPPTNRTDEAQLLQQTHQPREGQLDQHLVPFDVILGLPMFLRFYLICRVLMLHSRLFQDASSQSLGALNRVPFNFRFIFKSMMSMYPEYVLTAAALVLFIWASWATRACEMYRGKKQRNFLNSMWLTAITFLTVGYGDVVPETYCSRGVAVLTGIFGTGVTALVVAVLARRLELSRAEKYVHNFVIDTELDKRMRHSAANILKEGWLAYKFRRS---GDAAASL-RHQRKLLHSIYQIRQLRSDQRRLADNSIGLLEVHKNQGFILTGVQQLHSRIREAEARMVNIDDKLD 383          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Cavefish
Match: kcnn3 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 3 [Source:ZFIN;Acc:ZDB-GENE-100921-56])

HSP 1 Score: 207.994 bits (528), Expect = 5.111e-59
Identity = 131/409 (32.03%), Postives = 247/409 (60.39%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYHVV------NSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCE-------VTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQ---------INARSSLDEISRDLYHIETNLQSL 1417
            +   L  RR LF  R+ ++ + L+ G+FG+ + +++ ++S          K+ + S  +K  I+L+T++L+ LI+ YH  ++++ +      DW++A+ + R++    E+++ +  P+P D+  V       + + S+ +   D ++++ M LR YL+ARV++L S L  D S++S  A+N+   NT+F+ K+ MT+    +L+   I ++I  +W   VCE       VT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+     +  D  + +  ++R+ L  I Q+R+++ E+R L D + +++++S+ Q         +N RS  +++ R +  +E  ++ L
Sbjct:  246 IGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGVYS-----KSSMYSLALKCLISLSTIILLGLIIAYHAREVQLFVIDNGADDWRIAMTMERVLLIALELLVSAVHPVPGDFKFVWRARLAFTYIPSQAEADLDMVLSVPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKVHFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDAQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLMKKIDHSR-VRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQSVMYELMSELNDRS--EDLERQMLSLEQRVEQL 646          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Cavefish
Match: kcnn2 (potassium calcium-activated channel subfamily N member 2 [Source:ZFIN;Acc:ZDB-GENE-091116-41])

HSP 1 Score: 197.978 bits (502), Expect = 1.611e-56
Identity = 139/411 (33.82%), Postives = 245/411 (59.61%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYHV--VNSLVY----SEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCE-------VTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQ---INARSSLDEISRD----LYHIETNLQSLRDKL 1429
            + Q L  RR LF  R+ ++ + L+ G+FG+ + +++ ++S          K  + S  +K  I+L+T++L+ LI++YH  ++++ M      DW++A+   RI     EI++C+  P+P  Y       L +    S+     D I++I M LR YL+ARV++L S L  D S++S  A+N+ + NT+F+ K+ MT+    +L+   I ++I  +W    CE       VT  F  +MWL ++TFL+IGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+     +  D  + +  ++R+ L  I Q+R+++ E+R L D + S++++++ Q    +  S L+E   D    +  +ET L++L   L
Sbjct:   86 IGQKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWG-----AYGKESLYSLALKCLISLSTIILLGLIIIYHAREIQLFMVDNAADDWRIAMTYERIFFICLEILVCAIHPIPGKYTFTWTARLAFYYTSSKTDADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFTISLWIIAAWTVRACERYHDNQDVTSNFLGAMWLISITFLTIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVAKKLELTKAEKHVHNFMMDTQLTKRVKNTAANVLRETWLIYKNTKLVRKMDHAR-VRKHQRKFLQAIHQLRSVKMEQRKLNDQANSLVDLAKTQNIMYDLISDLNERGEDTEKRIAVLETKLETLLSNL 490          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Cavefish
Match: kcnn1b (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1b [Source:ZFIN;Acc:ZDB-GENE-060503-397])

HSP 1 Score: 148.288 bits (373), Expect = 1.445e-38
Identity = 115/401 (28.68%), Postives = 219/401 (54.61%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDY------HVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCEVTFT---FSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLRDKLN 1432
            +   L  RR LF  R+ ++ + L+ G+FG+ + + + ++S          K    SF +K  I+L+T++L+ LI++YH  ++++ M      DW++A+   RI+  + E+++C+  P+P  Y       +  +   S      D I++I M LR YL+ RV++L S L  D S++S  A+N+ + NT+F+ K+ MT+    +L+   I  +I  +W   V    +       ++WL  V F  +  G  +P         +L    GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+     +  D  K +  ++R+ L  I Q+R+++ E+R L D + +++++++ Q      + E+      ++  +  L +KL+
Sbjct:   78 IGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSWGVYT-----KESSYSFALKCLISLSTLILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERILFIVLELLVCAIHPIPGHYVFTWTARLAFTYAPSVADADVDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVFLFWYPQNILPIALWLVYVIFSKLQTGSSVPFWKA--VAFLLQPFRGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAK-VRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLVSELQERSEELDKRIGQLEEKLD 470          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Cavefish
Match: kcnn4 (potassium calcium-activated channel subfamily N member 4 [Source:NCBI gene;Acc:103046778])

HSP 1 Score: 138.272 bits (347), Expect = 3.109e-35
Identity = 113/413 (27.36%), Postives = 213/413 (51.57%), Query Frame = 2
Query:  269 LRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQP----LPVDYHVV------NSLV--------YSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCE-----VTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQI-------NARSSLDEISRDLYHIETNLQSL 1417
            LR R+ L   +R +  + L   + G+ L I   ++     QP       + +  I   I+ +T  L+ LI+ +H  D+R+ +  +N  DW++A+   R++    E+++C+  P    L  D  V       NS V        + E     + +++ LM LR YL+ R ++L S +    S +S  ++N  +   +F+ K  M  Y    L+  I+  ++  +W   +CE      T     ++WL A+TFL++GYGD+ P T+CG+ V + TG +G  CTA++VA+V+ KL L + EK++H F+ D ++++++++ +AN+++  W L+R    K  +   +   +++R LL  IR  R +R ++R L D +  ++++S+ Q+       N  +S  E+ + +  +E  L  L
Sbjct:   57 LRDRKFLLEDKRRLCAWALGAAMLGILLMIGHAELCPAVYQPGS-----IYAISINGLISFSTGCLLILIIAFHYKDIRLFIIDHNQVDWRIAMTTNRVLGISLELLVCAVHPVASYLGPDVGVQVPVLKWNSSVTPICLCQSHRETWLEIELLLSGLMFLRLYLVHRAILLHSKVLLSASYRSIGSLNNINFTFRFVLKVLMNKYPARTLLVFIMLFWLSAAWMLRLCERQAEVETGDMGTALWLIAITFLTVGYGDVSPCTSCGKVVCLFTGVMGVACTAMLVAVVTKKLALNKGEKHVHFFMMDIQISKEIRNAAANVLRECWLLHRTTQAKNNNGEHR---HHQRCLLEAIRVFRHLRLKQRKLRDYTSEMVDLSKMQMIMCDLSANWNNSYRELEQRIISMEQKLDEL 461          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010066.1 (pep scaffold:Pmarinus_7.0:GL480376:18291:27660:1 gene:ENSPMAG00000009109.1 transcript:ENSPMAT00000010066.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.464 bits (280), Expect = 3.377e-29
Identity = 62/169 (36.69%), Postives = 101/169 (59.76%), Query Frame = 2
Query:  533 DWKLALNIRRIIKFITEIVICSCQPLPVDY------HVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCE-------VTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGR 1000
            DW++A+  +RI     E++IC+  P+P +Y       +  + V S K+   D +++I M LR YL+ARV++L S L  D S++S  A+N+ + NT+F+ K+ MT+    +L+   I ++I  +W    CE       +T  F  +MWL ++TFL+IGYGD++P T CGR
Sbjct:   11 DWRIAMTYQRIFNIGLELLICAIHPIPGNYTFMWTARLAFTYVSSVKEADVDIVLSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKITFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDPQDITSNFLAAMWLISITFLTIGYGDMVPHTYCGR 179          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Medaka
Match: KCNN1 (small conductance calcium-activated potassium channel protein 3 [Source:NCBI gene;Acc:101154856])

HSP 1 Score: 209.534 bits (532), Expect = 5.990e-61
Identity = 137/410 (33.41%), Postives = 245/410 (59.76%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDY------HVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVC-------EVTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYR-LRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQ---------INARSSLDEISRDLYHIETNLQSL 1417
            ++  L  RR LFG R+ ++ + LV G+FG+ + +++ ++S  +       K    S+ +K  I+++T  L+ LI++YH  ++++ M      DW++A+ + RI+    E+V+C+  P+P  Y       +  +   S     +D I+++ M LR YL+ RV++L S L  D S++S  A+N+ + NT+F+ K+ MT+    +L+   +  +I  +W   +C       EVT TF  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ K ELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+  +  K+I     ++ +++R+ L  I Q+R ++ E+R L D + ++ +V++ Q         +  RSS  E+ R +  +E  L SL
Sbjct:   74 ISYRLGLRRALFGKRKQLSDYALVCGMFGIIIMVVETELSRAFYS-----KESTYSYTLKSLISVSTAFLLGLILMYHAREIQLFMVDNGADDWRIAMTLERILFIALELVVCAIHPIPGQYVFSWTARLAFNYTSSPSDDDFDIILSVPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSVTCWIIAAWIVRICERYHDTQEVTSTFLGAMWLVSITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKSELTRAEKHVHNFMMDTQLLKKIKNTAANVLQETWLIYKNTKLVKKIDH--ATVRHHQRKFLQAIHQLRRVKMEQRKLTDQANTVADVAKTQNMMYDLVSDLQHRSS--ELDRRVVVLEEKLDSL 474          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Medaka
Match: KCNN1 (small conductance calcium-activated potassium channel protein 3 [Source:NCBI gene;Acc:101154856])

HSP 1 Score: 209.149 bits (531), Expect = 6.266e-61
Identity = 137/410 (33.41%), Postives = 245/410 (59.76%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDY------HVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVC-------EVTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYR-LRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQ---------INARSSLDEISRDLYHIETNLQSL 1417
            ++  L  RR LFG R+ ++ + LV G+FG+ + +++ ++S  +       K    S+ +K  I+++T  L+ LI++YH  ++++ M      DW++A+ + RI+    E+V+C+  P+P  Y       +  +   S     +D I+++ M LR YL+ RV++L S L  D S++S  A+N+ + NT+F+ K+ MT+    +L+   +  +I  +W   +C       EVT TF  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ K ELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+  +  K+I     ++ +++R+ L  I Q+R ++ E+R L D + ++ +V++ Q         +  RSS  E+ R +  +E  L SL
Sbjct:   72 ISYRLGLRRALFGKRKQLSDYALVCGMFGIIIMVVETELSRAFYS-----KESTYSYTLKSLISVSTAFLLGLILMYHAREIQLFMVDNGADDWRIAMTLERILFIALELVVCAIHPIPGQYVFSWTARLAFNYTSSPSDDDFDIILSVPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSVTCWIIAAWIVRICERYHDTQEVTSTFLGAMWLVSITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKSELTRAEKHVHNFMMDTQLLKKIKNTAANVLQETWLIYKNTKLVKKIDH--ATVRHHQRKFLQAIHQLRRVKMEQRKLTDQANTVADVAKTQNMMYDLVSDLQHRSS--ELDRRVVVLEEKLDSL 472          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Medaka
Match: kcnn1a (small conductance calcium-activated potassium channel protein 2 [Source:NCBI gene;Acc:101164003])

HSP 1 Score: 209.534 bits (532), Expect = 2.752e-60
Identity = 135/405 (33.33%), Postives = 239/405 (59.01%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDY------HVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVC-------EVTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLRDKLN 1432
            +   L  RR LF  R+ ++ + L+ G+FG+ + + + ++S          K    SF +K  I+L+TV+L+ LI++YH  ++++ M      DW++A+   RI   + E+++C+  P+P  Y       +  +   S      D I++I M LR YL+ RV++L S L  D S++S  A+N+ + NT+F+ K+ MT+    +L+   I  +I  +W   VC       EVT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+     +  D  K +  ++R+ L  I Q+R+++ E+R L D + +++++++ Q      + E+      ++  + +L DKL+
Sbjct:  148 IGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSWGVYT-----KESSYSFALKCLISLSTVILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFIVLELLVCAIHPIPGQYVFTWTARLAFTYTPSVADADVDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAK-VRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNVMYDLVSELQERSEELDKRIGTLEDKLD 546          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Medaka
Match: kcnn3 (small conductance calcium-activated potassium channel protein 2 [Source:NCBI gene;Acc:101156116])

HSP 1 Score: 208.379 bits (529), Expect = 4.434e-59
Identity = 135/415 (32.53%), Postives = 250/415 (60.24%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDY------HVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCE-------VTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYR-LRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQ---------INARSSLDEISRDLYHIETNLQSLRDKLN 1432
            +   L  RR LF  R+ ++ + L+ G+FG+ + +++ ++S          K+ + S  +K  I+L+TV+L+ LI+ YH  ++++ +      DW++A+ + R++    E+++ +  P+P D+       +  S   S+ +   D ++++ M LR YL+ARV++L S L  D S++S  A+N+   NT+F+ K+ MT+    +L+   I ++I  +W   VCE       VT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+  +  K+I D  + +  ++R+ L  I Q+R+++ E+R L D + +++++S+ Q         +N RS  +++ R +  +E  ++ L    N
Sbjct:  231 IGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGVYS-----KSSMYSLALKCLISLSTVILLGLIIAYHAREVQLFVIDNGADDWRIAMTMERVLLIALELLVSAVHPVPGDFKFQWRARLAFSYAPSQAEADLDMVLSVPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKVHFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDAQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLMKKI-DHSR-VRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQSVMYELMSELNDRS--EDLERQMLSLEQRVEQLTAGFN 636          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Medaka
Match: kcnn3 (small conductance calcium-activated potassium channel protein 2 [Source:NCBI gene;Acc:101156116])

HSP 1 Score: 208.379 bits (529), Expect = 1.353e-58
Identity = 135/415 (32.53%), Postives = 250/415 (60.24%), Query Frame = 2
Query:  257 VAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDY------HVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCE-------VTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYR-LRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQ---------INARSSLDEISRDLYHIETNLQSLRDKLN 1432
            +   L  RR LF  R+ ++ + L+ G+FG+ + +++ ++S          K+ + S  +K  I+L+TV+L+ LI+ YH  ++++ +      DW++A+ + R++    E+++ +  P+P D+       +  S   S+ +   D ++++ M LR YL+ARV++L S L  D S++S  A+N+   NT+F+ K+ MT+    +L+   I ++I  +W   VCE       VT  F  +MWL ++TFLSIGYGD++P T CG+ V +LTG +GAGCTALVVA+V+ KLELT+ EK++HNF+ D++L +++K+ +AN+++  W +Y+  +  K+I D  + +  ++R+ L  I Q+R+++ E+R L D + +++++S+ Q         +N RS  +++ R +  +E  ++ L    N
Sbjct:  318 IGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGVY-----SKSSMYSLALKCLISLSTVILLGLIIAYHAREVQLFVIDNGADDWRIAMTMERVLLIALELLVSAVHPVPGDFKFQWRARLAFSYAPSQAEADLDMVLSVPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKVHFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDAQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLMKKI-DHSR-VRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQSVMYELMSELNDRS--EDLERQMLSLEQRVEQLTAGFN 723          
BLAST of Small conductance calcium-activated potassium channel protein vs. Planmine SMEST
Match: SMESG000068902.1 (SMESG000068902.1)

HSP 1 Score: 818.535 bits (2113), Expect = 0.000e+0
Identity = 436/437 (99.77%), Postives = 437/437 (100.00%), Query Frame = 2
Query:  122 MAMKSNERAMFKKSICSSRSYGSIYEVGKPYESQQSSIDVSLFSTVAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYHVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCEVTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLRDKLN 1432
            MAMKSNERAMFKKSICSSRSYGSIYEVGKPYESQQSSIDVSLFSTVAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNY+VSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYHVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLYSIYILISLIIFIFIWGSWATTVCEVTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRAVAVLTGALGAGCTALVVAIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLRDKLN
Sbjct:    1 MAMKSNERAMFKKSICSSRSYGSIYEVGKPYESQQSSIDVSLFSTVAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYIVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYHVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLYSIYILISLIIFIFIWGSWATTVCEVTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRAVAVLTGALGAGCTALVVAIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLRDKLN 437          
BLAST of Small conductance calcium-activated potassium channel protein vs. Planmine SMEST
Match: SMESG000068902.1 (SMESG000068902.1)

HSP 1 Score: 813.142 bits (2099), Expect = 0.000e+0
Identity = 434/435 (99.77%), Postives = 435/435 (100.00%), Query Frame = 2
Query:  128 MKSNERAMFKKSICSSRSYGSIYEVGKPYESQQSSIDVSLFSTVAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYHVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCEVTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLRDKLN 1432
            MKSNERAMFKKSICSSRSYGSIYEVGKPYESQQSSIDVSLFSTVAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNY+VSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYHVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLYSIYILISLIIFIFIWGSWATTVCEVTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRAVAVLTGALGAGCTALVVAIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLRDKLN
Sbjct:    1 MKSNERAMFKKSICSSRSYGSIYEVGKPYESQQSSIDVSLFSTVAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYIVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYHVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLYSIYILISLIIFIFIWGSWATTVCEVTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRAVAVLTGALGAGCTALVVAIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLRDKLN 435          
BLAST of Small conductance calcium-activated potassium channel protein vs. Planmine SMEST
Match: SMESG000060715.1 (SMESG000060715.1)

HSP 1 Score: 216.853 bits (551), Expect = 5.403e-65
Identity = 139/382 (36.39%), Postives = 244/382 (63.87%), Query Frame = 2
Query:  308 MAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYH--VVNSLVYSEKQYTY-----DGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCEV-----TFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLD-------EISRDLYHI 1396
            ++  CL+  +FG+ L I   ++S+   + N  K N   + ++K  I+ TT ML+  ++ YH++D+++ M    + DW+LA+++ RI+    E++IC   P P  ++  +VN L       +      D ++++ M LRF+++ RVL+L S L+QD SAQS  A+N+   N  FIFKS M+LY+ Y+L ++I F+F+W SWA   CE         F DSMW+ A+TFL++GYGD++P +TCG+A++V+TG  G GCTALVVA+++ KLEL++ E Y+HNFV   +L++QLKH +AN+VK  W +++    K++  + ++L  ++R+LL  IR++R ++ ++  + D+++S++E+ R Q+  + +++       EI + ++ I
Sbjct:   48 VSDLCLIFSMFGILLMITYIELSIFLMKGN-QKSNIFSAMILKLFISFTTFMLLLFLIWYHSIDIQLFMIDNGMEDWRLAMSLSRILVIGLELLICLIHPFPGSHNLKIVNLLKKGSNNISISIVPIDVLLSLPMFLRFFMVCRVLMLHSQLYQDASAQSLGALNRIHFNFAFIFKSLMSLYAEYVLTAMITFLFLWASWAIRACESYQGDNHLDFFDSMWIIAITFLTVGYGDMVPQSTCGKAISVMTGIFGVGCTALVVAVLARKLELSRAEMYVHNFVISVELSKQLKHAAANVVKEGWLVHK---YKKLGWKQRAL-KHERRLLQAIRRIRELKNDQSKVSDNTLSMVEIYRNQVYMQKTIESTQTTILEIHKKIFEI 424          
BLAST of Small conductance calcium-activated potassium channel protein vs. Planmine SMEST
Match: SMESG000036688.1 (SMESG000036688.1)

HSP 1 Score: 199.134 bits (505), Expect = 2.361e-58
Identity = 152/448 (33.93%), Postives = 244/448 (54.46%), Query Frame = 2
Query:  107 SE*SQMAMKSNERAMFKKSICSSRSYGSIYEVGKPYESQQSSIDVSLFSTVAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQ--ISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYHVVNSLVYSEKQYTYDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCEVTF-----TFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIETNLQSLRDKL 1429
            SE SQ+ +  N  + + ++  +        E  KP+   +  I    F  V   L +R+  F  RR +A   LV    G+ + + D +  IS  Y    G  +                      +V YH + + I M   +I DW LA+++  ++    E++ICS  P+PVDY  VN++       T D     ++    YL  RV       +QD SAQS  A+N+   N +FIFKS M +Y  Y+L  LI+ +FIW SWA   CE+        F + MW+ A+TFLS+GYG+I+P + CGR++AVLTG  GAGCTALVVA+++ KLEL++ EKY+HNFV D +L++Q+KH + N++K  W +++    K+   R  +L + +R+LL +IR++R ++ ER+ L D+++++LEV  +Q     S+  ++  +  ++  +QS+  KL
Sbjct:    6 SEDSQIPLIENSVSKYYQTYTNEVCNNEKPENPKPFHVNKREI----FENVGSKLAYRKSRFYKRRLIADLSLVFAALGIIIMVADTEFAISGKYGIDYGASR---------------------FLVWYHKICIEIFMLDNSIDDWHLAMSVSTVLGLAIELIICSIHPIPVDYFQVNNVT------TIDSSHQSML----YLDCRV-------YQDASAQSLGALNRIHFNFRFIFKSLMNVYPEYVLTLLILILFIWASWALRACEIYHLELRDNFFNCMWVVAITFLSVGYGEIVPESYCGRSIAVLTGIFGAGCTALVVAVLARKLELSRAEKYVHNFVMDIELDKQMKHAAINVIKEGWLVFK---NKRSGTRNIALEH-QRRLLRSIRKIRDLKNERKRLADNAVNLLEVHHSQSCLSESVSVLNVKIGALDNAMQSIDSKL 407          
BLAST of Small conductance calcium-activated potassium channel protein vs. Planmine SMEST
Match: SMESG000006262.1 (SMESG000006262.1)

HSP 1 Score: 177.563 bits (449), Expect = 1.035e-47
Identity = 130/403 (32.26%), Postives = 227/403 (56.33%), Query Frame = 2
Query:  239 VSLFSTVAQNLRFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVVSFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIKFITEIVICSCQPLPVDYHVVNSLVYSEKQYT----YDGIMTILMCLRFYLLARVLILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLXXXXXXXXXXXXXXXWGSWATTVCEVT-----FTFSDSMWLTAVTFLSIGYGDIIPTTTCGRXXXXXXXXXXXXXXXXXXXIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKYYWRLYR----LRTQKQISDR--GKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSISILEVSRAQINARSSLDEISRDLYHIET 1402
             S  +T+   L+ RR+L   R+  A  CL   + G+ + I+   + L +++      +  +  ++   +T+  V ++   + YH  DL++ M   ++SD+++A++ +R+ +   EI IC   P            Y   Q       + I+ + M L+ YL+ RV++L S ++Q++  QS   +N+ + N +F+ KS M LY + I++ LI+ +  W SWA  VCE+      F   +SMWL ++TFL +GYGDI+P TTCGR VAV++G  GAG TAL VAI++ KLE T +E Y+H F+  SKLN+ L+  +ANIVK  W+LY+    +R+   + DR  G+S++  +R+L   I  +R I+   + + D S+ + +V +  +N ++++ ++   +  IE 
Sbjct:   35 ASSITTIGNRLKKRRELHIRRKICADLCLGFAVLGIFVMII--SLELRFSKIGSMAISLQLIQLLLSILTIILVAIL---ITYHVTDLKVFMIDNSLSDFRVAISYKRLGQVCLEIFICLLHPAN----------YGSGQNANMTMMNDILGMGMFLKLYLVGRVMVLHSWINQNLWTQSLGTMNKINFNFRFVLKSAMNLYPVSIILFLIVILLCWCSWAVRVCEIERPDGIFLMKNSMWLISITFLGVGYGDIVPLTTCGRIVAVMSGIFGAGITALTVAILAKKLEFTNSESYVHYFIISSKLNKSLRIAAANIVKRAWKLYKIKAIIRSNMSMYDRSKGESILCCERKLFQAIYAIRDIKRGLKQVSDESVVMCDVKKINLNLQNNIYDLKDRVASIEN 422          
The following BLAST results are available for this feature:
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNN24.354e-6134.40potassium calcium-activated channel subfamily N me... [more]
KCNN32.339e-6033.09potassium calcium-activated channel subfamily N me... [more]
KCNN22.352e-6033.74potassium calcium-activated channel subfamily N me... [more]
KCNN11.318e-5931.54potassium calcium-activated channel subfamily N me... [more]
KCNN22.003e-5934.40potassium calcium-activated channel subfamily N me... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnl-28.191e-5531.89KCNN (Potassium K ChaNNel, calcium activated)-Like... [more]
kcnl-21.008e-5431.89KCNN (Potassium K ChaNNel, calcium activated)-Like... [more]
kcnl-21.391e-5431.89KCNN (Potassium K ChaNNel, calcium activated)-Like... [more]
kcnl-21.452e-5431.89KCNN (Potassium K ChaNNel, calcium activated)-Like... [more]
kcnl-21.787e-5431.89KCNN (Potassium K ChaNNel, calcium activated)-Like... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SK3.771e-6033.50gene:FBgn0029761 transcript:FBtr0301949[more]
SK1.542e-5933.50gene:FBgn0029761 transcript:FBtr0301952[more]
SK1.554e-5833.91gene:FBgn0029761 transcript:FBtr0301954[more]
SK4.407e-5833.33gene:FBgn0029761 transcript:FBtr0300467[more]
SK1.432e-5733.99gene:FBgn0029761 transcript:FBtr0344557[more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnn1b3.314e-6233.66potassium intermediate/small conductance calcium-a... [more]
kcnn1a1.481e-6133.58potassium intermediate/small conductance calcium-a... [more]
kcnn1b5.474e-6132.77potassium intermediate/small conductance calcium-a... [more]
kcnn31.233e-5832.29potassium intermediate/small conductance calcium-a... [more]
kcnn31.233e-5832.29potassium intermediate/small conductance calcium-a... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNN25.880e-6034.31potassium channel, calcium activated intermediate/... [more]
KCNN22.305e-5934.31potassium channel, calcium activated intermediate/... [more]
KCNN23.245e-5934.31potassium channel, calcium activated intermediate/... [more]
wdr171.226e-5833.33WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-10... [more]
wdr172.097e-5834.07WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-10... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnn19.906e-6633.91potassium intermediate/small conductance calcium-a... [more]
Kcnn19.906e-6633.91potassium intermediate/small conductance calcium-a... [more]
Kcnn11.534e-6433.01potassium intermediate/small conductance calcium-a... [more]
Kcnn11.534e-6433.01potassium intermediate/small conductance calcium-a... [more]
Kcnn11.534e-6433.01potassium intermediate/small conductance calcium-a... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9EQR3|KCNN1_MOUSE1.095e-6333.01Small conductance calcium-activated potassium chan... [more]
sp|P70606|KCNN1_RAT3.522e-6132.52Small conductance calcium-activated potassium chan... [more]
sp|Q9H2S1|KCNN2_HUMAN2.091e-6034.40Small conductance calcium-activated potassium chan... [more]
sp|P70604|KCNN2_RAT2.490e-6034.40Small conductance calcium-activated potassium chan... [more]
sp|P58391|KCNN3_MOUSE5.111e-6033.33Small conductance calcium-activated potassium chan... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8FZC71.096e-7337.47CaMBD domain-containing protein OS=Macrostomum lig... [more]
A0A267GF914.243e-6836.10CaMBD domain-containing protein OS=Macrostomum lig... [more]
K1QLY94.649e-6736.11Small conductance calcium-activated potassium chan... [more]
A0A1I8IEB41.967e-6337.37CaMBD domain-containing protein OS=Macrostomum lig... [more]
A0A1I8J5733.553e-6336.67CaMBD domain-containing protein OS=Macrostomum lig... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
kcnn35.111e-5932.03potassium intermediate/small conductance calcium-a... [more]
kcnn21.611e-5633.82potassium calcium-activated channel subfamily N me... [more]
kcnn1b1.445e-3828.68potassium intermediate/small conductance calcium-a... [more]
kcnn43.109e-3527.36potassium calcium-activated channel subfamily N me... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000010066.13.377e-2936.69pep scaffold:Pmarinus_7.0:GL480376:18291:27660:1 g... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNN15.990e-6133.41small conductance calcium-activated potassium chan... [more]
KCNN16.266e-6133.41small conductance calcium-activated potassium chan... [more]
kcnn1a2.752e-6033.33small conductance calcium-activated potassium chan... [more]
kcnn34.434e-5932.53small conductance calcium-activated potassium chan... [more]
kcnn31.353e-5832.53small conductance calcium-activated potassium chan... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068902.10.000e+099.77SMESG000068902.1[more]
SMESG000068902.10.000e+099.77SMESG000068902.1[more]
SMESG000060715.15.403e-6536.39SMESG000060715.1[more]
SMESG000036688.12.361e-5833.93SMESG000036688.1[more]
SMESG000006262.11.035e-4732.26SMESG000006262.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020416 ID=SMED30020416|Name=Small conductance calcium-activated potassium channel protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1511bp
TAGCACCATTTATGGGAATTGTACACAAGCACAATAAATTTTAAATGCCC
ACGCATTCCGGTTGTCGTTAGCAAACACAATACTCTGTTCATTGAGCAAA
CAAGTATCAGAATAATCACAAATGGCAATGAAGTCCAATGAAAGGGCAAT
GTTCAAAAAGTCTATTTGTTCTTCTCGGTCATACGGCTCGATCTATGAAG
TAGGAAAACCATACGAATCGCAACAGTCTTCAATTGACGTTTCATTGTTC
TCTACCGTTGCGCAGAATCTAAGATTTCGTCGTGATTTATTCGGATACAG
GAGGTTTATGGCAAAGTTTTGTTTAGTGTTGGGACTTTTTGGTTTGTCGT
TAGCTATTCTAGACAATCAAATCTCACTGAATTACAATCAGCCAAATGGA
CCGAAGAAGAACTATGTCGTGTCGTTCGTCATCAAATTCTGTATTACTCT
GACAACTGTCATGCTGATGTTTCTGATTGTCGTTTATCACAATATGGACT
TGAGAATAGAAATGCAGCGGTATAACATAAGTGATTGGAAATTGGCTCTG
AACATCCGAAGAATCATCAAATTCATTACGGAAATAGTGATTTGCTCCTG
TCAGCCTTTACCCGTCGATTATCACGTGGTAAATAGTTTGGTTTATTCAG
AAAAACAATATACATATGATGGAATAATGACAATTCTCATGTGCTTAAGA
TTTTACCTGTTGGCAAGGGTTTTAATCCTGAGAAGTACTCTTCATCAAGA
CATTTCAGCCCAAAGTTTCAGTGCTATCAATCAGACTTCGGTGAATACAA
AGTTTATTTTTAAGTCATGGATGACTTTATATTCTATTTATATATTAATT
AGTTTGATAATCTTTATTTTTATTTGGGGAAGTTGGGCGACAACAGTTTG
TGAAGTGACCTTTACATTCTCCGATAGTATGTGGCTTACTGCGGTGACTT
TTTTGAGTATTGGATATGGAGACATTATACCAACTACTACCTGTGGACGA
GCAGTGGCAGTTTTAACAGGTGCTCTGGGAGCCGGGTGCACAGCGTTGGT
AGTGGCGATAGTATCGAGCAAATTGGAACTGACCCAAACCGAAAAATATC
TCCATAATTTTGTCGAAGACTCTAAATTAAATCAGCAGTTGAAACACGTT
TCAGCAAATATCGTTAAGTACTATTGGCGATTATATCGTTTGCGAACTCA
AAAACAGATTAGCGACAGAGGAAAGTCTTTAATTTACAATAAGCGCCAAT
TATTGTACAATATTCGACAAGTGCGCGCTATTCGAACAGAGAGGCGACAT
TTGCTTGACAGCAGCATAAGCATATTAGAAGTCAGCAGAGCTCAAATAAA
TGCTCGCTCTTCTTTAGACGAAATATCACGAGATCTTTACCACATCGAGA
CCAACTTGCAGTCATTACGAGATAAATTGAATTAAAAAAACGTACTATTA
GGTTGATGATACTGATTATTTTTGTTAAATGTCTTTTTTAAAAAAAATTT
TAATTTTGAAA
back to top

protein sequence of SMED30020416-orf-1

>SMED30020416-orf-1 ID=SMED30020416-orf-1|Name=SMED30020416-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=438bp
MAMKSNERAMFKKSICSSRSYGSIYEVGKPYESQQSSIDVSLFSTVAQNL
RFRRDLFGYRRFMAKFCLVLGLFGLSLAILDNQISLNYNQPNGPKKNYVV
SFVIKFCITLTTVMLMFLIVVYHNMDLRIEMQRYNISDWKLALNIRRIIK
FITEIVICSCQPLPVDYHVVNSLVYSEKQYTYDGIMTILMCLRFYLLARV
LILRSTLHQDISAQSFSAINQTSVNTKFIFKSWMTLYSIYILISLIIFIF
IWGSWATTVCEVTFTFSDSMWLTAVTFLSIGYGDIIPTTTCGRAVAVLTG
ALGAGCTALVVAIVSSKLELTQTEKYLHNFVEDSKLNQQLKHVSANIVKY
YWRLYRLRTQKQISDRGKSLIYNKRQLLYNIRQVRAIRTERRHLLDSSIS
ILEVSRAQINARSSLDEISRDLYHIETNLQSLRDKLN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036122CaM-bd_dom_sf
IPR004178CaM-bd_dom
IPR015449K_chnl_Ca-activ_SK
IPR013099K_chnl_dom
Vocabulary: molecular function
TermDefinition
GO:0015269calcium-activated potassium channel activity
GO:0005516calmodulin binding
GO:0016286small conductance calcium-activated potassium channel activity
GO:0005249voltage-gated potassium channel activity
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0071805potassium ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0008076voltage-gated potassium channel complex
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 415..435
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 318..414
e-value: 7.1E-18
score: 66.5
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 96..317
e-value: 3.1E-12
score: 48.5
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 192..357
NoneNo IPR availableTMHMMTMhelixcoord: 143..165
NoneNo IPR availableTMHMMTMhelixcoord: 294..316
NoneNo IPR availableTMHMMTMhelixcoord: 270..287
NoneNo IPR availableTMHMMTMhelixcoord: 180..202
NoneNo IPR availableTMHMMTMhelixcoord: 100..122
NoneNo IPR availableTMHMMTMhelixcoord: 58..80
NoneNo IPR availableTMHMMTMhelixcoord: 233..255
IPR013099Potassium channel domainPFAMPF07885Ion_trans_2coord: 247..318
e-value: 1.5E-11
score: 44.1
IPR004178Calmodulin-binding domainPFAMPF02888CaMBDcoord: 333..408
e-value: 8.5E-8
score: 32.3
IPR015449Potassium channel, calcium-activated, SKPFAMPF03530SK_channelcoord: 50..166
e-value: 9.6E-24
score: 83.6
IPR015449Potassium channel, calcium-activated, SKPANTHERPTHR10153SMALL CONDUCTANCE CALCIUM-ACTIVATED POTASSIUM CHANNELcoord: 45..436
IPR036122SK, calmodulin-binding domain superfamilySUPERFAMILYSSF81327Small-conductance potassium channelcoord: 333..409