PHD finger-like domain-containing protein 5A

Overview
NamePHD finger-like domain-containing protein 5A
Smed IDSMED30020375
Length (bp)365
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PHD finger-like domain-containing protein 5A (SMED30020375) t-SNE clustered cells

Violin plots show distribution of expression levels for PHD finger-like domain-containing protein 5A (SMED30020375) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PHD finger-like domain-containing protein 5A (SMED30020375) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PHD finger-like domain-containing protein 5A (SMED30020375) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020375

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30020375SMESG000029843.1 SmedASXL_079973SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30020375SMESG000029843.1 SmedASXL_079973SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30020375SMESG000029843.1 dd_Smed_v4_2656_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30020375SMESG000029843.1 dd_Smed_v4_2656_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020375SMESG000029843.1 dd_Smed_v4_2656_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020375SMESG000029843.1 dd_Smed_v4_2656_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30020375SMESG000029843.1 dd_Smed_v4_2656_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020375SMESG000029843.1 dd_Smed_v4_2656_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020375SMESG000029843.1 dd_Smed_v4_2656_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020375SMESG000029843.1 Contig46968newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020375SMESG000029843.1 Contig46968uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PHD finger-like domain-containing protein 5A vs. Ensembl Human
Match: PHF5A (PHD finger protein 5A [Source:HGNC Symbol;Acc:HGNC:18000])

HSP 1 Score: 176.792 bits (447), Expect = 3.246e-58
Identity = 98/109 (89.91%), Postives = 103/109 (94.50%), Query Frame = 1
Query:   22 MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHXXXXXXXXXXXXSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKKYGFKK 348
            MAKHH DLIFCRK  GVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGS+ GRCVICGG GVSDAYYC+ECTI EKDRDGCPKIVNLG+++TDLFYERKKYGFKK
Sbjct:    1 MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK 109          
BLAST of PHD finger-like domain-containing protein 5A vs. Ensembl Celegans
Match: phf-5 (PHF-5; PHd Finger family [Source:UniProtKB/TrEMBL;Acc:G5EBY6])

HSP 1 Score: 174.866 bits (442), Expect = 5.506e-58
Identity = 95/109 (87.16%), Postives = 104/109 (95.41%), Query Frame = 1
Query:   22 MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHXXXXXXXXXXXXSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKKYGFKK 348
            MAKHH DLIFCRK PG+AIGRLCEKCDG+CVICDS+VRPCTLVRIC+ECNYGS+ GRCVICGG GVSDAYYC+ECTILEKDRDGCPKIVNLG+A+TDLFYERKK+G KK
Sbjct:    1 MAKHHPDLIFCRKQPGIAIGRLCEKCDGRCVICDSHVRPCTLVRICEECNYGSYQGRCVICGGAGVSDAYYCKECTILEKDRDGCPKIVNLGSAKTDLFYERKKFGSKK 109          
BLAST of PHD finger-like domain-containing protein 5A vs. Ensembl Fly
Match: Phf5a (gene:FBgn0031822 transcript:FBtr0079264)

HSP 1 Score: 173.711 bits (439), Expect = 2.089e-57
Identity = 97/111 (87.39%), Postives = 103/111 (92.79%), Query Frame = 1
Query:   22 MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHXXXXXXXXXXXXSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKKYGFKK*Y 354
            MAKHH DLIFCRK PGVAIGRLCEK DGKCVICDSYVRPCTLVRICDECNYGS+ GRCVICGG GVSDAYYC+ CTI EKDRDGCPKIVNLG+++TDLFYERKKYGFK+ Y
Sbjct:    1 MAKHHPDLIFCRKQPGVAIGRLCEKDDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKSCTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKQNY 111          
BLAST of PHD finger-like domain-containing protein 5A vs. Ensembl Zebrafish
Match: phf5a (PHD finger protein 5A [Source:ZFIN;Acc:ZDB-GENE-021219-3])

HSP 1 Score: 176.792 bits (447), Expect = 2.065e-58
Identity = 98/109 (89.91%), Postives = 103/109 (94.50%), Query Frame = 1
Query:   22 MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHXXXXXXXXXXXXSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKKYGFKK 348
            MAKHH DLIFCRK  GVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGS+ GRCVICGG GVSDAYYC+ECTI EKDRDGCPKIVNLG+++TDLFYERKKYGFKK
Sbjct:    1 MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK 109          
BLAST of PHD finger-like domain-containing protein 5A vs. Ensembl Zebrafish
Match: phf5a (PHD finger protein 5A [Source:ZFIN;Acc:ZDB-GENE-021219-3])

HSP 1 Score: 176.792 bits (447), Expect = 2.065e-58
Identity = 98/109 (89.91%), Postives = 103/109 (94.50%), Query Frame = 1
Query:   22 MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHXXXXXXXXXXXXSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKKYGFKK 348
            MAKHH DLIFCRK  GVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGS+ GRCVICGG GVSDAYYC+ECTI EKDRDGCPKIVNLG+++TDLFYERKKYGFKK
Sbjct:    1 MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK 109          
BLAST of PHD finger-like domain-containing protein 5A vs. Ensembl Zebrafish
Match: phf5a (PHD finger protein 5A [Source:ZFIN;Acc:ZDB-GENE-021219-3])

HSP 1 Score: 152.91 bits (385), Expect = 4.001e-49
Identity = 89/109 (81.65%), Postives = 94/109 (86.24%), Query Frame = 1
Query:   22 MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHXXXXXXXXXXXXSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKKYGFKK 348
            MAKHH DLIFCRK  GV         DGKCVICDSYVRPCTLVRICDECNYGS+ GRCVICGG GVSDAYYC+ECTI EKDRDGCPKIVNLG+++TDLFYERKKYGFKK
Sbjct:    1 MAKHHPDLIFCRKQAGVG--------DGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK 101          
BLAST of PHD finger-like domain-containing protein 5A vs. Ensembl Zebrafish
Match: phf5a (PHD finger protein 5A [Source:ZFIN;Acc:ZDB-GENE-021219-3])

HSP 1 Score: 152.91 bits (385), Expect = 4.001e-49
Identity = 89/109 (81.65%), Postives = 94/109 (86.24%), Query Frame = 1
Query:   22 MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHXXXXXXXXXXXXSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKKYGFKK 348
            MAKHH DLIFCRK  GV         DGKCVICDSYVRPCTLVRICDECNYGS+ GRCVICGG GVSDAYYC+ECTI EKDRDGCPKIVNLG+++TDLFYERKKYGFKK
Sbjct:    1 MAKHHPDLIFCRKQAGVG--------DGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK 101          
BLAST of PHD finger-like domain-containing protein 5A vs. Ensembl Xenopus
Match: phf5a (PHD finger protein 5A [Source:NCBI gene;Acc:100170460])

HSP 1 Score: 176.792 bits (447), Expect = 2.943e-58
Identity = 98/109 (89.91%), Postives = 103/109 (94.50%), Query Frame = 1
Query:   22 MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHXXXXXXXXXXXXSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKKYGFKK 348
            MAKHH DLIFCRK  GVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGS+ GRCVICGG GVSDAYYC+ECTI EKDRDGCPKIVNLG+++TDLFYERKKYGFKK
Sbjct:    1 MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK 109          
BLAST of PHD finger-like domain-containing protein 5A vs. Ensembl Xenopus
Match: phf5a (PHD finger protein 5A [Source:NCBI gene;Acc:100170460])

HSP 1 Score: 152.91 bits (385), Expect = 5.701e-49
Identity = 89/109 (81.65%), Postives = 94/109 (86.24%), Query Frame = 1
Query:   22 MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHXXXXXXXXXXXXSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKKYGFKK 348
            MAKHH DLIFCRK  GV         DGKCVICDSYVRPCTLVRICDECNYGS+ GRCVICGG GVSDAYYC+ECTI EKDRDGCPKIVNLG+++TDLFYERKKYGFKK
Sbjct:    1 MAKHHPDLIFCRKQAGVG--------DGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK 101          
BLAST of PHD finger-like domain-containing protein 5A vs. Ensembl Mouse
Match: Phf5a (PHD finger protein 5A [Source:MGI Symbol;Acc:MGI:2156864])

HSP 1 Score: 176.792 bits (447), Expect = 2.229e-58
Identity = 98/109 (89.91%), Postives = 103/109 (94.50%), Query Frame = 1
Query:   22 MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHXXXXXXXXXXXXSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKKYGFKK 348
            MAKHH DLIFCRK  GVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGS+ GRCVICGG GVSDAYYC+ECTI EKDRDGCPKIVNLG+++TDLFYERKKYGFKK
Sbjct:    1 MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK 109          
BLAST of PHD finger-like domain-containing protein 5A vs. UniProt/SwissProt
Match: sp|P83871|PHF5A_RAT (PHD finger-like domain-containing protein 5A OS=Rattus norvegicus OX=10116 GN=Phf5a PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 1.559e-57
Identity = 98/109 (89.91%), Postives = 103/109 (94.50%), Query Frame = 1
Query:   22 MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHXXXXXXXXXXXXSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKKYGFKK 348
            MAKHH DLIFCRK  GVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGS+ GRCVICGG GVSDAYYC+ECTI EKDRDGCPKIVNLG+++TDLFYERKKYGFKK
Sbjct:    1 MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK 109          
BLAST of PHD finger-like domain-containing protein 5A vs. UniProt/SwissProt
Match: sp|P83870|PHF5A_MOUSE (PHD finger-like domain-containing protein 5A OS=Mus musculus OX=10090 GN=Phf5a PE=1 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 1.559e-57
Identity = 98/109 (89.91%), Postives = 103/109 (94.50%), Query Frame = 1
Query:   22 MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHXXXXXXXXXXXXSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKKYGFKK 348
            MAKHH DLIFCRK  GVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGS+ GRCVICGG GVSDAYYC+ECTI EKDRDGCPKIVNLG+++TDLFYERKKYGFKK
Sbjct:    1 MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK 109          
BLAST of PHD finger-like domain-containing protein 5A vs. UniProt/SwissProt
Match: sp|Q7RTV0|PHF5A_HUMAN (PHD finger-like domain-containing protein 5A OS=Homo sapiens OX=9606 GN=PHF5A PE=1 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 1.559e-57
Identity = 98/109 (89.91%), Postives = 103/109 (94.50%), Query Frame = 1
Query:   22 MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHXXXXXXXXXXXXSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKKYGFKK 348
            MAKHH DLIFCRK  GVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGS+ GRCVICGG GVSDAYYC+ECTI EKDRDGCPKIVNLG+++TDLFYERKKYGFKK
Sbjct:    1 MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK 109          
BLAST of PHD finger-like domain-containing protein 5A vs. UniProt/SwissProt
Match: sp|Q0WMV8|PHF5B_ARATH (PHD finger-like domain-containing protein 5B OS=Arabidopsis thaliana OX=3702 GN=At1g07170 PE=3 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 5.209e-57
Identity = 97/109 (88.99%), Postives = 102/109 (93.58%), Query Frame = 1
Query:   22 MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHXXXXXXXXXXXXSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKKYGFKK 348
            MAKHH DLI CRK PG+AIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGS  GRCVICGGVG+SDAYYC+ECT  EKDRDGCPKIVNLG+A+TDLFYERKKYGFKK
Sbjct:    1 MAKHHPDLIMCRKQPGIAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSFQGRCVICGGVGISDAYYCKECTQQEKDRDGCPKIVNLGSAKTDLFYERKKYGFKK 109          
BLAST of PHD finger-like domain-containing protein 5A vs. UniProt/SwissProt
Match: sp|P0DI19|PHF5A_ARATH (PHD finger-like domain-containing protein 5A OS=Arabidopsis thaliana OX=3702 GN=At2g30000 PE=3 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 5.209e-57
Identity = 97/109 (88.99%), Postives = 102/109 (93.58%), Query Frame = 1
Query:   22 MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHXXXXXXXXXXXXSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKKYGFKK 348
            MAKHH DLI CRK PG+AIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGS  GRCVICGGVG+SDAYYC+ECT  EKDRDGCPKIVNLG+A+TDLFYERKKYGFKK
Sbjct:    1 MAKHHPDLIMCRKQPGIAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSFQGRCVICGGVGISDAYYCKECTQQEKDRDGCPKIVNLGSAKTDLFYERKKYGFKK 109          
BLAST of PHD finger-like domain-containing protein 5A vs. TrEMBL
Match: A0A336MUY0 (CSON001654 protein OS=Culicoides sonorensis OX=179676 GN=CSON001654 PE=4 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 5.275e-59
Identity = 98/111 (88.29%), Postives = 105/111 (94.59%), Query Frame = 1
Query:   16 F*MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHXXXXXXXXXXXXSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKKYGFKK 348
            F MAKHH DLIFCRK PGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGS+ GRCVICGG GVSDAYYC+ECT+ EKDRDGCPKIVNLG+++TDLFYERKKYGFK+
Sbjct:  336 FLMAKHHPDLIFCRKQPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTVQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKQ 446          
BLAST of PHD finger-like domain-containing protein 5A vs. TrEMBL
Match: A0A1I7Y232 (Uncharacterized protein OS=Steinernema glaseri OX=37863 PE=4 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 9.193e-58
Identity = 98/113 (86.73%), Postives = 107/113 (94.69%), Query Frame = 1
Query:   10 SKF*MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHXXXXXXXXXXXXSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKKYGFKK 348
            S F MAKHH DLIFCRK PGVAIGRLC+KCDG+CV+CDSYVRPCTLVRICDECNYGS+ GRCVICGG GVSDAYYC+ECT++EKDRDGCPKIVNLG+A+TDLFYERKKYGFKK
Sbjct:   62 SSFQMAKHHPDLIFCRKQPGVAIGRLCDKCDGRCVVCDSYVRPCTLVRICDECNYGSYQGRCVICGGQGVSDAYYCKECTLMEKDRDGCPKIVNLGSAKTDLFYERKKYGFKK 174          
BLAST of PHD finger-like domain-containing protein 5A vs. TrEMBL
Match: W6V5Z6 (PHD finger-like domain-containing protein 5A OS=Echinococcus granulosus OX=6210 GN=EGR_03345 PE=4 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.734e-57
Identity = 100/109 (91.74%), Postives = 105/109 (96.33%), Query Frame = 1
Query:   22 MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHXXXXXXXXXXXXSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKKYGFKK 348
            MAKHH DLIFCRK PGV+IGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGS+ GRCVICGG GVSDAYYCRECTI+EKDRDGCPKIVNLG+A+TDLFYERKKYGFKK
Sbjct:    1 MAKHHPDLIFCRKQPGVSIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGTGVSDAYYCRECTIMEKDRDGCPKIVNLGSAKTDLFYERKKYGFKK 109          
BLAST of PHD finger-like domain-containing protein 5A vs. TrEMBL
Match: A0A0R3T868 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS3255 PE=4 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 2.413e-57
Identity = 100/111 (90.09%), Postives = 106/111 (95.50%), Query Frame = 1
Query:   22 MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHXXXXXXXXXXXXSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKKYGFKK*Y 354
            MAKHH DLIFCRK PGV+IGRLCEKCDG+CVICDSYVRPCTLVRICDECNYGS+ GRCVICGG GVSDAYYCRECTI+EKDRDGCPKIVNLG+A+TDLFYERKKYGFKK Y
Sbjct:    1 MAKHHPDLIFCRKQPGVSIGRLCEKCDGRCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGTGVSDAYYCRECTIMEKDRDGCPKIVNLGSAKTDLFYERKKYGFKKTY 111          
BLAST of PHD finger-like domain-containing protein 5A vs. TrEMBL
Match: A0A0R3SS10 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS8025 PE=4 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 2.413e-57
Identity = 100/111 (90.09%), Postives = 106/111 (95.50%), Query Frame = 1
Query:   22 MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHXXXXXXXXXXXXSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKKYGFKK*Y 354
            MAKHH DLIFCRK PGV+IGRLCEKCDG+CVICDSYVRPCTLVRICDECNYGS+ GRCVICGG GVSDAYYCRECTI+EKDRDGCPKIVNLG+A+TDLFYERKKYGFKK Y
Sbjct:    1 MAKHHPDLIFCRKQPGVSIGRLCEKCDGRCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGTGVSDAYYCRECTIMEKDRDGCPKIVNLGSAKTDLFYERKKYGFKKTY 111          
BLAST of PHD finger-like domain-containing protein 5A vs. Ensembl Cavefish
Match: phf5a (PHD finger protein 5A [Source:NCBI gene;Acc:103029494])

HSP 1 Score: 176.792 bits (447), Expect = 1.750e-58
Identity = 98/109 (89.91%), Postives = 103/109 (94.50%), Query Frame = 1
Query:   22 MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHXXXXXXXXXXXXSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKKYGFKK 348
            MAKHH DLIFCRK  GVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGS+ GRCVICGG GVSDAYYC+ECTI EKDRDGCPKIVNLG+++TDLFYERKKYGFKK
Sbjct:    1 MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK 109          
BLAST of PHD finger-like domain-containing protein 5A vs. Ensembl Cavefish
Match: phf5a (PHD finger protein 5A [Source:NCBI gene;Acc:103029494])

HSP 1 Score: 152.91 bits (385), Expect = 3.390e-49
Identity = 89/109 (81.65%), Postives = 94/109 (86.24%), Query Frame = 1
Query:   22 MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHXXXXXXXXXXXXSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKKYGFKK 348
            MAKHH DLIFCRK  GV         DGKCVICDSYVRPCTLVRICDECNYGS+ GRCVICGG GVSDAYYC+ECTI EKDRDGCPKIVNLG+++TDLFYERKKYGFKK
Sbjct:    1 MAKHHPDLIFCRKQAGVG--------DGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK 101          
BLAST of PHD finger-like domain-containing protein 5A vs. Ensembl Cavefish
Match: phf5a (PHD finger protein 5A [Source:NCBI gene;Acc:103029494])

HSP 1 Score: 123.25 bits (308), Expect = 2.306e-37
Identity = 73/81 (90.12%), Postives = 75/81 (92.59%), Query Frame = 1
Query:   22 MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHXXXXXXXXXXXXSDAYYCRECTILEKD 264
            MAKHH DLIFCRK  GVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGS+ GRCVICGG GVSDAYYC+ECTI EKD
Sbjct:    1 MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKD 81          
BLAST of PHD finger-like domain-containing protein 5A vs. Ensembl Sea Lamprey
Match: phf5a (PHD finger protein 5A [Source:ZFIN;Acc:ZDB-GENE-021219-3])

HSP 1 Score: 176.792 bits (447), Expect = 3.550e-59
Identity = 98/109 (89.91%), Postives = 103/109 (94.50%), Query Frame = 1
Query:   22 MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHXXXXXXXXXXXXSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKKYGFKK 348
            MAKHH DLIFCRK  GVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGS+ GRCVICGG GVSDAYYC+ECTI EKDRDGCPKIVNLG+++TDLFYERKKYGFKK
Sbjct:    1 MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK 109          
BLAST of PHD finger-like domain-containing protein 5A vs. Ensembl Yeast
Match: RDS3 (Component of the SF3b subcomplex of the U2 snRNP; zinc cluster protein involved in pre-mRNA splicing and cycloheximide resistance [Source:SGD;Acc:S000006298])

HSP 1 Score: 110.153 bits (274), Expect = 3.389e-33
Identity = 58/105 (55.24%), Postives = 73/105 (69.52%), Query Frame = 1
Query:   22 MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHXXX-XXXXXXXXXSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKK 333
            M++H  DLI C K PGV  G LCEKCDGKC ICDSYVRP   VR+C+ C++G       +    VGV+DA+YC EC  L KD+DGCP+I+NLG+ R D  +E+KK
Sbjct:    1 MSRHQFDLIMCLKQPGVQTGLLCEKCDGKCPICDSYVRPKRKVRVCENCSFGKQAKNCIICNLNVGVNDAFYCWECCRLGKDKDGCPRILNLGSNRLDRHFEKKK 105          
BLAST of PHD finger-like domain-containing protein 5A vs. Ensembl Nematostella
Match: EDO31922 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWK0])

HSP 1 Score: 177.178 bits (448), Expect = 4.166e-59
Identity = 97/109 (88.99%), Postives = 103/109 (94.50%), Query Frame = 1
Query:   22 MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHXXXXXXXXXXXXSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKKYGFKK 348
            MAKHH DLI CRK PGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGS+ GRCVICGG GVSDAYYC+ECT+ EKDRDGCPKIVNLG+++TDLFYERKKYGFKK
Sbjct:    1 MAKHHPDLIMCRKQPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTVQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK 109          
BLAST of PHD finger-like domain-containing protein 5A vs. Ensembl Medaka
Match: phf5a (PHD finger protein 5A [Source:NCBI gene;Acc:101164511])

HSP 1 Score: 176.792 bits (447), Expect = 1.739e-58
Identity = 98/109 (89.91%), Postives = 103/109 (94.50%), Query Frame = 1
Query:   22 MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHXXXXXXXXXXXXSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKKYGFKK 348
            MAKHH DLIFCRK  GVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGS+ GRCVICGG GVSDAYYC+ECTI EKDRDGCPKIVNLG+++TDLFYERKKYGFKK
Sbjct:    1 MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK 109          
BLAST of PHD finger-like domain-containing protein 5A vs. Planmine SMEST
Match: SMESG000029843.1 (SMESG000029843.1)

HSP 1 Score: 192.586 bits (488), Expect = 5.867e-65
Identity = 109/109 (100.00%), Postives = 109/109 (100.00%), Query Frame = 1
Query:   22 MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHXXXXXXXXXXXXSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKKYGFKK 348
            MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHVGRCVICGGVGVSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKKYGFKK
Sbjct:    1 MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSHVGRCVICGGVGVSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFYERKKYGFKK 109          
The following BLAST results are available for this feature:
BLAST of PHD finger-like domain-containing protein 5A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
PHF5A3.246e-5889.91PHD finger protein 5A [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of PHD finger-like domain-containing protein 5A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
phf-55.506e-5887.16PHF-5; PHd Finger family [Source:UniProtKB/TrEMBL... [more]
back to top
BLAST of PHD finger-like domain-containing protein 5A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Phf5a2.089e-5787.39gene:FBgn0031822 transcript:FBtr0079264[more]
back to top
BLAST of PHD finger-like domain-containing protein 5A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
phf5a2.065e-5889.91PHD finger protein 5A [Source:ZFIN;Acc:ZDB-GENE-02... [more]
phf5a2.065e-5889.91PHD finger protein 5A [Source:ZFIN;Acc:ZDB-GENE-02... [more]
phf5a4.001e-4981.65PHD finger protein 5A [Source:ZFIN;Acc:ZDB-GENE-02... [more]
phf5a4.001e-4981.65PHD finger protein 5A [Source:ZFIN;Acc:ZDB-GENE-02... [more]
back to top
BLAST of PHD finger-like domain-containing protein 5A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
phf5a2.943e-5889.91PHD finger protein 5A [Source:NCBI gene;Acc:100170... [more]
phf5a5.701e-4981.65PHD finger protein 5A [Source:NCBI gene;Acc:100170... [more]
back to top
BLAST of PHD finger-like domain-containing protein 5A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Phf5a2.229e-5889.91PHD finger protein 5A [Source:MGI Symbol;Acc:MGI:2... [more]
back to top
BLAST of PHD finger-like domain-containing protein 5A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P83871|PHF5A_RAT1.559e-5789.91PHD finger-like domain-containing protein 5A OS=Ra... [more]
sp|P83870|PHF5A_MOUSE1.559e-5789.91PHD finger-like domain-containing protein 5A OS=Mu... [more]
sp|Q7RTV0|PHF5A_HUMAN1.559e-5789.91PHD finger-like domain-containing protein 5A OS=Ho... [more]
sp|Q0WMV8|PHF5B_ARATH5.209e-5788.99PHD finger-like domain-containing protein 5B OS=Ar... [more]
sp|P0DI19|PHF5A_ARATH5.209e-5788.99PHD finger-like domain-containing protein 5A OS=Ar... [more]
back to top
BLAST of PHD finger-like domain-containing protein 5A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A336MUY05.275e-5988.29CSON001654 protein OS=Culicoides sonorensis OX=179... [more]
A0A1I7Y2329.193e-5886.73Uncharacterized protein OS=Steinernema glaseri OX=... [more]
W6V5Z61.734e-5791.74PHD finger-like domain-containing protein 5A OS=Ec... [more]
A0A0R3T8682.413e-5790.09Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A0R3SS102.413e-5790.09Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of PHD finger-like domain-containing protein 5A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
phf5a1.750e-5889.91PHD finger protein 5A [Source:NCBI gene;Acc:103029... [more]
phf5a3.390e-4981.65PHD finger protein 5A [Source:NCBI gene;Acc:103029... [more]
phf5a2.306e-3790.12PHD finger protein 5A [Source:NCBI gene;Acc:103029... [more]
back to top
BLAST of PHD finger-like domain-containing protein 5A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
phf5a3.550e-5989.91PHD finger protein 5A [Source:ZFIN;Acc:ZDB-GENE-02... [more]
back to top
BLAST of PHD finger-like domain-containing protein 5A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RDS33.389e-3355.24Component of the SF3b subcomplex of the U2 snRNP; ... [more]
back to top
BLAST of PHD finger-like domain-containing protein 5A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO319224.166e-5988.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PHD finger-like domain-containing protein 5A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
phf5a1.739e-5889.91PHD finger protein 5A [Source:NCBI gene;Acc:101164... [more]
back to top
BLAST of PHD finger-like domain-containing protein 5A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000029843.15.867e-65100.00SMESG000029843.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020375 ID=SMED30020375|Name=PHD finger-like domain-containing protein 5A|organism=Schmidtea mediterranea sexual|type=transcript|length=365bp
TTAGATATTTCAAAGTTTTAAATGGCTAAGCATCATGCAGATTTAATTTT
TTGCAGAAAGCTACCGGGAGTAGCTATTGGAAGATTATGCGAAAAATGTG
ATGGTAAATGTGTTATTTGTGATTCATATGTTAGGCCATGCACGTTGGTT
AGGATTTGTGATGAATGCAATTATGGTTCACATGTCGGAAGATGCGTAAT
TTGTGGTGGTGTTGGAGTTTCAGATGCTTACTATTGTCGCGAATGTACAA
TATTAGAAAAAGACAGAGATGGATGTCCTAAAATAGTCAATCTGGGTACA
GCTCGAACAGACTTATTTTACGAGCGGAAGAAATATGGTTTTAAAAAATA
GTATTAATCTATGCC
back to top

protein sequence of SMED30020375-orf-1

>SMED30020375-orf-1 ID=SMED30020375-orf-1|Name=SMED30020375-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=110bp
MAKHHADLIFCRKLPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECN
YGSHVGRCVICGGVGVSDAYYCRECTILEKDRDGCPKIVNLGTARTDLFY
ERKKYGFKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR005345PHF5
Vocabulary: biological process
TermDefinition
GO:0045893positive regulation of transcription, DNA-templated
GO:0000398mRNA splicing, via spliceosome
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006397mRNA processing
GO:0008380RNA splicing
Vocabulary: cellular component
TermDefinition
GO:0071011precatalytic spliceosome
GO:0071013catalytic step 2 spliceosome
GO:0005634nucleus
GO:0005681spliceosomal complex
GO:0005686U2 snRNP
GO:0005689U12-type spliceosomal complex
GO:0016363nuclear matrix
GO:0016607nuclear speck
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003723RNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005345PHF5-likePIRSFPIRSF016468RDS3pcoord: 1..109
e-value: 3.2E-50
score: 166.6
IPR005345PHF5-likePFAMPF03660PHF5coord: 1..104
e-value: 2.1E-48
score: 162.8
IPR005345PHF5-likePANTHERPTHR13120FAMILY NOT NAMEDcoord: 1..109
NoneNo IPR availablePANTHERPTHR13120:SF2coord: 1..109