Potassium channel subfamily K member 18

Overview
NamePotassium channel subfamily K member 18
Smed IDSMED30020390
Length (bp)1829
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Potassium channel subfamily K member 18 (SMED30020390) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Potassium channel subfamily K member 18 (SMED30020390) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020390

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30020390h1SMcG0016878 dd_Smed_v4_36644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020390h1SMcG0016878 dd_Smed_v4_36644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30020390h1SMcG0016878 dd_Smed_v4_36644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK16 (potassium two pore domain channel subfamily K member 16 [Source:HGNC Symbol;Acc:HGNC:14464])

HSP 1 Score: 90.8929 bits (224), Expect = 2.119e-19
Identity = 77/293 (26.28%), Postives = 124/293 (42.32%), Query Frame = 2
Query:  821 FKTLIKVEIEKFSNVIFNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSI---ICSIYVLFGLSLCIMCFDLLGQKAKTCITKFLKSLKMKLTGQELNSNQP 1690
            +  L +  +E+F  VI  A   G++ K           + W+FG +  +A TV+TTIGYG++ P T  G++  + YA++GIPL +I L ++GT +   L  I R       ++P+    +S     +  +L +T+                                              TLV  IF         +F + E W+F E  YF+FITLSTIGFGD V    T  ++ Y S+   + +I++L GL+   +   L       C   +L SL+     +     +P
Sbjct:   58 YTCLDQWAMEQFVQVIMEAWVKGVNPK-----GNSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEAGQVFCVFYALLGIPLNVIFLNHLGTGLRAHLAAIERW-----EDRPR----RSQVLQVLGLALFLTL---------------------------------------------GTLVILIFP------PMVFSHVEGWSFSEGFYFAFITLSTIGFGDYV--VGTDPSKHYISVYRSLAAIWILLGLAWLALILPLGPLLLHRCCQLWLLSLRQGCGAKAAPGRRP 283          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK16 (potassium two pore domain channel subfamily K member 16 [Source:HGNC Symbol;Acc:HGNC:14464])

HSP 1 Score: 87.4261 bits (215), Expect = 2.339e-18
Identity = 71/255 (27.84%), Postives = 113/255 (44.31%), Query Frame = 2
Query:  821 FKTLIKVEIEKFSNVIFNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSI---ICSIYVLFGLS 1576
            +  L +  +E+F  VI  A   G++ K           + W+FG +  +A TV+TTIGYG++ P T  G++  + YA++GIPL +I L ++GT +   L  I      R  ++P+    +S     +  +L +T+                                              TLV  IF         +F + E W+F E  YF+FITLSTIGFGD V    T  ++ Y S+   + +I++L GL+
Sbjct:   58 YTCLDQWAMEQFVQVIMEAWVKGVNPK-----GNSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEAGQVFCVFYALLGIPLNVIFLNHLGTGLRAHLAAI-----ERWEDRPR----RSQVLQVLGLALFLTL---------------------------------------------GTLVILIFP------PMVFSHVEGWSFSEGFYFAFITLSTIGFGDYV--VGTDPSKHYISVYRSLAAIWILLGLA 245          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK16 (potassium two pore domain channel subfamily K member 16 [Source:HGNC Symbol;Acc:HGNC:14464])

HSP 1 Score: 81.6481 bits (200), Expect = 1.188e-16
Identity = 65/227 (28.63%), Postives = 100/227 (44.05%), Query Frame = 2
Query:  821 FKTLIKVEIEKFSNVIFNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLV 1501
            +  L +  +E+F  VI  A   G++ K  + +N       W+FG +  +A TV+TTIGYG++ P T  G++  + YA++GIPL +I L ++GT +   L  I R       ++P+    +S     +  +L +T+                                              TLV  IF         +F + E W+F E  YF+FITLSTIGFGD V
Sbjct:   58 YTCLDQWAMEQFVQVIMEAWVKGVNPKG-NSTNPSN----WDFGSSFFFAGTVVTTIGYGNLAPSTEAGQVFCVFYALLGIPLNVIFLNHLGTGLRAHLAAIERW-----EDRPR----RSQVLQVLGLALFLTL---------------------------------------------GTLVILIFP------PMVFSHVEGWSFSEGFYFAFITLSTIGFGDYV 219          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK10 (potassium two pore domain channel subfamily K member 10 [Source:HGNC Symbol;Acc:HGNC:6273])

HSP 1 Score: 84.7297 bits (208), Expect = 1.246e-16
Identity = 75/259 (28.96%), Postives = 108/259 (41.70%), Query Frame = 2
Query:  842 EIEKFSNVIFNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIF--IFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKST--RQTEQYKSIICSIYVLFGLSLCIMCFDLLG 1606
            E+E       +A + G+S       N    ++ W+ G A  +A TVITTIGYG+I P T  G+I  ILYAI GIPL    LA IG                             D    IF      V             + +F+   VS              Q+K   V +T++F +   I +  I + IF Y E W  LE++YF  +TL+T+GFGD V   +      E YK ++   ++L GL+       ++G
Sbjct:  123 ELETLIQHALDADNAGVSPIG----NSSNNSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGIG-----------------------------DQLGTIFGKSIARV-------------EKVFRKKQVS--------------QTK-IRVISTILFILAGCIVFVTIPAVIFKYIEGWTALESIYFVVVTLTTVGFGDFVAGGNAGINYREWYKPLVW-FWILVGLAYFAAVLSMIG 319          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK10 (potassium two pore domain channel subfamily K member 10 [Source:HGNC Symbol;Acc:HGNC:6273])

HSP 1 Score: 84.3445 bits (207), Expect = 1.563e-16
Identity = 75/259 (28.96%), Postives = 108/259 (41.70%), Query Frame = 2
Query:  842 EIEKFSNVIFNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIF--IFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKST--RQTEQYKSIICSIYVLFGLSLCIMCFDLLG 1606
            E+E       +A + G+S       N    ++ W+ G A  +A TVITTIGYG+I P T  G+I  ILYAI GIPL    LA IG                             D    IF      V             + +F+   VS              Q+K   V +T++F +   I +  I + IF Y E W  LE++YF  +TL+T+GFGD V   +      E YK ++   ++L GL+       ++G
Sbjct:  128 ELETLIQHALDADNAGVSPIG----NSSNNSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGIG-----------------------------DQLGTIFGKSIARV-------------EKVFRKKQVS--------------QTK-IRVISTILFILAGCIVFVTIPAVIFKYIEGWTALESIYFVVVTLTTVGFGDFVAGGNAGINYREWYKPLVW-FWILVGLAYFAAVLSMIG 324          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-48 (TWiK family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q7YWY7])

HSP 1 Score: 163.696 bits (413), Expect = 8.079e-45
Identity = 110/326 (33.74%), Postives = 161/326 (49.39%), Query Frame = 2
Query:  719 ADFYNLILPRFENLYNVLYNTSEDFGNSEQNQIKFKTLIKVEIEKFSNVIFNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIY--------RIFSMRKNNKPKMVN--------------VKSDSFSDIF--------KSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTE--QYKSIICSIYVLFGLSLCIMCFDL 1600
            A+   L+    E   +V++N +      +  Q K KT++  E+++F  V        LS +  ++  +  +   W F GA LY++TVITTIGYG+   +T +G+  T+LYAI+GIPLM++ L NIG +MA I R +Y        R+    K  K   +               VK+DS  D F        + L    +   +LE ++                        AA Q +S  VP +LV F  + Y  +G+TIF  WE W FLE+ YF FI+L+TIGFGD  P  S   T+  Q K +I SIY+LFG++L  MCF+L
Sbjct:   54 AEIQELVKSAREKAVDVVWNATFRVNRLDSKQWK-KTVLD-EVKRFKTVCM------LSIRKGYDGKEYGKQAQWTFTGAFLYSLTVITTIGYGNTAAKTYIGKTLTMLYAIIGIPLMLLFLTNIGDVMAKIFRFLYAQSIRLKFRLILWHKKRKAAKIRRANSLVSRLTRGHRVKADSSVDSFGLGAGADVEDLLTARVEMEQLEVRET-----------------------AAAQLESMTVPISLVVFTMLGYLGVGTTIFKVWEGWTFLESFYFCFISLTTIGFGDKFPSTSVSNTDEAQEKLVITSIYLLFGMALLAMCFNL 348          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-2 (TWiK family of potassium channels [Source:UniProtKB/TrEMBL;Acc:A0A2X0SX30])

HSP 1 Score: 133.265 bits (334), Expect = 3.378e-32
Identity = 79/243 (32.51%), Postives = 126/243 (51.85%), Query Frame = 2
Query:  878 SSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLLG 1606
            S     H+  ++        MW    AL +A T + TIGYG+I P TPLGR+  +L+A+ G P+ II + ++G  +++    +Y+   MRK       + + DS    F+ L  ++   + LE+   N  S   + ++       + I K       +EVP  +VF I + Y   G  +F   EDW++++A Y+SFI+L+TIGFGD+VP     +   Y +I+  IY+  GLS+  MC DL G
Sbjct:  143 SERKRRHRHGNKRGDRGSEKMWTTSSALFFAATTMATIGYGNIVPVTPLGRLACVLFALFGAPIAIITIGDLGKFLSECTIWLYK--HMRKG------SARLDSAWKRFRGLEDSI--SDDLESASKNQDSSILDMDM-------DEIDK-------SEVPVLMVFTIILLYIAFGGILFSILEDWSYMDAFYYSFISLTTIGFGDIVP-----ENHDYIAIML-IYLGVGLSVTTMCIDLAG 355          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-2 (TWiK family of potassium channels [Source:UniProtKB/TrEMBL;Acc:A0A2X0SX30])

HSP 1 Score: 133.265 bits (334), Expect = 3.818e-32
Identity = 79/243 (32.51%), Postives = 126/243 (51.85%), Query Frame = 2
Query:  878 SSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLLG 1606
            S     H+  ++        MW    AL +A T + TIGYG+I P TPLGR+  +L+A+ G P+ II + ++G  +++    +Y+   MRK       + + DS    F+ L  ++   + LE+   N  S   + ++       + I K       +EVP  +VF I + Y   G  +F   EDW++++A Y+SFI+L+TIGFGD+VP     +   Y +I+  IY+  GLS+  MC DL G
Sbjct:  143 SERKRRHRHGNKRGDRGSEKMWTTSSALFFAATTMATIGYGNIVPVTPLGRLACVLFALFGAPIAIITIGDLGKFLSECTIWLYK--HMRKG------SARLDSAWKRFRGLEDSI--SDDLESASKNQDSSILDMDM-------DEIDK-------SEVPVLMVFTIILLYIAFGGILFSILEDWSYMDAFYYSFISLTTIGFGDIVP-----ENHDYIAIML-IYLGVGLSVTTMCIDLAG 355          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-2 (TWiK family of potassium channels [Source:UniProtKB/TrEMBL;Acc:A0A2X0SX30])

HSP 1 Score: 133.265 bits (334), Expect = 3.937e-32
Identity = 77/243 (31.69%), Postives = 124/243 (51.03%), Query Frame = 2
Query:  878 SSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLLG 1606
            S     H+  ++        MW    AL +A T + TIGYG+I P TPLGR+  +L+A+ G P+ II + ++G  +++    +Y+   MRK       + + DS    F+ L  ++   + LE+   N  S   + ++               +   +EVP  +VF I + Y   G  +F   EDW++++A Y+SFI+L+TIGFGD+VP     +   Y +I+  IY+  GLS+  MC DL G
Sbjct:  143 SERKRRHRHGNKRGDRGSEKMWTTSSALFFAATTMATIGYGNIVPVTPLGRLACVLFALFGAPIAIITIGDLGKFLSECTIWLYK--HMRKG------SARLDSAWKRFRGLEDSI--SDDLESASKNQDSSILDMDMD--------------EIDKSEVPVLMVFTIILLYIAFGGILFSILEDWSYMDAFYYSFISLTTIGFGDIVP-----ENHDYIAIML-IYLGVGLSVTTMCIDLAG 355          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-2 (TWiK family of potassium channels [Source:UniProtKB/TrEMBL;Acc:A0A2X0SX30])

HSP 1 Score: 133.265 bits (334), Expect = 4.406e-32
Identity = 77/243 (31.69%), Postives = 124/243 (51.03%), Query Frame = 2
Query:  878 SSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLLG 1606
            S     H+  ++        MW    AL +A T + TIGYG+I P TPLGR+  +L+A+ G P+ II + ++G  +++    +Y+   MRK       + + DS    F+ L  ++   + LE+   N  S   + ++               +   +EVP  +VF I + Y   G  +F   EDW++++A Y+SFI+L+TIGFGD+VP     +   Y +I+  IY+  GLS+  MC DL G
Sbjct:  143 SERKRRHRHGNKRGDRGSEKMWTTSSALFFAATTMATIGYGNIVPVTPLGRLACVLFALFGAPIAIITIGDLGKFLSECTIWLYK--HMRKG------SARLDSAWKRFRGLEDSI--SDDLESASKNQDSSILDMDMD--------------EIDKSEVPVLMVFTIILLYIAFGGILFSILEDWSYMDAFYYSFISLTTIGFGDIVP-----ENHDYIAIML-IYLGVGLSVTTMCIDLAG 355          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: sand (gene:FBgn0033257 transcript:FBtr0088780)

HSP 1 Score: 138.272 bits (347), Expect = 1.939e-35
Identity = 84/260 (32.31%), Postives = 134/260 (51.54%), Query Frame = 2
Query:  920 KEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSM-----------------------RKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEV--PATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVP----IKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLLGQK 1612
            K  +   W+F GA LY++TVITTIGYG+ITP +  G++ TILYAI+G+PL ++ L+NIG ++A   + IY    +                       R      M N +  S      S T +    ++         S+     V  +    +S ++   +  + E+  P T+  F+ + Y L G+ +F  WEDWN+L+  YF  I+LS+IGFGDLVP    I + R   +   I+C+IY+L G+++  MCF+L+ ++
Sbjct:  120 KGPDVEQWSFSGAFLYSLTVITTIGYGNITPHSECGKLVTILYAIIGMPLFLLYLSNIGDVLAKSFKWIYSKVCLCRICPGVAKRRIIRERRKMRQLARALQMHDMENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSL-----VDIQYTESDSDIEREIRGSTDEITVPVTVCVFVMVGYILWGALLFGRWEDWNYLDGSYFCLISLSSIGFGDLVPGDRVITADRDKVEVSFILCAIYLLLGMAVIAMCFNLMQEQ 374          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: CG34396 (gene:FBgn0085425 transcript:FBtr0112645)

HSP 1 Score: 119.783 bits (299), Expect = 9.724e-28
Identity = 90/297 (30.30%), Postives = 144/297 (48.48%), Query Frame = 2
Query:  749 FENLYNVLYNTSEDFGNSEQNQIKFKTLIKVEIEKFSNVIFNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADI-------LRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRK------NKLETKDNNFQSIFQNC-NVSFKLP-TPNSILKAARQSKST-EVPATLVFFIFIFYNLIGSTIFMYWED-WNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSIYVLFGLSLCIM 1588
             + L++V +N  E+          +K+L + ++  F + + N +  GL      +S        WNF    ++  TVITTIGYGHITP+T +GR  TI+YAI+GIP+ +I LA++G L           +R +Y   S R+  K + +      F+ ++       IR+      N     D   Q+  +   +V    P TP S      +      +P ++   + I Y L+GS  F+  E  W  L+A Y+ FI++STIGFGDLVP      +  +  ++  IY++FGL+L  M
Sbjct:  567 IDRLWDVSHNMREE---------DWKSLARQKLRSFEDELNNLAELGLRRYPGQKS--------WNFVNCFIFCWTVITTIGYGHITPKTGMGRSLTIVYAIIGIPMFLIVLADLGKLFTRCVKFLWVYVRRMYYTRSCRRIRKQQQIRSAMTGFNTMYD----MAIRRPSMFFSNSAPENDEESQADAEAARSVGTSHPETPTSPYPETFEVDDEFNLPVSVASLLLITYILLGSFGFLMMEPSWTPLDAFYYVFISMSTIGFGDLVP------SNPFYVMVSMIYLMFGLALTSM 836          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: CG34396 (gene:FBgn0085425 transcript:FBtr0112644)

HSP 1 Score: 115.161 bits (287), Expect = 1.082e-26
Identity = 85/278 (30.58%), Postives = 136/278 (48.92%), Query Frame = 2
Query:  899 KSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADI-------LRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRK------NKLETKDNNFQSIFQNC-NVSFKLP-TPNSILKAARQSKST-EVPATLVFFIFIFYNLIGSTIFMYWE-DWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSIYVLFGLSLCIMCFDL----LGQKAKTCITKFLKSLKMKLTGQ 1669
            +S   S   +    W+F  A++Y+ T+ TTIGYGHITP+T +GR  TI+YAI+GIP+ +I LA++G L           +R +Y   S R+  K + +      F+ ++       IR+      N     D   Q+  +   +V    P TP S      +      +P ++   + I Y L+GS  F+  E  W  L+A Y+ FI++STIGFGDLVP      +  +  ++  IY++FGL+L  M  ++    L    K    K   ++ M +T +
Sbjct:  189 QSLLRSGMVDNTDPWSFWDAMVYSATIYTTIGYGHITPKTGMGRSLTIVYAIIGIPMFLIVLADLGKLFTRCVKFLWVYVRRMYYTRSCRRIRKQQQIRSAMTGFNTMYD----MAIRRPSMFFSNSAPENDEESQADAEAARSVGTSHPETPTSPYPETFEVDDEFNLPVSVASLLLITYILLGSFGFLMMEPSWTPLDAFYYVFISMSTIGFGDLVP------SNPFYVMVSMIYLMFGLALTSMFINVVQIKLSDHFKMASAKVGATIGMNMTSE 456          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: CG42594 (gene:FBgn0260971 transcript:FBtr0345704)

HSP 1 Score: 107.842 bits (268), Expect = 5.276e-24
Identity = 70/252 (27.78%), Postives = 126/252 (50.00%), Query Frame = 2
Query:  941 WNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYR---IFSMRKNNKPKMVNVK--SDSFSDIFKSLTITVIRKNKLETKDNNF-QSIFQNC---NVSFKLPTPNS--------------ILKAARQSKSTEVPATLVFFIFIFYNLI-----GSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLLGQK 1612
            WNF  A LY++TV+TTIGYG++ P+T LGRI T+ YA  GIPL ++ L++ G+++A + R ++       +  N      + K  ++    + +      +RK +   ++  + + +F      +     P PN+               L A+    S    + L   +  F  +I     G+ +    E W  L+ +YF F++LSTIGFGD++P    R+     +  CS+Y++ G++L  MCF+++ ++
Sbjct:  600 WNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAREVFSKALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKDAGAGAPPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYIVFGAAVLYRLEKWPILDGIYFCFMSLSTIGFGDMLP--GLRRESNATTWFCSVYIMSGMTLTAMCFNVIHEE 849          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: CG42594 (gene:FBgn0260971 transcript:FBtr0301749)

HSP 1 Score: 107.842 bits (268), Expect = 5.276e-24
Identity = 70/252 (27.78%), Postives = 126/252 (50.00%), Query Frame = 2
Query:  941 WNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYR---IFSMRKNNKPKMVNVK--SDSFSDIFKSLTITVIRKNKLETKDNNF-QSIFQNC---NVSFKLPTPNS--------------ILKAARQSKSTEVPATLVFFIFIFYNLI-----GSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLLGQK 1612
            WNF  A LY++TV+TTIGYG++ P+T LGRI T+ YA  GIPL ++ L++ G+++A + R ++       +  N      + K  ++    + +      +RK +   ++  + + +F      +     P PN+               L A+    S    + L   +  F  +I     G+ +    E W  L+ +YF F++LSTIGFGD++P    R+     +  CS+Y++ G++L  MCF+++ ++
Sbjct:  600 WNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAREVFSKALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKDAGAGAPPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYIVFGAAVLYRLEKWPILDGIYFCFMSLSTIGFGDMLP--GLRRESNATTWFCSVYIMSGMTLTAMCFNVIHEE 849          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk18 (potassium channel, subfamily K, member 18 [Source:ZFIN;Acc:ZDB-GENE-100405-2])

HSP 1 Score: 103.219 bits (256), Expect = 2.596e-23
Identity = 79/297 (26.60%), Postives = 137/297 (46.13%), Query Frame = 2
Query:  920 KEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIY----------------RIFSMRKNNKPKMVNVKSDSFSDIFKSLTI-------------TVIRKNKLETKDNNFQSIFQ------------------NCNVSFKLPTPNSIL--KAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWE-DWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICS-IYVLFGLSLCIMCFDLLGQKAKTCI-TKFLKSLKM 1654
            ++E +  W F  +L +  TV TT+GYG I P T  G++  +LYA++GIPLM++ ++++G L+A +L   Y                R+ S  K +    V   +D      + + +             + IR+   + ++N  + IF                   +C    ++PTP   L     ++ +  +VP  ++  +   Y +I S I   WE   +  +A YF+FITL+TIGFGD+VP       E  K  + + ++++ G+++  M F  LGQ    C   + +KSL M
Sbjct:   93 EKERDHGWTFFASLFFCCTVFTTVGYGRIYPLTSKGKVACVLYAMVGIPLMLLVISDVGDLLAVLLSKAYTRLNLFFRRWIGHQSWRLQSHEKTSALPQVQADTDGTYKFNQDVVVLETTNNQQVIQTRSSIRRGSFQLRNN--KEIFDRIIVRESFRIKGTLSKSCSCPELDRVPTPKDELFNDIGQEMEQLDVPLLVILLMVFAYMVICSQILKCWEKQMDHSDAFYFTFITLTTIGFGDIVP-------EHPKFFMVTFLFIITGMAIMSMAFK-LGQSQIVCFYRRCIKSLSM 379          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk18 (potassium channel, subfamily K, member 18 [Source:ZFIN;Acc:ZDB-GENE-100405-2])

HSP 1 Score: 103.219 bits (256), Expect = 2.735e-23
Identity = 79/297 (26.60%), Postives = 137/297 (46.13%), Query Frame = 2
Query:  920 KEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIY----------------RIFSMRKNNKPKMVNVKSDSFSDIFKSLTI-------------TVIRKNKLETKDNNFQSIFQ------------------NCNVSFKLPTPNSIL--KAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWE-DWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICS-IYVLFGLSLCIMCFDLLGQKAKTCI-TKFLKSLKM 1654
            ++E +  W F  +L +  TV TT+GYG I P T  G++  +LYA++GIPLM++ ++++G L+A +L   Y                R+ S  K +    V   +D      + + +             + IR+   + ++N  + IF                   +C    ++PTP   L     ++ +  +VP  ++  +   Y +I S I   WE   +  +A YF+FITL+TIGFGD+VP       E  K  + + ++++ G+++  M F  LGQ    C   + +KSL M
Sbjct:   93 EKERDHGWTFFASLFFCCTVFTTVGYGRIYPLTSKGKVACVLYAMVGIPLMLLVISDVGDLLAVLLSKAYTRLNLFFRRWIGHQSWRLQSHEKTSALPQVQADTDGTYKFNQDVVVLETTNNQQVIQTRSSIRRGSFQLRNN--KEIFDRIIVRESFRIKGTLSKSCSCPELDRVPTPKDELFNDIGQEMEQLDVPLLVILLMVFAYMVICSQILKCWEKQMDHSDAFYFTFITLTTIGFGDIVP-------EHPKFFMVTFLFIITGMAIMSMAFK-LGQSQIVCFYRRCIKSLSM 379          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk18 (potassium channel, subfamily K, member 18 [Source:ZFIN;Acc:ZDB-GENE-100405-2])

HSP 1 Score: 103.219 bits (256), Expect = 2.892e-23
Identity = 79/297 (26.60%), Postives = 137/297 (46.13%), Query Frame = 2
Query:  920 KEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIY----------------RIFSMRKNNKPKMVNVKSDSFSDIFKSLTI-------------TVIRKNKLETKDNNFQSIFQ------------------NCNVSFKLPTPNSIL--KAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWE-DWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICS-IYVLFGLSLCIMCFDLLGQKAKTCI-TKFLKSLKM 1654
            ++E +  W F  +L +  TV TT+GYG I P T  G++  +LYA++GIPLM++ ++++G L+A +L   Y                R+ S  K +    V   +D      + + +             + IR+   + ++N  + IF                   +C    ++PTP   L     ++ +  +VP  ++  +   Y +I S I   WE   +  +A YF+FITL+TIGFGD+VP       E  K  + + ++++ G+++  M F  LGQ    C   + +KSL M
Sbjct:   93 EKERDHGWTFFASLFFCCTVFTTVGYGRIYPLTSKGKVACVLYAMVGIPLMLLVISDVGDLLAVLLSKAYTRLNLFFRRWIGHQSWRLQSHEKTSALPQVQADTDGTYKFNQDVVVLETTNNQQVIQTRSSIRRGSFQLRNN--KEIFDRIIVRESFRIKGTLSKSCSCPELDRVPTPKDELFNDIGQEMEQLDVPLLVILLMVFAYMVICSQILKCWEKQMDHSDAFYFTFITLTTIGFGDIVP-------EHPKFFMVTFLFIITGMAIMSMAFK-LGQSQIVCFYRRCIKSLSM 379          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk2a (potassium channel, subfamily K, member 2a [Source:ZFIN;Acc:ZDB-GENE-061226-2])

HSP 1 Score: 89.7373 bits (221), Expect = 1.262e-18
Identity = 74/258 (28.68%), Postives = 113/258 (43.80%), Query Frame = 2
Query:  842 EIEKFSNVIFNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIF--IFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLLGQ 1609
            E+E     +  A   G+ + S H SN   E++MW+   +  +A TVITTIG+G+++P T  GRI  I+YA++GIPL    LA +G                             D    IF      V             + +F   NVS              Q+K   V +T++F +F  + +  + + IF + E W+ LE++YF  ITL+TIGFGD V   S  +   Y   I   ++L GL+       ++G 
Sbjct:  111 ELEDLVKQVVLAIRAGV-NPSGHPSN---ESSMWDLSSSFFFAGTVITTIGFGNVSPHTEGGRIFCIIYALLGIPLFGFLLAGVG-----------------------------DQLGTIFGKGIAKV-------------EKMFVKWNVS--------------QTK-IRVTSTVLFILFGCLLFVALPALIFQHIEGWSALESIYFVVITLTTIGFGDFVAGGSEIEYLDYYKPIVWFWILVGLAYFAAVLSMIGD 307          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk2a (potassium channel, subfamily K, member 2a [Source:ZFIN;Acc:ZDB-GENE-061226-2])

HSP 1 Score: 89.3521 bits (220), Expect = 1.430e-18
Identity = 74/258 (28.68%), Postives = 113/258 (43.80%), Query Frame = 2
Query:  842 EIEKFSNVIFNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIF--IFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLLGQ 1609
            E+E     +  A   G+ + S H SN   E++MW+   +  +A TVITTIG+G+++P T  GRI  I+YA++GIPL    LA +G                             D    IF      V             + +F   NVS              Q+K   V +T++F +F  + +  + + IF + E W+ LE++YF  ITL+TIGFGD V   S  +   Y   I   ++L GL+       ++G 
Sbjct:   98 ELEDLVKQVVLAIRAGV-NPSGHPSN---ESSMWDLSSSFFFAGTVITTIGFGNVSPHTEGGRIFCIIYALLGIPLFGFLLAGVG-----------------------------DQLGTIFGKGIAKV-------------EKMFVKWNVS--------------QTK-IRVTSTVLFILFGCLLFVALPALIFQHIEGWSALESIYFVVITLTTIGFGDFVAGGSEIEYLDYYKPIVWFWILVGLAYFAAVLSMIGD 294          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: KCNK18 (potassium two pore domain channel subfamily K member 18 [Source:HGNC Symbol;Acc:HGNC:19439])

HSP 1 Score: 95.9005 bits (237), Expect = 9.220e-21
Identity = 85/309 (27.51%), Postives = 138/309 (44.66%), Query Frame = 2
Query:  866 IFNASSNGLSHKSFHESNKE------------EENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKN---NKPKMVNVKS---------------DSFSDIFKSLTITVIRKNKLETKDNNFQ----SIFQ----------------------NCNVSFKLPTPNSIL----KAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWE-DWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLLGQ 1609
            I   S NG + + F E  +E            +    W+F  +L +  TV TT+GYGHI P T  G++  ++YA +GIPLM++ LA++G ++A +L   Y+   +  N   +KPK + + S               DS   + + L IT + K +   K    Q     IF+                      +C      P  +S +    K   +    +VP  L+  + + Y + G+ I   WE DW  ++A YF F+TL+TIGFGD++P    +    +  ++ S Y + G+ +  M F  LGQ
Sbjct:   29 IATISDNGSAPEIFKELAREAIITDLQVEWLQKPEEQWSFKSSLFFCCTVFTTVGYGHICPVTMYGKLACMVYATLGIPLMLLLLADLGDILARLLSRTYKRAVLACNKLCHKPKPIKLSSLHKEHSGKSSLLKTMDSRVSMKEPLNITEVIKTQASVKRKYLQMRNIDIFELIIVKENQKVLPLKSSLQQKSFSCPDLDLWPPSDSAMQNFDKIGEELDHLDVPIVLIVLVMVAYIMCGACILPLWEDDWTTIDAFYFCFVTLTTIGFGDIIP----KHPNYF--LLLSAYTVVGMVIVCMAFK-LGQ 330          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: KCNK4 (potassium channel, two pore domain subfamily K, member 4 [Source:NCBI gene;Acc:100488063])

HSP 1 Score: 76.6406 bits (187), Expect = 2.744e-14
Identity = 68/258 (26.36%), Postives = 110/258 (42.64%), Query Frame = 2
Query:  914 SNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKN-NKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIF--IFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLLGQKAKTCITKFLKSLKMKLTGQELN 1678
            +N     T W+ G    +A T+ITTIGYG+  P+T  G+I  I YA++GIPL  I LA +G  +           S+RK   K +M+ +K          ++ T++R                                         V + L+F +   + + LI   IF   E+W  LE++YF  ITL+T GFGD V   +  +   YK ++   ++L GL+       ++G   +  +T+  ++    LT    N
Sbjct:   76 ANATNVTTRWDIGSCFFFAGTIITTIGYGNNAPKTDGGQIFCIFYALVGIPLFGILLAGVGDHLGS---------SLRKGIGKVEMLFLKW--------HVSATIVR-----------------------------------------VISALLFILIGCLLFVLIPMFIFQKIENWTLLESIYFVVITLTTTGFGDYVADGAGHEHTWYKPVVW-FWILLGLAYFASILTMIGNWLR-VLTRKTRAEMGGLTAHAAN 273          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: bcdin3d (BCDIN3 domain containing RNA methyltransfease [Source:Xenbase;Acc:XB-GENE-5859380])

HSP 1 Score: 70.8626 bits (172), Expect = 7.843e-13
Identity = 42/134 (31.34%), Postives = 77/134 (57.46%), Query Frame = 2
Query:  758 LYNVLYNTSEDFG--NSEQNQIKF----KTLIKVEIEKFSN-VIFNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIF 1138
            ++ VL   +ED    ++E++++ F      L K  ++   N VI +A   G+ H   +++     N  W+   +  +A TV+TTIGYG ++P+TP G+I  +LYA+ GIPL +I L  +G +++ + +++  IF
Sbjct:   26 VFQVLEKEAEDTAKTDTERHRLDFLKNYTCLTKEALDHLVNQVITDAVKQGI-HPLENQTKNSHSN--WDMSSSFFFAGTVVTTIGYGTLSPRTPGGQIFCVLYALFGIPLNVIVLGRVGKILSRVSKVLTIIF 156          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: pole4 (polymerase (DNA-directed), epsilon 4, accessory subunit [Source:Xenbase;Acc:XB-GENE-5722002])

HSP 1 Score: 72.0182 bits (175), Expect = 9.132e-13
Identity = 31/85 (36.47%), Postives = 47/85 (55.29%), Query Frame = 2
Query:  908 HESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIY----RIFSMRK 1150
             +S        W F G+  +A+TVITTIGYGH  P T  G++  + YA++GIPL ++   ++G  M   +R +     R F +RK
Sbjct:   79 QQSEPHRAGKQWKFAGSFYFAITVITTIGYGHAAPGTDAGKVFCMFYAVLGIPLTLVMFQSLGERMNTFVRFLLKKLKRCFRLRK 163          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: pole4 (polymerase (DNA-directed), epsilon 4, accessory subunit [Source:Xenbase;Acc:XB-GENE-5722002])

HSP 1 Score: 70.8626 bits (172), Expect = 2.051e-12
Identity = 31/85 (36.47%), Postives = 47/85 (55.29%), Query Frame = 2
Query:  908 HESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIY----RIFSMRK 1150
             +S        W F G+  +A+TVITTIGYGH  P T  G++  + YA++GIPL ++   ++G  M   +R +     R F +RK
Sbjct:   68 QQSEPHRAGKQWKFTGSFYFAITVITTIGYGHAAPGTDAGKVFCMFYAVLGIPLTLVMFQSLGERMNTFVRFLLKKLKRCFRLRK 152          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk18 (potassium channel, subfamily K, member 18 [Source:MGI Symbol;Acc:MGI:2685627])

HSP 1 Score: 89.7373 bits (221), Expect = 8.684e-19
Identity = 72/268 (26.87%), Postives = 118/268 (44.03%), Query Frame = 2
Query:  941 WNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILR-----------LIYRIFSMR--------KNNKP---KMVNVKSDSFSDIF-----------KSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPT------PNSIL----KAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWE-DWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLLGQK 1612
            W+F  AL +  TV +T+GYGH+ P T LG+   +LYA+ GIPLM + L +IG ++A IL            L + IF  R         ++KP    +  +  D+  D              S  + +  +     K N  Q   +    S   P         SIL    +  +Q +  ++P  ++  +   Y    + I  +WE +  F +A YF F+TL+TIGFGD+V          +  +  SIY++ G+ +  + F L+  +
Sbjct:  112 WSFLSALFFCCTVFSTVGYGHMYPVTRLGKFLCMLYALFGIPLMFLVLTDIGDILATILSRAYSRFQALLCLPHDIFKWRSLPLCRKQPDSKPVEEAIPQIVIDAGVDELLNPQPSKDPPSPSCNVELFERLVAREKKNKLQPPTRPVERSNSCPELVLGRLSCSILSNLDEVGQQVERLDIPLPVIALVVFAYISCAAAILPFWETELGFEDAFYFCFVTLTTIGFGDIV------LVHPHFFLFFSIYIIVGMEILFIAFKLMQNR 373          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk4 (potassium channel, subfamily K, member 4 [Source:MGI Symbol;Acc:MGI:1298234])

HSP 1 Score: 86.6557 bits (213), Expect = 1.120e-17
Identity = 65/247 (26.32%), Postives = 108/247 (43.72%), Query Frame = 2
Query:  845 IEKFSNVIFNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFI---FYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSIYVLFGLS 1576
            +E F  ++  A   G + ++   +N    ++ WN G A  ++ T+ITTIGYG+I   T  GR+  I YA++GIPL  + LA +G  +           S+R+                                    + ++IF   +V      P  ++++           + V F+ I    + L  + +F Y E W+ LEA+YF  +TL+T+GFGD VP   T Q       +   ++LFGL+
Sbjct:   58 LEDFIKLLVEALGGGANPET-SWTNSSNHSSAWNLGSAFFFSGTIITTIGYGNIVLHTDAGRLFCIFYALVGIPLFGMLLAGVGDRLGS---------SLRRGI---------------------------------GHIEAIFLKWHV------PPGLVRSL----------SAVLFLLIGCLLFVLTPTFVFSYMESWSKLEAIYFVIVTLTTVGFGDYVPGDGTGQNSPAYQPLVWFWILFGLA 245          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk10 (potassium channel, subfamily K, member 10 [Source:MGI Symbol;Acc:MGI:1919508])

HSP 1 Score: 85.8853 bits (211), Expect = 3.832e-17
Identity = 75/259 (28.96%), Postives = 108/259 (41.70%), Query Frame = 2
Query:  842 EIEKFSNVIFNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIF--IFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKST--RQTEQYKSIICSIYVLFGLSLCIMCFDLLG 1606
            E+E       +A + G+S       N    ++ W+ G A  +A TVITTIGYG+I P T  G+I  ILYAI GIPL    LA IG                             D    IF      V             + +F+   VS              Q+K   V +T++F +   I +  I + IF Y E W  LE++YF  +TL+T+GFGD V   +      E YK ++   ++L GL+       ++G
Sbjct:  120 ELETLIQHALDADNAGVSPVG----NSSNSSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGIG-----------------------------DQLGTIFGKSIARV-------------EKVFRKKQVS--------------QTK-IRVISTILFILAGCIVFVTIPAVIFKYIEGWTALESIYFVVVTLTTVGFGDFVAGGNAGINYREWYKPLVW-FWILVGLAYFAAVLSMIG 316          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk10 (potassium channel, subfamily K, member 10 [Source:MGI Symbol;Acc:MGI:1919508])

HSP 1 Score: 85.5001 bits (210), Expect = 4.560e-17
Identity = 75/259 (28.96%), Postives = 108/259 (41.70%), Query Frame = 2
Query:  842 EIEKFSNVIFNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIF--IFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKST--RQTEQYKSIICSIYVLFGLSLCIMCFDLLG 1606
            E+E       +A + G+S       N    ++ W+ G A  +A TVITTIGYG+I P T  G+I  ILYAI GIPL    LA IG                             D    IF      V             + +F+   VS              Q+K   V +T++F +   I +  I + IF Y E W  LE++YF  +TL+T+GFGD V   +      E YK ++   ++L GL+       ++G
Sbjct:  106 ELETLIQHALDADNAGVSPVG----NSSNSSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGIG-----------------------------DQLGTIFGKSIARV-------------EKVFRKKQVS--------------QTK-IRVISTILFILAGCIVFVTIPAVIFKYIEGWTALESIYFVVVTLTTVGFGDFVAGGNAGINYREWYKPLVW-FWILVGLAYFAAVLSMIG 302          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk2 (potassium channel, subfamily K, member 2 [Source:MGI Symbol;Acc:MGI:109366])

HSP 1 Score: 74.3294 bits (181), Expect = 1.170e-13
Identity = 60/232 (25.86%), Postives = 99/232 (42.67%), Query Frame = 2
Query:  914 SNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLLGQ 1609
             N   + + W+ G +  +A TVITTIG+G+I+P+T  G+I  I+YA++GIPL        G L+A +   +  IF        K +    D+F           I+ N  +TK     +                                 + F  + +  + + IF + E W+ L+A+YF  ITL+TIGFGD V   S  +   +   +   ++L GL+       ++G 
Sbjct:  121 GNSSNQVSHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALLGIPLF-------GFLLAGVGDQLGTIFG-------KGIAKVEDTF-----------IKWNVSQTKIRIIST------------------------------IIFILFGCVLFVALPAVIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYFAAVLSMIGD 297          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|P34410|TWK7_CAEEL (TWiK family of potassium channels protein 7 OS=Caenorhabditis elegans OX=6239 GN=twk-7 PE=3 SV=3)

HSP 1 Score: 103.99 bits (258), Expect = 4.607e-22
Identity = 78/274 (28.47%), Postives = 134/274 (48.91%), Query Frame = 2
Query:  794 GNSEQNQIKFKTLIKVEIEKFSNVIFNASSNGLSHKSFHESNKEEENTM---WNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLLG 1606
              +E  + ++++L +  +   S+ +F A       K F  SN+ ++N     W F  ++ +AVTV+TTIGYG+  P T +GRI  IL++++GIPL ++ +A++G  +++ L  +Y        N  K+            K L ++  RK + E        + ++C+ S  +    +I       +   +PA LV  I I Y   G  +    E W+F  + Y+SFIT++T+GFGDL+P +          II        L++  MC DL+G
Sbjct:  218 AGNETKRYEWESLAERHMHNMSDQLFVAFE-----KYFLTSNEVKKNAATETWTFSSSIFFAVTVVTTIGYGNPVPVTNIGRIWCILFSLLGIPLTLVTIADLGKFLSEHLVWLY-------GNYLKL------------KYLILSRHRKERRE-------HVCEHCH-SHGMGHDMNI-------EEKRIPAFLVLAILIVYTAFGGVLMSKLEPWSFFTSFYWSFITMTTVGFGDLMPRRDGYMYIILLYIILG------LAITTMCIDLVG 446          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|Q18120|TWK18_CAEEL (TWiK family of potassium channels protein 18 OS=Caenorhabditis elegans OX=6239 GN=twk-18 PE=1 SV=2)

HSP 1 Score: 102.834 bits (255), Expect = 6.018e-22
Identity = 68/232 (29.31%), Postives = 114/232 (49.14%), Query Frame = 2
Query:  926 EENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIF--SMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSI-ICSIYVLFGLSLCIMCFDLLGQK 1612
            +++  W F G++ Y +TV TTIGYG+I P T  GR  TILYA +GIPL ++ L  +G+L A   ++++R F  S R  +K  + N  S++  +I +  T       K E  D++  S                             P + +  I + + +  + +F + E+W+F  ++YF+ I+ +TIGFGD++P         Y  + I  + +L GLSL      L+ Q+
Sbjct:  109 DKDIHWTFLGSIFYCMTVYTTIGYGNIVPGTGWGRFATILYAFIGIPLTVLSLYCLGSLFAKGCKMLWRFFLKSTRVVSK-DLSNKISEAADNIEEGTTAITPSAEKTENNDDDLLSF----------------------------PISGLLLITVIWVIFCAVLFTFLEEWDFGTSLYFTLISFTTIGFGDILP-------SDYDFMPIVGVLLLIGLSLVSTVMTLIQQQ 304          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|Q6Q1P3|KCNKI_RAT (Potassium channel subfamily K member 18 OS=Rattus norvegicus OX=10116 GN=Kcnk18 PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 8.784e-20
Identity = 73/265 (27.55%), Postives = 118/265 (44.53%), Query Frame = 2
Query:  941 WNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFS-----------------MRK--NNKPK-------MVNVKSDSFSD-------IFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPT------PNSIL----KAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWE-DWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLL 1603
            W+F  AL +  TV +T+GYGH+ P T LG+   +LYA+ GIPLM + L +IG ++A IL   Y  F                   RK  ++KP        +++  +D   D          S  + +  +     K N  Q   +    S   P         SIL    +  +Q +  ++P  ++  +   Y    + I  +WE D  F +A YF F+TL+TIGFGD+V +        +  +  SIY++ G+ +  + F L+
Sbjct:  123 WSFLSALFFCCTVFSTVGYGHMYPVTRLGKFLCMLYALFGIPLMFLVLTDIGDILAAILSRAYSRFQALLCLPRDISKWRPLLLCRKQTDSKPADEAIPQIVIDAGADELLDPQPSREPASPSCNVELFERLVAREKQNELQPPMRPVERSNSCPELVLGRLSCSILSNLDEVGQQVERLDIPLPVIALVIFAYISCAAAILPFWETDLGFEDAFYFCFVTLTTIGFGDIVLVHP------HFFLFFSIYIIVGMEILFIAFKLM 381          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|Q96T55|KCNKG_HUMAN (Potassium channel subfamily K member 16 OS=Homo sapiens OX=9606 GN=KCNK16 PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.018e-18
Identity = 77/293 (26.28%), Postives = 124/293 (42.32%), Query Frame = 2
Query:  821 FKTLIKVEIEKFSNVIFNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSI---ICSIYVLFGLSLCIMCFDLLGQKAKTCITKFLKSLKMKLTGQELNSNQP 1690
            +  L +  +E+F  VI  A   G++ K           + W+FG +  +A TV+TTIGYG++ P T  G++  + YA++GIPL +I L ++GT +   L  I R       ++P+    +S     +  +L +T+                                              TLV  IF         +F + E W+F E  YF+FITLSTIGFGD V    T  ++ Y S+   + +I++L GL+   +   L       C   +L SL+     +     +P
Sbjct:   58 YTCLDQWAMEQFVQVIMEAWVKGVNPK-----GNSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEAGQVFCVFYALLGIPLNVIFLNHLGTGLRAHLAAIERW-----EDRPR----RSQVLQVLGLALFLTL---------------------------------------------GTLVILIFP------PMVFSHVEGWSFSEGFYFAFITLSTIGFGDYV--VGTDPSKHYISVYRSLAAIWILLGLAWLALILPLGPLLLHRCCQLWLLSLRQGCGAKAAPGRRP 283          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|Q6VV64|KCNKI_MOUSE (Potassium channel subfamily K member 18 OS=Mus musculus OX=10090 GN=Kcnk18 PE=1 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 6.075e-18
Identity = 72/268 (26.87%), Postives = 118/268 (44.03%), Query Frame = 2
Query:  941 WNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILR-----------LIYRIFSMR--------KNNKP---KMVNVKSDSFSDIF-----------KSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPT------PNSIL----KAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWE-DWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLLGQK 1612
            W+F  AL +  TV +T+GYGH+ P T LG+   +LYA+ GIPLM + L +IG ++A IL            L + IF  R         ++KP    +  +  D+  D              S  + +  +     K N  Q   +    S   P         SIL    +  +Q +  ++P  ++  +   Y    + I  +WE +  F +A YF F+TL+TIGFGD+V          +  +  SIY++ G+ +  + F L+  +
Sbjct:  112 WSFLSALFFCCTVFSTVGYGHMYPVTRLGKFLCMLYALFGIPLMFLVLTDIGDILATILSRAYSRFQALLCLPHDIFKWRSLPLCRKQPDSKPVEEAIPQIVIDAGVDELLNPQPSKDPPSPSCNVELFERLVAREKKNKLQPPTRPVERSNSCPELVLGRLSCSILSNLDEVGQQVERLDIPLPVIALVVFAYISCAAAILPFWETELGFEDAFYFCFVTLTTIGFGDIV------LVHPHFFLFFSIYIIVGMEILFIAFKLMQNR 373          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: T1EGH1 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20195673 PE=3 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 1.582e-45
Identity = 101/279 (36.20%), Postives = 156/279 (55.91%), Query Frame = 2
Query:  809 NQIKFKTLIKVEIEKFSNVIFNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYR-------IFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNN-FQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVP-IKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLLGQKAK 1618
            N  +F  +IK  + ++  VI  A  N   +  F     +E +  W+F G+LLYAVTVITTIGYGH+ P+TP+GR+ TILYA++GIPL  + L+N+G   A   RL Y+       I+     +K +M+NV+                R+ + + K    F SI ++  +S K    +   +   +     VP ++   I   Y  +G+ +F YWE W+ + + YF FITLSTIGFGDLVP I S+++    K ++CS++++ GLSL  MCF+L+ ++ K
Sbjct:   97 NHTQFADIIKNVLYRYQEVIVMAVKNEGFNGKF---GSDESSIQWSFAGSLLYAVTVITTIGYGHVVPKTPVGRLVTILYALLGIPLTFLYLSNVGNFAAKCFRLFYKKFCCGLCIYVRLLRHKRRMLNVR----------------RQAEAQMKSQEAFDSIVESTFISAKRGGAS---EDDLEYVKMTVPISICLIIITLYIYLGAQLFSYWEKWDLITSSYFCFITLSTIGFGDLVPGIDSSQEKAHQKLMLCSLWLVVGLSLLAMCFNLMQEEVK 353          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: V3ZUS1 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_94184 PE=3 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 1.741e-44
Identity = 98/259 (37.84%), Postives = 146/259 (56.37%), Query Frame = 2
Query:  848 EKFSNVIFNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRK-----NNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWE-DWNFLEAVYFSFITLSTIGFGDLVPIKSTRQ-TEQYKSIICSIYVLFGLSLCIMCFDLL 1603
            E+F   ++ A  NG   +    + + EE   W+F G+LLY+VTVITTIGYGH+TP+T  GRI TI YAI+GIPL ++CL+NIG L+A + R++++    ++     NN+P  V         I   +   ++R     ++D    S              N+IL+  R S    VP  +   +   Y  +G+ +F  WE  W++++A YF F+TLSTIGFGDLVP  +      QYK + C++Y+LFGL +  MCFDL+
Sbjct:   75 EEFQQSVYVAVQNGWDGQDIFATKEIEEE--WSFAGSLLYSVTVITTIGYGHLTPRTNWGRIVTIFYAIIGIPLTLLCLSNIGCLLAKLFRILWKHTQCKRCCKKENNEPGSV---------IENPINKPLVRGQG--SRDVISDSAHY-----------NNILENRRHSDIIRVPIPICLCLLALYIGLGALLFRLWERSWSYMDASYFCFVTLSTIGFGDLVPGYTHESWGNQYKRVACTLYLLFGLVVVAMCFDLI 309          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: A0A4S2MDN7 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000757 PE=3 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 5.163e-43
Identity = 145/505 (28.71%), Postives = 234/505 (46.34%), Query Frame = 2
Query:  320 FFEIVFSNIGLSLAVIVYVLLGAFIFQFLEEMSEITRYKTYKKDVVLAKLNITEQIMMIHQN----------FEFPKSKFHLNHSQASSNELNYYEFRIFLNKILFYSETFRDF-------QQNKTLFQILCNGTDXXXXXXXXXXXXWLADFYNLILPRFE--------NLYNVLYNTSEDFGNSEQNQIKFKTLIKVEIEKFSNVIFNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRI-FSMRKNNKPKMVNVKSDSFSDIFK-------SLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNS---------------------ILKAARQSKST----EVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQ--TEQYKSIICSIYVLFGLSLCIMCFDLLGQKAKTCITKFLKSLKM 1654
            F   +FS+IGL L VI Y  LGA IF  +E+  +I+  + ++ +V  A   I +++++ HQ            ++       +  QA++  L     R+     L+  E+ R            +T  + L NG+              L    + IL  F+        +L    ++  ED G   ++Q  F  L  + + + +N     S+     +    S  E+   MW   GALLYA TVITTIGYGHI P+T LGR  T+LYA+ GIPL+++ +AN+G  +A  +RL+Y++    R+  +P+    K+++  ++FK        + I ++  +  +       S+ +    + +L TP +                     I K A + KS      VP  L   I + Y ++G+ IF  WE W+ L++ YF FITLSTIGFGD VP     Q   +  K I C  Y+L GLS+  MCF L+ ++ KT   +F + + +
Sbjct:  118 FISFLFSHIGLCLLVIGYCALGAVIFLHIEKDHQISSIRKHRCNVTNATQQI-QRLLVEHQKTLVKNCTIFIIQWIAEYIDKSLDQANATSL----IRLMR---LYEEESTRQTTNFSLGNPDERTSLESLENGSTGPLAQLFAQ----LEQIQSEILQHFQLQAMDFSGSLIIATFDAFED-GWKPRDQGTFSVLDNLNVSRSTNHSLCCSA-----QCADLSESEKHQVMWTLTGALLYATTVITTIGYGHIVPRTELGRFVTVLYAMFGIPLVLLFMANLGGFLASCVRLLYKLCLRSRQKRQPEQ---KANASREMFKKTPPEELQMKIIIMENDSEQQTTTTEGSMKEGGKKNGQLSTPKAAHPRRSSVQQFIHTLTTSQSLISKRANKPKSKSQEIRVPIWLTLLIILIYLIVGAIIFSIWEGWSVLQSAYFVFITLSTIGFGDFVPGIQKDQWYKDSRKPIFCCFYLLIGLSMIAMCFSLMQEEVKTKFRRFAERIGL 601          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: A0A077ZBB5 (TWiK family of potassium channels protein 7 OS=Trichuris trichiura OX=36087 GN=TTRE_0000592401 PE=3 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.359e-42
Identity = 95/241 (39.42%), Postives = 136/241 (56.43%), Query Frame = 2
Query:  908 HESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIY-RI--FSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFK------LPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLL 1603
            ++   E+    W F GALLY++T+ TTIGYGHI P+T LGR  TILYA++GIPLM++CLANI   +  +   +Y RI  F  R   + + +       ++I    T TV R N  E    + +S   +    F+      L  P  ++   R  K   VP ++     + + L G+ +F  WE+WN  +  YFSF+TL+TIGFGD+VP KS     Q K IICS+Y+LFG++L  MCF L+
Sbjct:   87 YDGEDEQIKYQWTFFGALLYSITIFTTIGYGHICPKTKLGRAITILYAMIGIPLMLLCLANIADSLVRLFTFVYSRICCFYCRMKKQERWMKR-----ANISVRYTNTVPRFNDEEVVGTSERSHEADIRSDFRRYEESALKVPKRLVNQYRYEK---VPVSVGILTVVLFILGGAVLFAVWENWNVFDGAYFSFVTLTTIGFGDMVPGKSLDSGSQEKLIICSLYLLFGMALIAMCFKLM 319          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: A0A2H2I413 (Uncharacterized protein OS=Caenorhabditis japonica OX=281687 PE=3 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 1.034e-41
Identity = 106/312 (33.97%), Postives = 164/312 (52.56%), Query Frame = 2
Query:  719 ADFYNLILPRFENLYNVLYNTSEDFGNSEQNQIKFKTLIKVEIEKFSNVIFNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIY--------RIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFK-LPTPNSILK-------AARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTE--QYKSIICSIYVLFGLSLCIMCFDL 1600
            A+   L+    E   +V++N +  F  +  +  K+K+ +  E++ F  +   +   G   K F +  +      W F G+ LY++T+ITTIGYG+   +T +G+  T+LYAI+GIPLM++ L NIG +MA I R +Y        R+    K  K   +   +        SL   + R ++++T D++  S         + L T    ++       AA Q +S  VP +LV F  + Y  +G+TIF  WE W FLE+ YF FI+L+TIGFGD  P  S   T+  Q K +I SIY+LFG++L  MCF+L
Sbjct:   54 AEVQELVKRARERAVDVVWNAT--FRVNRLDSKKWKSTVLNEVKAFKTICMQSIRKGYDGKEFGKQAQ------WTFTGSFLYSLTIITTIGYGNTAAKTYIGKTLTMLYAIIGIPLMLLFLTNIGDVMAKIFRFLYAQSIRLKFRLILWHKKRKAAKIRRAN--------SLVSRLTRGHRVKT-DSSVDSFGLGAGADVEDLLTARVEMEQLEVRETAAAQLESVSVPISLVVFTMLGYLGVGTTIFKVWEGWTFLESFYFCFISLTTIGFGDKFPSTSVSNTDEAQEKLVITSIYLLFGMALLAMCFNL 348          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: ENSAMXT00000047723.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:15897283:15919205:1 gene:ENSAMXG00000033807.1 transcript:ENSAMXT00000047723.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.0561 bits (240), Expect = 7.119e-21
Identity = 74/280 (26.43%), Postives = 136/280 (48.57%), Query Frame = 2
Query:  926 EENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADIL------------RLIYRIFSMRKNNKPK-MVNVKSDSF----SDIFKSLTI-----TVIRKNKLETKDNNF---QSIFQN------------------CNVSFKLPTP------NSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWE-DWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLLGQKA 1615
            + +  W+F G+L +  TV TT+GYG I P T  GR+  ILYA +GIPLM++ + ++G ++A +             RL+YR+++   + KP+  V ++  ++      + + +++     T I  + +E K ++    ++IF +                  C    ++P P         L    + +   VP  ++  +   Y LI + I   WE D    +A YF FITL+TIGFGD+VP    +  + +  ++  ++++ G+++  M F  LG +A
Sbjct:  218 QSSDRWHFYGSLFFCCTVFTTVGYGEIYPVTKAGRVACILYATVGIPLMLLVITDVGDILAVLFSNSYRRLHSSCRRLLYRVWN--PHQKPRDPVTIRDGTYIFNRDVVVQEVSVDHRIGTAIDSSVIEQKPDHLLKNKNIFNHIIAKEKFRRKRPLTRSCSCPELNQMPPPPVGFKIKDFLSIGHEMERFNVPFLVILLVVFAYILIWALILPIWEDDLGKFDAFYFCFITLTTIGFGDIVP----KHPKFF--MLTFLFIIMGMAIMSMAFK-LGSRA 488          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: kcnk17 (potassium channel, subfamily K, member 17 [Source:ZFIN;Acc:ZDB-GENE-120113-3])

HSP 1 Score: 77.7962 bits (190), Expect = 2.511e-15
Identity = 61/236 (25.85%), Postives = 98/236 (41.53%), Query Frame = 2
Query:  875 ASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIF--IFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSIYVLFGLS 1576
            A+ NGLS K  H +        + +  + ++A TV+TTI YG+++P T  G+I  +++AI GIPL ++ L  +G  M  I                                           E K  NF +   NC                   K   V    +FF+   + Y ++   +F  +E W + +A+Y+ FITLSTIGFGD V     ++   +   I  +++ FGL+
Sbjct:   82 ATKNGLSLKGNHTTGG-----FFKYTSSAVFAATVVTTI-YGNMSPSTTPGQIFCVIFAIFGIPLNMVVLNRVGKYMLAI-------------------------------------------ERKFCNFIATKTNCQ------------------KFMRVSIHFLFFLISSVLYFMVPMLLFKQYEGWTYAQAIYYCFITLSTIGFGDYVAYNPDKEYPDWYGCIMGVWIFFGLA 250          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: kcnk10a (potassium channel subfamily K member 10-like [Source:NCBI gene;Acc:103032675])

HSP 1 Score: 79.7221 bits (195), Expect = 3.434e-15
Identity = 77/270 (28.52%), Postives = 115/270 (42.59%), Query Frame = 2
Query:  941 WNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIF--IFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYK--SIICSIYVLFGLSLCIMCFDLLGQKAKTCITKFLKSL-KMKLTGQELNSNQP*KIK*NFRSTSIRIA 1735
            W+ G A  +A TVITTIGYG+I P T  G+I  ILYAI GIPL        G L+A +                       D    IF     T+ +  K+  + +N  S                      Q+K   V +TL+F +   I +  I + IF + E W  L+A+YF  ITL+T+G GD V     R+ E YK    +   ++L GL+       ++G   +    K  + + + K    E  +N    ++  FR T  R++
Sbjct:  170 WDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLF-------GFLLAGV----------------------GDQLGTIF---VKTIAKVEKIFRRKHNQIS----------------------QTK-IRVASTLLFILVGCIVFVTIPALIFQHIEGWTGLDAIYFVVITLTTVGIGDYV-AGGDRRIEYYKWYKPLVWFWILVGLAYFAAVLSMIGDWLRVLSKKTKEEVGEFKAHAAEWKAN----VRAEFRETRRRLS 379          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: kcnk10b (potassium two pore domain channel subfamily K member 10 [Source:NCBI gene;Acc:103030192])

HSP 1 Score: 78.5666 bits (192), Expect = 5.339e-15
Identity = 64/228 (28.07%), Postives = 99/228 (43.42%), Query Frame = 2
Query:  932 NTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADI-LRLIYRIFSM-RKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTR-QTEQYKSIICSIYVLFGLSLCIMCFDLLG 1606
            ++ W+ G A  +A TVITTIGYG+I P T  G+I  ILYAI GIPL    LA IG  +  I ++ I ++  + RK+ +     ++          +T T++              I   C V   +P                         FIF ++         E W  LEA+YF  ITL+T+G GD V     R + +++   +   ++L GL+       ++G
Sbjct:  151 SSHWDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGIGDQLGTIFVKSILKVEQIFRKHRQISQTKIR----------VTSTIL-------------FILAGCIVFVTIPA------------------------FIFKHI---------EGWTALEAIYFVVITLTTVGIGDYVAGGDRRIEYKKWYKPLVWFWILVGLAYFAAVLSMIG 322          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: kcnk5a (potassium two pore domain channel subfamily K member 5 [Source:NCBI gene;Acc:103027816])

HSP 1 Score: 78.5666 bits (192), Expect = 6.652e-15
Identity = 61/230 (26.52%), Postives = 97/230 (42.17%), Query Frame = 2
Query:  821 FKTLIKVEIEKFSNVIFNASSNGLS---HKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLV 1501
            +  L K +++K   V+  A+  G++    K+F+          WN+  A+++A TVITTIGYG+I P+TP GR+  I Y + G+PL +  ++ +G       + + +  + R                          +RK +              C   F L                 V   LV   F+F +  G T         ++E +YFSF+TL+TIGFGDLV
Sbjct:   49 YPCLTKYDLDKILEVVSEAAGQGVTITGDKTFNN---------WNWPNAVIFAATVITTIGYGNIAPKTPSGRVFCIFYGLFGVPLCLTWISELGKFFGGRAKHLGQYLTKRG-----------------------VTLRKAQF------------TCTAIFLL---------------WGVLVHLVIPPFVFMSQEGWT---------YIEGLYFSFVTLTTIGFGDLV 210          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003416.1 (pep scaffold:Pmarinus_7.0:GL476517:78247:80718:1 gene:ENSPMAG00000003129.1 transcript:ENSPMAT00000003416.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 126.716 bits (317), Expect = 1.995e-33
Identity = 68/201 (33.83%), Postives = 105/201 (52.24%), Query Frame = 2
Query:  941 WNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMR-------KNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAA------RQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVP 1504
            WNF G+L +  T+ TTIGYGHI P T  G+I  ++YA  GIP+M++ LA++G L+A  L  IY  F  R           P     + +        +  +   + + +  D   +S   +     +LP   SI + A      R+ K  +VP TL+F I   Y + G+ +   WE+W++L+A YF F+T++TIG GD+VP
Sbjct:    2 WNFLGSLFFCCTIFTTIGYGHIAPSTDGGKIMCMVYATFGIPIMLLVLADVGDLLARTLTTIYTSFRHRLLPGARCGRQHPPGDGPEGNDLQRSRTKIDDSHRHEGEDDAVDVPLKSPGSDVEGGRELPATVSIAEGADVPEADREVKELDVPFTLIFLIVFVYLMFGTFLLPCWEEWSYLDAFYFVFVTMTTIGLGDIVP 202          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: KCNK10 (potassium two pore domain channel subfamily K member 10 [Source:HGNC Symbol;Acc:HGNC:6273])

HSP 1 Score: 77.7962 bits (190), Expect = 6.500e-16
Identity = 64/237 (27.00%), Postives = 99/237 (41.77%), Query Frame = 2
Query:  917 NKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANI----GTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPI--KSTRQTEQYKSIICSIYVLFGLSLCIMCFDLLGQ 1609
            N    +++W+ G A  +A TV+TTIGYG+++P T  GRI    YA++GIP+    LA +    GT+    +  + ++F M+ +     + V S   + IF                      I   C +   LPT                                  IFM+ E W  LEA+YF  ITL+TIGFGD V    +     E YK ++   ++L G++       ++G 
Sbjct:   94 NTNHSSSLWDLGSAFFFAGTVLTTIGYGNVSPSTDWGRIFCTAYALVGIPIFGFLLAGVGDQLGTIFGKAIGRVEKVF-MKWHVSATWIRVIS---TIIF----------------------IMMGCGLFVVLPT---------------------------------IIFMHIELWTPLEAIYFVVITLTTIGFGDYVAGGNRDIVYREWYKPLVW-FWILLGMAYFAAILSMIGD 270          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: kcnk13a (potassium channel, subfamily K, member 13a [Source:ZFIN;Acc:ZDB-GENE-080219-46])

HSP 1 Score: 60.4622 bits (145), Expect = 6.147e-10
Identity = 60/227 (26.43%), Postives = 94/227 (41.41%), Query Frame = 2
Query:  941 WNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMI----ICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYK--------------SIICSIYVLF 1567
            W+F GA  +  TV++TIG+G  TP T  G+I  I Y + G    I    + L  + TL+A ++R  +R    R+ N+                 L I   RK        + QS    C   +K P+   ++              ++    +      S +F   E W++++++YF F+  STIGFGDLV    T Q + Y               + +C IY LF
Sbjct:  115 WDFTGAFYFVGTVVSTIGFGMTTPTTVSGKIFLIFYGLFGCAAGILFFNLFLERLITLLACVMRSCHR----RQINR-----------------LVIQPGRK-------ASDQSDAIECLAGWK-PSVYHVM-------------MILGIAAVAIACSASAMFSAVEGWSYVDSLYFCFVAFSTIGFGDLV----TGQRDLYDHQTWYRVGNIVFILAGVCCIYSLF 295          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: kcnk7 (potassium channel, subfamily K, member 7 [Source:ZFIN;Acc:ZDB-GENE-110304-2])

HSP 1 Score: 58.9214 bits (141), Expect = 9.162e-10
Identity = 29/83 (34.94%), Postives = 44/83 (53.01%), Query Frame = 2
Query:  845 IEKFSNVIFNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANI 1093
            +E F      A ++G+S               W+F  AL +A TV+TT+GYGH  P +  G+   ILYA++GIP  ++ L +I
Sbjct:   61 LEGFLRDALEARTHGVS-----ALRNATAGPHWDFVSALFFASTVLTTVGYGHTVPLSDAGKALCILYAVLGIPFTLLLLTSI 138          

HSP 2 Score: 47.7506 bits (112), Expect = 4.169e-6
Identity = 20/41 (48.78%), Postives = 26/41 (63.41%), Query Frame = 2
Query: 1427 EDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIIC 1549
            E W FL A YF FI+LST+G GD VP ++ RQ  +    +C
Sbjct:  201 EGWGFLGAFYFCFISLSTVGLGDYVPGEADRQPSRELYKVC 241          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: KCNK16 (potassium two pore domain channel subfamily K member 16 [Source:HGNC Symbol;Acc:HGNC:14464])

HSP 1 Score: 56.9954 bits (136), Expect = 2.195e-9
Identity = 28/75 (37.33%), Postives = 43/75 (57.33%), Query Frame = 2
Query:  845 IEKFSNVIFNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPL 1069
            ++ F   + +A S+G+   +   S+       W+F  ALL+ VTV+TTIGYG   P +  GR +   YA++GIPL
Sbjct:   67 LDLFLQEVLDARSHGVRVAAGQASSPSN----WDFSSALLFTVTVVTTIGYGSTAPGSTWGRASCAFYALLGIPL 137          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Yeast
Match: TOK1 (Outward-rectifier potassium channel of the plasma membrane; has two pore domains in tandem, each of which forms a functional channel permeable to potassium; carboxy tail functions to prevent inner gate closures; target of K1 toxin [Source:SGD;Acc:S000003629])

HSP 1 Score: 51.6026 bits (122), Expect = 2.679e-7
Identity = 46/194 (23.71%), Postives = 88/194 (45.36%), Query Frame = 2
Query:  947 FGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKP-----KMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTE---VPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVP 1504
            +G AL +    + T+G G I P++   +I  +++++ G+ LM         L+  + R I     ++K++ P     ++   +S S+     S       KN  E +             +F L      +K  RQ+ S +      ++   IF+ + L+G+ +F + E+W++   +YF F+ L TIG+GD  P
Sbjct:  274 YGNALYFCTVSLLTVGLGDILPKSVGAKIMVLIFSLSGVVLM--------GLIVFMTRSI-----IQKSSGPIFFFHRVEKGRSKSWKHYMDS------SKNLSERE-------------AFDL------MKCIRQTASRKQHWFSLSVTIAIFMAFWLLGALVFKFAENWSYFNCIYFCFLCLLTIGYGDYAP 429          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO47668 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLC5])

HSP 1 Score: 89.7373 bits (221), Expect = 7.678e-20
Identity = 67/248 (27.02%), Postives = 112/248 (45.16%), Query Frame = 2
Query:  842 EIEKFSNVIFNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKST--RQTEQYKSIICSIYVLFGLSL 1579
            E+++F +V+  A+S GL+     +         W++ G+L ++ TVITTIGYGH++P+T  GRI  +LYA+ GIP+  + L ++G       +++  I S  +       N +S SF                      NF  +     +S                          F + +   ++G    ++ E+W F E  YF+FI+L+TIGFGD VP+      +  +  S   S++VLF + L
Sbjct:   62 EMKEFVDVVQKAASFGLTQDWLEK---------WSYTGSLFFSGTVITTIGYGHLSPETFFGRIFCMLYALFGIPITWLMLTSLGK------KIVEHISSFLQGFSSSCCNTQSKSF----------------------NFFCLLAAIGLS--------------------------FVVMVIVAIVG----IFSENWTFFEGFYFAFISLTTIGFGDYVPLHPNVDHKDIEKSSFRISLFVLFCMFL 242          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO33193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSX6])

HSP 1 Score: 88.5817 bits (218), Expect = 1.123e-19
Identity = 64/253 (25.30%), Postives = 113/253 (44.66%), Query Frame = 2
Query:  839 VEIEKFSNVIFNASSNGLSHKSF---HESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSI---YVLFGLSL 1579
            VE++      +N +S  L    F    ++N +     W+F G++ +A TVITTIGYGH  P+TP G+I  ++YA +GIPL +    +IG      L  ++R    +   K           +D+  +  + V+                  C +   + T +S                            G+ IF ++E W++  ++Y+ FIT++TIGFGD V ++ ++  E+Y +    I   ++ FGL++
Sbjct:   42 VELQARLTRKYNITSTDLKSWEFFLVAKANLKANLYQWSFAGSVYFATTVITTIGYGHTVPRTPRGKIFCMIYAAVGIPLALTMFQSIGERFNTFLACMFRRLKRKLGMKA----------TDVSSTTNLVVV------------------CGLLAMVITVSS----------------------------GAFIFTHYEKWDYFHSLYYCFITVTTIGFGDYVALQDSKD-ERYSNKYVGISLLFIFFGLTI 237          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO38072 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE00])

HSP 1 Score: 87.4261 bits (215), Expect = 2.564e-19
Identity = 55/194 (28.35%), Postives = 86/194 (44.33%), Query Frame = 2
Query:  941 WNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQ 1522
            W+F GA  +    + T+GYG I P+TP+GR  TI+Y ++G+PL ++ L   G  +  ++      F  R    P                                               P+P+S+ +           AT V  + ++  L+ + + MY E+W+FL++ Y  FIT STIGFGDLVP++S RQ
Sbjct:   33 WDFLGACAFTFAALLTVGYGDIIPETPIGRGLTIIYCLVGLPLSVMALKTGGEAVVHLISSTEAFFYSRTCGTP-----------------------------------------------PSPHSLRRCL---------ATSVILVTVYLCLM-AGLGMYLEEWSFLDSFYAWFITFSTIGFGDLVPLESFRQ 169          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO48564 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIT3])

HSP 1 Score: 87.4261 bits (215), Expect = 7.732e-19
Identity = 52/198 (26.26%), Postives = 88/198 (44.44%), Query Frame = 2
Query:  911 ESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVP 1504
            E ++ +    W+   + L+A TV TT+GYG+I P T  GR+  +LY  +GIPL  +   ++ + + +I+  +++ +  RK ++   ++ K D            VI  ++                     P P             E+    V  +   Y  IG+ +F   E W+  E+ Y+ FITLST+G GD VP
Sbjct:  116 EQSEPDPVVNWSLADSWLFACTVFTTVGYGNIAPLTIKGRVFCMLYGAVGIPLFSVVAGSLASFVTEIIHALHKEYHRRKRHESAAMHKKDD------------VIAPDE---------------------PVPE-----------LEIKLKHVAVVVAGYLCIGAVLFCICEGWSLFESFYYCFITLSTVGLGDYVP 269          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO35592 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL44])

HSP 1 Score: 85.1149 bits (209), Expect = 1.085e-18
Identity = 69/256 (26.95%), Postives = 104/256 (40.62%), Query Frame = 2
Query:  842 EIEKFSNVIFNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTR-QTEQYKS---IICSIYVLFGLSLCIMCFD 1597
            E+E+F   I  A   G+S        +      W FG A  +A TVITTIGYG+I P +  G+I  I+YA+ GIP+  I L                                    + I + L +   R  +L       + I            P S L+    +        ++  + +F   + + +FM  E WN+ EA YF FI+L+TIG GD VP      Q   Y+S   + C ++ + GLS  I+  +
Sbjct:   49 ELEEFIKDIVVARDQGISPL------RNVSVPSWEFGSAFFFAGTVITTIGYGNIAPLSSGGKIFCIVYALFGIPMTAIML------------------------------------TAIVERLLLAAERVQELMAGSCTVRGI------------PASYLRMVHLT-------FIMLVVLMFIMFVPALVFMNLEGWNYFEAFYFCFISLTTIGLGDFVPGDDVMWQHSAYRSLYKVCCILFFIIGLSFVILVLE 243          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: kcnk18 (potassium two pore domain channel subfamily K member 18 [Source:NCBI gene;Acc:101159039])

HSP 1 Score: 92.8189 bits (229), Expect = 7.359e-20
Identity = 78/285 (27.37%), Postives = 126/285 (44.21%), Query Frame = 2
Query:  941 WNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIY-------RIFSMRKNNKPKMVNVKSDS-----------FS---------DIFKSLTITV-IRKNKLETKDNN--FQSIFQNCNVSFK--------------LPTPN------SILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWE-DWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLLGQKAKTCITKFLK 1642
            W F G++ +  TV TT+GYG I P T  G++  +LYA++GIPLM++ + ++G  +A ++   Y       +    +  +  K  +  SDS           FS         DI + L     +R   ++ ++N   F+ I    N+  K              LPTP                   +VP  L+ F    Y  +G  I   WE D+   +  YF FITL+TIGFGD++P     +   Y  +I S++++ G+++  M F L   +  TC  K +K
Sbjct:  101 WTFFGSMFFCCTVFTTVGYGEIYPVTLSGKVVCVLYAMVGIPLMLLVILDVGDFLALLMTKAYVQAHAFFKDLRSQTWSPGKAQDRASDSRRQGLDDGTFVFSRDVVALEPLDIRQVLRSQADVRHKSIQLQNNKEIFEKILARDNLQRKGPLLRTFSCPELNQLPTPPKGFIVWDFTGLGDGMDQLDVPFVLILFAVFAYICLGGLILPLWEKDFTDFDPYYFCFITLTTIGFGDIIP-----KHPNYFMLI-SLFIIVGMAIMSMAFKLSQTRIVTCYRKCIK 379          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: KCNK16 (potassium channel subfamily K member 16-like [Source:NCBI gene;Acc:101160611])

HSP 1 Score: 88.1965 bits (217), Expect = 6.126e-19
Identity = 72/267 (26.97%), Postives = 114/267 (42.70%), Query Frame = 2
Query:  845 IEKFSNVIFNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIF--IFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSI---ICSIYVLFGLSLCIMCFDLLGQKAKTCIT 1630
            +E F  VI  A  NG+     + S      + W+F  +  +A TV+TTIGYG+++P T  G++  + YA+ GIPL +  L  IG  ++  L  + R          +MV V                                     V  K+P            ++ E     +FF+   + + +I   +F Y EDW F E  YF+FITLSTIGFGD V    T   ++Y S+   +  +++LF L+   +  +   Q  +  +T
Sbjct:   66 LENFVKVILYAWENGV-----NPSGNSTNPSNWDFSSSFFFAGTVVTTIGYGNLSPSTVSGQVFCVFYALFGIPLNLAFLKQIGKCLSVHLSRLER----------RMVAV-------------------------------------VPLKIP------------RTVEAVVVSLFFVSGSLLFLVIPPLLFSYVEDWTFGEGFYFAFITLSTIGFGDYV--VGTDPGKEYISVYRSLAGVWILFALAWLALILNTGAQMMENLVT 266          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: kcnk5b (potassium channel subfamily K member 5-like [Source:NCBI gene;Acc:101156677])

HSP 1 Score: 85.5001 bits (210), Expect = 2.340e-17
Identity = 62/253 (24.51%), Postives = 109/253 (43.08%), Query Frame = 2
Query:  821 FKTLIKVEIEKFSNVIFNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVP-IKSTRQTEQYKSIICSIYVLFGLS 1576
            ++ L   ++++   V   A+  G++    +  N       W++  ++++A T++TTIGYG++ P+T  GR+  ILY + GIPL ++ L+ +G+                              F D  K L+  +IRK  +  K   F      C   F                        + +  + + +I   +FM  E W +LE +YFSFITL+T+GFGD V  +    Q  +   +   I++  GL+
Sbjct:   49 YQCLTLEDLDEILEVASEAAGQGVAITGDNHRN------TWDWVNSVIFAATIVTTIGYGNVAPKTKGGRVFCILYGLCGIPLCLVWLSELGSF-----------------------------FGDRAKRLSQVMIRKG-ISVKKVQF-----TCTALF------------------------LLWGLLVHLVIPPFVFMSVEGWTYLEGIYFSFITLTTVGFGDYVAGVNPDIQYPRLYRVCAEIWIYMGLA 236          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: ENSORLT00000013824.2 (potassium channel subfamily K member 2-like [Source:NCBI gene;Acc:101168108])

HSP 1 Score: 84.3445 bits (207), Expect = 5.070e-17
Identity = 63/230 (27.39%), Postives = 101/230 (43.91%), Query Frame = 2
Query:  929 ENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADIL-RLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIF--IFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLLGQ 1609
             +++W+   A  +A TVITTIG+G+I+P T  G+I  I+YA++GIPL    LA +G  +  I  + I R+  M                   F+ ++ T IR                                         V +TL+F +F  + +  + + IF + E W+ LE++YF  ITL+TIGFGD V   S  +   Y   +   ++L GL+       ++G 
Sbjct:  136 HSSLWDLSSAFFFAGTVITTIGFGNISPHTEGGKIFCIVYALLGIPLFGFLLAGVGDQLGTIFGKGIARVEKM-------------------FRDISQTKIR-----------------------------------------VISTLLFVLFGCLLFVALPAAIFKHIEGWSALESLYFVVITLTTIGFGDFVAGGSEIEYLDYYKPVVWFWILVGLAYFAAILSMIGD 305          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: ENSORLT00000021678.2 (potassium two pore domain channel subfamily K member 2 [Source:NCBI gene;Acc:101165275])

HSP 1 Score: 83.1889 bits (204), Expect = 1.437e-16
Identity = 72/268 (26.87%), Postives = 115/268 (42.91%), Query Frame = 2
Query:  842 EIEKFSNVIFNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIF--IFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQ----------YKSIICSIYVLFGLSLCIMCFDLLGQ 1609
            E+E     + +A   G++       N   + ++W+   +  +A TVITTIG+G+I+P T  GRI  I+YA++GIPL    LA +G  +         IF        KM+ V+                              +F    VS              Q+K   V +TL+F +F  + +  + + IF + E W+ LE++YF  ITL+TIGFGD V  +    TE           YK ++   ++L GL+       ++G 
Sbjct:   99 ELEDLVKQVVSAVRAGVTPTG----NLSLQTSLWDLSSSFFFAGTVITTIGFGNISPHTEGGRIFCIIYALLGIPLFGFLLAGVGDQLGT-------IFGKGIAKVEKMIVVR-----------------------------HVFYKWKVS--------------QTK-IRVISTLLFILFGCLIFVALPAVIFKHIEGWSTLESIYFVVITLTTIGFGDFVAGEKGHLTEGGSESLEYLNYYKPVVW-FWILVGLAYFAAVLSMIGD 310          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000078172.1 (SMESG000078172.1)

HSP 1 Score: 1067.37 bits (2759), Expect = 0.000e+0
Identity = 562/562 (100.00%), Postives = 562/562 (100.00%), Query Frame = 2
Query:    5 MFDSLEYIDSEKSQXXXXXXXXXXXXXXXXXXXFDSQEEFYVVAQLPILINNDGIESLSGENCKSNILLESESFKNSFNNKTYITPEESIKFWKSRAHFKTCTQRFFEIVFSNIGLSLAVIVYVLLGAFIFQFLEEMSEITRYKTYKKDVVLAKLNITEQIMMIHQNFEFPKSKFHLNHSQASSNELNYYEFRIFLNKILFYSETFRDFQQNKTLFQILCNGTDXXXXXXXXXXXXWLADFYNLILPRFENLYNVLYNTSEDFGNSEQNQIKFKTLIKVEIEKFSNVIFNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLLGQKAKTCITKFLKSLKMKLTGQELNSNQP 1690
            MFDSLEYIDSEKSQINEDIKNENEENPSESKKEFDSQEEFYVVAQLPILINNDGIESLSGENCKSNILLESESFKNSFNNKTYITPEESIKFWKSRAHFKTCTQRFFEIVFSNIGLSLAVIVYVLLGAFIFQFLEEMSEITRYKTYKKDVVLAKLNITEQIMMIHQNFEFPKSKFHLNHSQASSNELNYYEFRIFLNKILFYSETFRDFQQNKTLFQILCNGTDNFKNNEENCNFNWLADFYNLILPRFENLYNVLYNTSEDFGNSEQNQIKFKTLIKVEIEKFSNVIFNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLLGQKAKTCITKFLKSLKMKLTGQELNSNQP
Sbjct:    1 MFDSLEYIDSEKSQINEDIKNENEENPSESKKEFDSQEEFYVVAQLPILINNDGIESLSGENCKSNILLESESFKNSFNNKTYITPEESIKFWKSRAHFKTCTQRFFEIVFSNIGLSLAVIVYVLLGAFIFQFLEEMSEITRYKTYKKDVVLAKLNITEQIMMIHQNFEFPKSKFHLNHSQASSNELNYYEFRIFLNKILFYSETFRDFQQNKTLFQILCNGTDNFKNNEENCNFNWLADFYNLILPRFENLYNVLYNTSEDFGNSEQNQIKFKTLIKVEIEKFSNVIFNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLLGQKAKTCITKFLKSLKMKLTGQELNSNQP 562          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000013544.1 (SMESG000013544.1)

HSP 1 Score: 301.212 bits (770), Expect = 5.116e-93
Identity = 201/550 (36.55%), Postives = 299/550 (54.36%), Query Frame = 2
Query:  161 DGIESLSGENCKSNILLESESFKNSFNNKTYITPEESIKFWKSRAHFKTCTQRFFEIVFSNIGLSLAVIVYVLLGAFIFQFLEEMSEITRYKTYKKDVVLAKLNIT--------EQIMMIHQN------FEFPKSKFHLNHSQASSNELNYYEFRIFLNKILFYSETFRDFQQNKTLFQILCNGT---DXXXXXXXXXXXXW---------LADFYNLILPRFENLYNVL---YNTSED---FGN--SEQNQIKFKTLIKVEIEKFSNVIFNASSNGLSHKSFH-ESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIFSMRK------------NNKPKMVNVKS---DSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLLGQKAKTCITKFLKSLKMKL 1660
            D IE  +      N++  S +     N+K  I  EE++KFWKS+ H    ++    ++FSNIGL+L ++ Y+LLGA +FQF E   E+  ++T   + VL  LN +        EQI++  +N       +F    F  N  +  +    ++E +I +      SE  R F++     +ILC  T      +N+ E     W         + +   +IL + +NL N +   YN  +     GN  S + +  F   +    E  +  +F+ + +G  H++ H  + K    T+W FGG++LY +TVITTIGYGHITP+T  GR  TI+YAI GIP+M+ICLA+IG+LMA++ RLIYR+  ++              N  K  +  +   D   D    +++TV+ KN      N F S  Q   + F +P PN +L+AA++SKS EVP +LV  +FI YNL+GS  F   E W   ++ YFSFITLSTIGFGD VP+    + EQYKSI+CS YVLFGLSLC+M FDL+ +K K+ I K +K ++ K+
Sbjct:  139 DNIEVETSFEDNDNLIYPSSNPNKFHNHKPKIKNEEALKFWKSKEHCILFSKLALSLLFSNIGLTLLIVTYILLGACMFQFFELKHELATFET-NSNKVLRNLNKSKSRIESEHEQIVLDIKNETKINLMKFLNETFTENQIKIGNLTEIFHEIKIQIQSA--QSEIDRSFKE-----EILCQSTVNNSCERNDSEAIGKTWKNISNKLQSVNENVEIILKKIDNLSNFINMKYNGKDINSLIGNNLSLRQKSSFIESLTKNFENLTETVFDVTKDGWIHENGHIGTEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIYRVSCLKAFKKYKKSQKSKCQNSEKQSSTSNELLDKSDDEDNQISLTVV-KNPHNPTGNYFGSTVQFRKILFHIPNPNRLLEAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAEQYKSIMCSFYVLFGLSLCVMSFDLMEKKCKSTIKKTVKRIRNKI 679          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000031911.1 (SMESG000031911.1)

HSP 1 Score: 191.815 bits (486), Expect = 5.996e-53
Identity = 161/547 (29.43%), Postives = 252/547 (46.07%), Query Frame = 2
Query:  194 KSNILLESESFKNSFNNKTYITPEESIKFWKSRAHFKTCTQRFFEIVFSNIGLSLAVIVYVLLGAFIFQFLEEMSEITRYKTYKKDV------VLAKLNITEQ-----------IMMIHQNFE--------FPKSKFHLNHSQASSNELNYYEFRIFLNKILFYSETFRDFQQNKTLF---QILCNGTDXXXXXXXXXXXXWLADFYNLI--LPRFENLYNVLYNTSEDFGNSEQNQIKFKTLIKVEIE-KFSNVI-----------FNASSNGLSHKSFHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYR-------IFSMRK--------------------NNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIK---STRQTEQYKSIICSIYVLFGLSLCIMCFDLLGQKAK 1618
            ++N++L+SE  +N   +  +   +  I+    R     C ++     FS IG+   V+ Y++ G F+FQ LE  +EI   K+ + ++      ++ K+  +EQ            ++I+Q+ E        F  +K  LN++   + + N+ + R F+       E   + Q N  L    + + N +     +      N L D    I  L   +N +    N  ED    +      KT+ K E   K S+VI           FNA+ NG              N +W F GALLY++T+ITTIGYGHI P+T  GR  TI+YAI+GIPLM++CL N+G +MAD+ + +YR       I S ++                     NKP+ +N+ S++ S I K    T              +    +  +S  L   N +      S+  +VP  L   I   Y L+G+ +F YW+ W F E+ YF FITL+TIGFGDLVP       +  +Q KSI C+ Y++ GL++  MCF L+ +K K
Sbjct:   90 ETNVILDSEQTQNRLKH-FFDAKQREIR----RQKCIRCCKQSIAFFFSQIGVMCIVVAYIIAGGFLFQNLEAKNEINISKSGESNINDSLKKLMEKIRSSEQETVDKYKSFCKRLIINQSSESNLRLTEFFNVNKKQLNNA-IYTLQWNFQDMRTFI------QEKITNIQSNLNLTKSSKFVSNNSALVIKDNLIEISNRLWDVGEEIKKLEALQNTFKTFPNQGEDPPLLKTKVKLLKTIDKTEFPNKDSDVINGKIKYLILSVFNATRNGYVFNG---------NILWTFSGALLYSITIITTIGYGHIVPKTFSGRFLTIVYAIIGIPLMLLCLTNLGKVMADLFKFMYRFTCFKVYIKSRKRKECKQKLLDSQNNQRKRSGNQNKPEFINILSENPSSILKKEITT--------------KPTMHSFRMSLPLGNANFMDSVHEISEEVDVPIWLPLTILGLYILVGAAVFSYWDGWTFFESCYFVFITLTTIGFGDLVPGNFELGEKSQDQTKSIFCAFYLVTGLAVFAMCFTLIQEKVK 601          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000016405.1 (SMESG000016405.1)

HSP 1 Score: 135.576 bits (340), Expect = 2.200e-34
Identity = 83/238 (34.87%), Postives = 125/238 (52.52%), Query Frame = 2
Query:  935 TMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIY-RIFSMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILK---------AARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVPIKST--RQTEQYKSIICSIYVLFGLSLCIMCFDLLGQK 1612
            + WN   ++ +  T+ITTIGYG+I P T  GRI  I+YA +GIPLM++ L+N G ++A   R +Y  +   R   K K  ++    F  + K   I  I+  +LE  +N       N N     P P  I +            Q +   +P T+V    I Y  +G+ IF  WE W+ + AVYFSFIT+STIGFGDL P K+T        + I+ ++Y + GL++  MC +L+ ++
Sbjct:  116 SAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSIS--EFESMSKRSAIE-IKNFELENAEN------LNSNPVKATPPPKFIDEDLDIVYVDDENDQDEIINIPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEE 344          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000019203.1 (SMESG000019203.1)

HSP 1 Score: 134.42 bits (337), Expect = 7.870e-34
Identity = 105/311 (33.76%), Postives = 155/311 (49.84%), Query Frame = 2
Query:  941 WNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIY---------RIFSMRKNNKPKMVN------------VKSD----------------------SFSDIFKSLTITVIR--------KNKLETK-----------DNNFQSIFQNCNVSFKLPTPNSILKAARQSKS---TE----VPATLVFFIFIFYNLIGSTIFMYW-EDWNFLEAVYFSFITLSTIGFGDLVP-IKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLLGQKAKTCITKFLKSLKMKL 1660
            W++ G++LY+VTVITTIGYGH+TP+T LGRI TI YAI GIPL I+ L NIG  +A+I RL+Y         ++F+ +K    ++V             +KSD                      SF++  +S+    I         + KLE             +N  +++  N +   KLP    ++    Q+ S   TE    VP TL   I + Y ++G+ +F +W  D ++L+  YF FITLSTIGFGD+VP I  +    + K I+  +YV  GL +  MCF L+  +    I   +KSL  K+
Sbjct:  123 WSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMKLFTKKKRLTNQLVGHHIRVSDESSIQIKSDFNENLLDTNTDFESISSRKMSHSFTEPLQSIENAKIHCWGDLENLQTKLEKSTETEIQIPENLENEIEAVQSNID---KLPV--ELIHFDNQNTSYFYTEVSETVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDE----IVNKVKSLAKKI 424          
The following BLAST results are available for this feature:
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNK162.119e-1926.28potassium two pore domain channel subfamily K memb... [more]
KCNK162.339e-1827.84potassium two pore domain channel subfamily K memb... [more]
KCNK161.188e-1628.63potassium two pore domain channel subfamily K memb... [more]
KCNK101.246e-1628.96potassium two pore domain channel subfamily K memb... [more]
KCNK101.563e-1628.96potassium two pore domain channel subfamily K memb... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
twk-488.079e-4533.74TWiK family of potassium channels [Source:UniProt... [more]
twk-23.378e-3232.51TWiK family of potassium channels [Source:UniProt... [more]
twk-23.818e-3232.51TWiK family of potassium channels [Source:UniProt... [more]
twk-23.937e-3231.69TWiK family of potassium channels [Source:UniProt... [more]
twk-24.406e-3231.69TWiK family of potassium channels [Source:UniProt... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sand1.939e-3532.31gene:FBgn0033257 transcript:FBtr0088780[more]
CG343969.724e-2830.30gene:FBgn0085425 transcript:FBtr0112645[more]
CG343961.082e-2630.58gene:FBgn0085425 transcript:FBtr0112644[more]
CG425945.276e-2427.78gene:FBgn0260971 transcript:FBtr0345704[more]
CG425945.276e-2427.78gene:FBgn0260971 transcript:FBtr0301749[more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnk182.596e-2326.60potassium channel, subfamily K, member 18 [Source:... [more]
kcnk182.735e-2326.60potassium channel, subfamily K, member 18 [Source:... [more]
kcnk182.892e-2326.60potassium channel, subfamily K, member 18 [Source:... [more]
kcnk2a1.262e-1828.68potassium channel, subfamily K, member 2a [Source:... [more]
kcnk2a1.430e-1828.68potassium channel, subfamily K, member 2a [Source:... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNK189.220e-2127.51potassium two pore domain channel subfamily K memb... [more]
KCNK42.744e-1426.36potassium channel, two pore domain subfamily K, me... [more]
bcdin3d7.843e-1331.34BCDIN3 domain containing RNA methyltransfease [Sou... [more]
pole49.132e-1336.47polymerase (DNA-directed), epsilon 4, accessory su... [more]
pole42.051e-1236.47polymerase (DNA-directed), epsilon 4, accessory su... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnk188.684e-1926.87potassium channel, subfamily K, member 18 [Source:... [more]
Kcnk41.120e-1726.32potassium channel, subfamily K, member 4 [Source:M... [more]
Kcnk103.832e-1728.96potassium channel, subfamily K, member 10 [Source:... [more]
Kcnk104.560e-1728.96potassium channel, subfamily K, member 10 [Source:... [more]
Kcnk21.170e-1325.86potassium channel, subfamily K, member 2 [Source:M... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P34410|TWK7_CAEEL4.607e-2228.47TWiK family of potassium channels protein 7 OS=Cae... [more]
sp|Q18120|TWK18_CAEEL6.018e-2229.31TWiK family of potassium channels protein 18 OS=Ca... [more]
sp|Q6Q1P3|KCNKI_RAT8.784e-2027.55Potassium channel subfamily K member 18 OS=Rattus ... [more]
sp|Q96T55|KCNKG_HUMAN1.018e-1826.28Potassium channel subfamily K member 16 OS=Homo sa... [more]
sp|Q6VV64|KCNKI_MOUSE6.075e-1826.87Potassium channel subfamily K member 18 OS=Mus mus... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1EGH11.582e-4536.20Uncharacterized protein OS=Helobdella robusta OX=6... [more]
V3ZUS11.741e-4437.84Uncharacterized protein (Fragment) OS=Lottia gigan... [more]
A0A4S2MDN75.163e-4328.71Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A077ZBB51.359e-4239.42TWiK family of potassium channels protein 7 OS=Tri... [more]
A0A2H2I4131.034e-4133.97Uncharacterized protein OS=Caenorhabditis japonica... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000047723.17.119e-2126.43pep primary_assembly:Astyanax_mexicanus-2.0:9:1589... [more]
kcnk172.511e-1525.85potassium channel, subfamily K, member 17 [Source:... [more]
kcnk10a3.434e-1528.52potassium channel subfamily K member 10-like [Sour... [more]
kcnk10b5.339e-1528.07potassium two pore domain channel subfamily K memb... [more]
kcnk5a6.652e-1526.52potassium two pore domain channel subfamily K memb... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003416.11.995e-3333.83pep scaffold:Pmarinus_7.0:GL476517:78247:80718:1 g... [more]
KCNK106.500e-1627.00potassium two pore domain channel subfamily K memb... [more]
kcnk13a6.147e-1026.43potassium channel, subfamily K, member 13a [Source... [more]
kcnk79.162e-1034.94potassium channel, subfamily K, member 7 [Source:Z... [more]
KCNK162.195e-937.33potassium two pore domain channel subfamily K memb... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TOK12.679e-723.71Outward-rectifier potassium channel of the plasma ... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO476687.678e-2027.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331931.123e-1925.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380722.564e-1928.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485647.732e-1926.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355921.085e-1826.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnk187.359e-2027.37potassium two pore domain channel subfamily K memb... [more]
KCNK166.126e-1926.97potassium channel subfamily K member 16-like [Sour... [more]
kcnk5b2.340e-1724.51potassium channel subfamily K member 5-like [Sourc... [more]
ENSORLT00000013824.25.070e-1727.39potassium channel subfamily K member 2-like [Sourc... [more]
ENSORLT00000021678.21.437e-1626.87potassium two pore domain channel subfamily K memb... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078172.10.000e+0100.00SMESG000078172.1[more]
SMESG000013544.15.116e-9336.55SMESG000013544.1[more]
SMESG000031911.15.996e-5329.43SMESG000031911.1[more]
SMESG000016405.12.200e-3434.87SMESG000016405.1[more]
SMESG000019203.17.870e-3433.76SMESG000019203.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020390 ID=SMED30020390|Name=Potassium channel subfamily K member 18|organism=Schmidtea mediterranea sexual|type=transcript|length=1829bp
ATAAATGTTTGATTCCTTGGAATATATTGATTCCGAAAAAAGTCAAATTA
ATGAAGATATCAAAAATGAGAATGAAGAAAATCCTTCTGAATCTAAAAAA
GAATTTGATTCTCAAGAAGAGTTTTATGTTGTAGCTCAGTTGCCAATTTT
AATAAACAATGACGGTATAGAATCTTTATCTGGCGAAAACTGCAAAAGTA
ATATTTTATTGGAATCCGAGAGTTTCAAAAATTCTTTTAACAACAAAACT
TACATTACACCGGAAGAATCCATTAAATTCTGGAAAAGCAGAGCTCATTT
TAAGACATGCACTCAAAGATTTTTTGAAATTGTTTTCTCGAACATTGGTT
TATCTCTCGCAGTTATTGTTTATGTTTTACTAGGTGCATTTATTTTTCAA
TTTCTTGAAGAAATGTCCGAAATAACTAGATATAAAACCTATAAAAAGGA
TGTTGTGCTCGCAAAATTAAATATAACTGAACAGATCATGATGATACATC
AAAATTTTGAATTTCCCAAATCCAAATTCCATTTAAATCATTCGCAAGCT
TCTTCAAATGAATTAAATTACTATGAGTTTCGAATTTTTTTGAATAAAAT
ATTATTTTATTCCGAAACATTTAGAGATTTTCAACAAAACAAAACTTTAT
TTCAAATTCTATGTAACGGGACAGATAACTTTAAAAATAACGAGGAAAAT
TGTAACTTCAATTGGTTAGCTGACTTTTACAATCTTATCCTTCCTCGATT
TGAAAACCTCTACAATGTTCTTTACAATACTTCTGAAGACTTCGGAAATT
CCGAACAAAACCAAATCAAATTTAAAACATTAATTAAAGTCGAAATTGAA
AAATTTAGCAATGTAATTTTTAATGCTTCTTCAAATGGTTTATCTCACAA
ATCGTTTCATGAGTCAAACAAAGAAGAAGAAAATACGATGTGGAATTTTG
GAGGAGCTCTTCTATATGCAGTTACAGTGATAACAACAATCGGATATGGC
CATATAACTCCTCAAACTCCACTGGGAAGAATAACTACAATACTCTATGC
AATTATGGGAATTCCTTTAATGATTATATGCTTAGCAAATATTGGTACTT
TAATGGCAGATATTTTAAGGCTGATATATAGAATTTTTTCTATGCGAAAG
AATAATAAACCGAAAATGGTAAATGTGAAGTCTGATTCATTTTCTGATAT
CTTCAAAAGTTTAACCATAACTGTGATTAGGAAAAATAAATTAGAAACAA
AAGACAATAATTTCCAATCTATTTTTCAGAATTGTAATGTAAGTTTCAAA
CTTCCGACCCCCAATAGCATATTAAAAGCAGCTCGTCAATCTAAGTCTAC
TGAAGTACCAGCAACTTTGGTTTTTTTCATTTTTATATTTTATAATTTAA
TTGGATCGACAATTTTTATGTATTGGGAAGACTGGAATTTTTTAGAGGCA
GTTTACTTTTCCTTCATAACTTTAAGTACAATCGGTTTTGGAGATTTAGT
TCCTATTAAAAGTACTCGACAAACAGAACAATATAAATCTATTATTTGCT
CTATTTATGTTCTATTTGGATTATCGTTGTGTATTATGTGCTTTGATTTG
CTTGGACAAAAAGCTAAAACTTGCATTACTAAATTCTTGAAAAGTCTCAA
AATGAAATTAACAGGACAAGAACTCAATTCAAATCAACCATGAAAAATTA
AGTAAAATTTTAGAAGTACATCGATTAGAATTGCAATTGTTATATTTTAC
TCATTTTTGCTCTTTATTATTTTTTTTGTATAATCATATTTTCTAATTGT
TACTTAAATAATTTGTAATACATTTAAAT
back to top

protein sequence of SMED30020390-orf-1

>SMED30020390-orf-1 ID=SMED30020390-orf-1|Name=SMED30020390-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=563bp
MFDSLEYIDSEKSQINEDIKNENEENPSESKKEFDSQEEFYVVAQLPILI
NNDGIESLSGENCKSNILLESESFKNSFNNKTYITPEESIKFWKSRAHFK
TCTQRFFEIVFSNIGLSLAVIVYVLLGAFIFQFLEEMSEITRYKTYKKDV
VLAKLNITEQIMMIHQNFEFPKSKFHLNHSQASSNELNYYEFRIFLNKIL
FYSETFRDFQQNKTLFQILCNGTDNFKNNEENCNFNWLADFYNLILPRFE
NLYNVLYNTSEDFGNSEQNQIKFKTLIKVEIEKFSNVIFNASSNGLSHKS
FHESNKEEENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAI
MGIPLMIICLANIGTLMADILRLIYRIFSMRKNNKPKMVNVKSDSFSDIF
KSLTITVIRKNKLETKDNNFQSIFQNCNVSFKLPTPNSILKAARQSKSTE
VPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVP
IKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLLGQKAKTCITKFLKSLKM
KLTGQELNSNQP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR0032802pore_dom_K_chnl
IPR013099K_chnl_dom
Vocabulary: biological process
TermDefinition
GO:0071805potassium ion transmembrane transport
GO:0006810transport
GO:0006811ion transport
Vocabulary: molecular function
TermDefinition
GO:0005267potassium channel activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 5..25
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 10..34
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..34
NoneNo IPR availablePANTHERPTHR11003POTASSIUM CHANNEL, SUBFAMILY Kcoord: 98..547
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 440..536
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 106..388
NoneNo IPR availableTMHMMTMhelixcoord: 451..473
NoneNo IPR availableTMHMMTMhelixcoord: 512..534
NoneNo IPR availableTMHMMTMhelixcoord: 477..499
NoneNo IPR availableTMHMMTMhelixcoord: 344..366
NoneNo IPR availableTMHMMTMhelixcoord: 312..334
NoneNo IPR availableTMHMMTMhelixcoord: 109..131
IPR003280Two pore domain potassium channelPRINTSPR013332POREKCHANELcoord: 324..352
score: 54.72
coord: 491..500
score: 75.97
IPR013099Potassium channel domainPFAMPF07885Ion_trans_2coord: 459..536
e-value: 1.5E-19
score: 69.7
coord: 309..367
e-value: 8.0E-19
score: 67.4