Hemicentin-1

Overview
NameHemicentin-1
Smed IDSMED30020371
Length (bp)12695
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Hemicentin-1 (SMED30020371) t-SNE clustered cells

Violin plots show distribution of expression levels for Hemicentin-1 (SMED30020371) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Hemicentin-1 (SMED30020371) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Hemicentin-1 (SMED30020371) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020371

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30020371SMESG000021248.1 Contig49541newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020371SMESG000021248.1 Contig49541uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30020371SMESG000021248.1 dd_Smed_v4_1161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30020371SMESG000021248.1 dd_Smed_v4_1161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020371SMESG000021248.1 dd_Smed_v4_1161_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020371SMESG000069530.1 SMESG000062787.1 SMESG000050992.1 SMESG000041908.1 SMESG000021248.1 SMESG000008972.1 SMESG000005064.1 Contig37501uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020371SMESG000069530.1 SMESG000062787.1 SMESG000050992.1 SMESG000041908.1 SMESG000021248.1 SMESG000008972.1 SMESG000005064.1 Contig37501newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020371SMESG000021248.1 Contig35714uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020371SMESG000021248.1 Contig35714newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020371SMESG000021248.1 Contig35713uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020371SMESG000021248.1 Contig35713newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020371SMESG000069530.1 SMESG000062787.1 SMESG000050992.1 SMESG000041908.1 SMESG000021248.1 SMESG000008972.1 SMESG000005064.1 Contig10795uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020371SMESG000069530.1 SMESG000062787.1 SMESG000050992.1 SMESG000041908.1 SMESG000021248.1 SMESG000008972.1 SMESG000005064.1 Contig10795newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parenchymaSMED30020371SMESG000021248.1 SMESG000003214.1 dd_1161dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
body wall musculatureSMED30020371SMESG000021248.1 dd_Smed_v4_1161_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30020371SMESG000021248.1 dd_Smed_v6_1161_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30020371SMESG000021248.1 dd_Smed_v6_1161_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30020371SMESG000021248.1 dd_Smed_v4_1161_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
body wall musculatureSMED30020371SMESG000021248.1 dd_Smed_v4_1161_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Hemicentin-1 vs. Ensembl Human
Match: HMCN1 (hemicentin 1 [Source:HGNC Symbol;Acc:HGNC:19194])

HSP 1 Score: 1546.56 bits (4003), Expect = 0.000e+0
Identity = 1089/3701 (29.42%), Postives = 1699/3701 (45.91%), Query Frame = 1
Query: 1903 LIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLD-LAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTID--GNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKD---FVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESK--PPAVISWLKNGKEIEYSN--RIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAK--DGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENV--------ELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMI-------KIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQF------------NDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYN-PIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAINIGESLN--FTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSING--------ISMRETPEFLKGSTTNLWCNVSGFPTPQIRW----------TYMETIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILK--DGELRLSCNSDAAPVATIEWFKDGELIRNN--LRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRI---DFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLP-SYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKF---PTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNF--VISNNAKVLTIPSVNKEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRYGTKTD-SRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNG-ITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKV-SLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLNS-NGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIK----RTILMCKVEGK-VDSIVWLKNGVIVQNSSRL-YINDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQGEVHSQPIYLTVQIPGGWSAWQEWSKCSLSCGKGFISRKRLCNNPPPSEFGMTCIGEDFEKRDCLLRFCPTDGEWSPWQEWSICSTKCGSGIRQRTRRCDNPPPSNLGKPCIGEAIEDILCEGNLPCPINGAWSEWKPWTVCSITCGFGGSQRRDRSCNNPEPKNNGKFCDGKELEVRACSKGPCPIDGRWXXXXXXXXXXXXXXXXIKQKARRCDNPTPKFGGANCVGTNIKKEKCNELPCPVHGQWSNWGSWSECSTECGSGLQERDRTCTEPSPNFGGQWCRGPSKEVQKCNENKCTINKVNIVSPWSEWSSCSLPCLKNSVDTSERTRNRKC-----LSSNGICSEKLIEKIKCYWISKCSIEESQNSSLGEIRGLLNGEDIGVVFLNATW-DSKNSKKIYFNISLTDIKNKYLSCFKVFTGLLTPLLWYEAYEVGLAGNGKSVSKGHFQMETNMEFADGSKMNLDHXXXXXXXXXXXXXXXXGQCPDAVMSA------NPADITLDSYKEIVVQMNPALGKLNSDSSRYFKIKNEIEPYQWTTGITVTKTRTQ-PITVQQLLVQDLSVRTDLPKGMLEFSVSSLIAEDDDSKSCPPGFTLIKSQRFCEDVNECKNAKFHKCDQICENTVPRFKCNCRSGFMLSSDGKSCQDINECSKNISPCSEPNHECINTPGSYMCKPKCAPGLRRSFDKLTCGDINECVEKPNICDSQLCINTHGSYYCLCRHGYKKMKNSCIDIDECSLGIAKCGLHQKCRNTPGSFFCENLCYDGY-QLINEQCYDLDECSSGTANCSKSSTCTNLPGSYRCECNDGFYTS--GSTCIDVNECQTNSSQCIYGCKNTYGSYECICPPNFIQSRDKKSCLKKHEICKTGFTWTSDRGCIDIDECTSYTNPHSCQHQCINTYGSY-----------------HCLCPQG--------------------------------------FSLNPKTMKCLDVDECRTNLGICSEKKLCINTPGNYSCIEPKCPKSYHFDIKLKACVSNCTEKSEICLSQSSRIQYIVVHMTGSLAQPVE-VRVI-----NTMKQKENNCQFTEKDVTPNIPITYESLQGSIILKPSWRNFNESIFLNQPYYLLFEVACWSSPDKHQQIFQKSFYIYVTLSKYPF 12525
            L + SA  SD G Y CVA +  G  +    ++ +  P    +E+ +S + + ++   C++ + PPPT +W  +G  L    P +SI  +   S +KI + + QD+G   C+A N AG  E    ++    P I   D L +   +EG+  ++ C ++G+P P + W+  GSPV  D  G + I      L I+  EK+    + CVA+N AG+++K +NL +   P I +     T I  + G++I++ C+V+G PPP V W++    G+ +  A G    +++ + L +K + + D   Y+C A N  G   +   + +    AP       +     S ++K  V L  E+   P   I+W K+G  +  SN  RI++    L +     ED   YTC+ +N  G  +    L V   P I+G+  T  D K  +   + L C+  G+P P+I W K G+PL  +    I+    G  L + ++   H G +TC A++      + F ++V   P I+  G SD   G+ E+V         L C   S  P+  I W+K+G PL E    + I      L++    ED  G Y C ATNE     + +++ + + P  +   +        ++  K    LTL C  + +  P+   SW      L+ +     N   + + L I + +    G YTC  +N+ G  ++ +DV I   P   +              +   V I+N I+L C  +  P P + W   K   P  +    ++      L + RA     G Y+C+A NE G+D     V V  P I +K  N ++     ++V  +    C+ + +P     W K   D    L  D  K   +G  L +   +  D G Y C+A N   S    F L V + P+++G  S    + +N    L  TC   G P P   W K+   +       I  GG+TL I + + SD   Y C   N+AGE KK F + V+VPPSI          +++RE      G++ +L C  +  P P I W          T++E +           LH    + S   +Y C A N AG   K F   +  PP   S++  ++  I++     + L+C++   P  TI W K+ + I N+  L V I + G++L +  +Q SD G Y C+ SN  G  ++ + + I +PPS+          V LG N+ L C + G P P I+W KDG  I   +  R+ +S +G  L +   + +D G+Y C+A N  G+ D  F++ V   PT+        K+   V  ++ +EC  +G P P I WLK+G+P   LP S   R++   + + I+  Q SD   Y+CVA N  G      ++ + APP++D +    E  +  G    + C  +G+P P++A+ +DG  L +       DA     L VS    +L L  A+  DSG Y C ASN  G     + ++V  PP  + S    +++   N    L C   G+  P  K+TW + G PL     ++    G  + +   +  D G Y C A +        + V V + P          I  ++N  V + C+    PPP + W R  + + A     P+  IL G   +QI N    D   Y C A+N  G   ++F ++V +PP I     GP++  +  N      C      +  P I W K+ + +L G+   Y    NG  L I +    ++GRY C A N AG D     L V  PP     PT+       +TV +       C A G P PSI W      ++     N   ++S+ + V+  PSV+ +   ++C   N  G   +   L V +P  +  +  +          + CTA G P P I WT++G  +   G       +G +EI   +    GRYTC   N      + V + +  PP I+     + V +   +LLPC   GT    I W   G N  +S     +  L   GL I R  ++ +G Y CVA N AG    +I L V V P +  P   E    ++  + + C+  +G+P P ITW ++G   +  ++    ++ S    F  ++  D G  TC+A NVAG    + ++TV + P++ S     T +E S   + C  +G P P + WKKD   L N+LG ++      E+ + ++  ED+G Y C+   +  E  T +  L++   P F   P   ++ +  + +   C+AT  P P + W FN   I +  +S NG   + ++ V  E++G Y C A+N VG V+    + V   P   V++ D PS  I+      IL C+V+G    +I W + GV ++ S R+  + + +L I    ++D G Y C+A+N AG  +  + L ++SPP+ TL P     N G  +IL C A G P PTI+W +    I +D   +++ N SL I   QKE +  + CVA +  G V  + + + VQ+ GG+S W  W  CS++CGKG   R RLCN P P+  G  C G D E R+C  + CP DG WS W  W  C+  CG G + RTR C+NP   + G+PC G A+E I+C    PCP++GAWS W+PW  CS +CG  G+Q R R CNNP P   G +CDG E +++ C++  CPI G+W++W+ WS CS SCG G +Q+ R C +P P++GG  C G++++ + CN  PCP HG WS W  W  CS  C  G   R RTC  P P+ GG+ C GP  ++Q+CN + C ++       W  WS CS  C        E+TR R C     +     C     +  +C  +  C        + G + G +N  + G+ FLNAT  DS NS        +T++     S  +    +L P+ W  A E+G A NG +++   F+ ET +EFA G  + + H    L +   L         D V+S       +PA++T+  Y E  +Q  P  G+L + S+R F I     PY W   +   + + + P  V+ L    +    +  +  L F + + I++ D S  CP GFTL     FC D +EC  A  + C   C N +  + C+C  G  +++DG++CQDI+EC+     C     +C NT GSY C  +C  G RR+ D L+C DINEC E  + C  Q C N  GS++C C  GY+     C+D++EC   +  C   Q C+NT G + C +LC +G  +  N  C D+DEC  GT  C  +  C N  GSYRC C  G+ +   G  C+D+NEC+     C + C NT GS++CICPP      D KSC     +   G  ++S           +   P     Q  + Y SY                    CP+G                                      + L      C D+DEC      C   ++C N  G+Y CI+  CP +Y  D     C+ NC      C      ++Y +V +   +A   + +R++       M  +       E+   P   +  E+L+G +    + R   E+    + Y +    + +S+    +  +Q +F +Y+ +S YP+
Sbjct: 2068 LALTSAQISDTGRYTCVAVNAAGEKQRDIDLRVYVPPNIMGEEQNVSVLISQAVELLCQSDAIPPPTLTWLKDGHPLL-KKPGLSISEN--RSVLKIEDAQVQDTGRYTCEATNVAGKTEKNYNVNIWVPPNIGGSDELTQLTVIEGNLISLLCESSGIPPPNLIWKKKGSPVLTDSMGRVRILSGGRQLQISIAEKSDAALYSCVASNVAGTAKKEYNLQVYIRPTITNSGSHPTEIIVTRGKSISLECEVQGIPPPTVTWMKD---GHPLIKAKGVE-ILDEGHILQLKNIHVSDTGRYVCVAVNVAGMTDKKYDLSVH---APPSIIGNHRSPENISVVEKNSVSLTCEASGIPLPSITWFKDGWPVSLSNSVRILSGGRMLRLMQTTMEDAGQYTCVVRNAAGEERKIFGLSVLVPPHIVGE-NTLEDVKVKEKQSVTLTCEVTGNPVPEITWHKDGQPLQEDEAHHIISG--GRFLQITNVQVPHTGRYTCLASSPAGHKSRSFSLNVFVSPTIAGVG-SD---GNPEDVTVILNSPTSLVCEAYSYPPA-TITWFKDGTPL-ESNRNIRILPGGRTLQILNAQEDNAGRYSCVATNEAGEMIKHYEVKVYIPPIINKGDLWGPGLSPKEVKIKVNNTLTLEC--EAYAIPSASLSWYKDGQPLKSDDH--VNIAANGHTLQIKEAQISDTGRYTCVASNIAGEDELDFDVNIQVPPSFQKLWEIGNMLDTGRNGEAKDVIINNPISLYCETNAAPPPTLTWY--KDGHPLTSSDKVLILPGGRVLQIPRAKVEDAGRYTCVAVNEAGEDSLQYDVRVLVPPI-IKGANSDLPEEVTVLVNKSALIECLSSGSPAPRNSWQK---DGQPLLEDDHHKFLSNGRILQILNTQITDIGRYVCVAENTAGSAKKYFNLNVHVPPSVIGPKSENLTVVVNNFISL--TCEVSGFPPPDLSWLKNEQPIKLNTNTLIVPGGRTLQIIRAKVSDGGEYTCIAINQAGESKKKFSLTVYVPPSIKDHDSESLSVVNVRE------GTSVSLECESNAVPPPVITWYKNGRMITESTHVEILADGQ------MLHIKKAEVSDTGQYVCRAINVAGRDDKNFHLNVYVPP---SIEGPEREVIVETISNPVTLTCDATGIPPPTIAWLKNHKRIENSDSLEVRILSGGSKLQIARSQHSDSGNYTCIASNMEGKAQKYYFLSIQVPPSVAGAEIPSDVSVLLGENVELVCNANGIPTPLIQWLKDGKPIASGETERIRVSANGSTLNIYGALTSDTGKYTCVATNPAGEEDRIFNLNVYVTPTIRGNKDEAEKLMTLVDTSINIECRATGTPPPQINWLKNGLP---LPLSSHIRLLAAGQVIRIVRAQVSDVAVYTCVASNRAGVDNKHYNLQVFAPPNMDNSMGTEEITVLKGSSTSMACITDGTPAPSMAWLRDGQPLGL-------DA----HLTVSTHGMVLQLLKAETEDSGKYTCIASNEAGEVSKHFILKVLEPPHINGSEEHEEISVIVNNPLELTCIASGI--PAPKMTWMKDGRPLPQTDQVQTLGGGEVLRISTAQVEDTGRYTCLASSPAGDDDKEYLVRVHVPPNIAGTDEPRDITVLRNRQVTLECKSDAVPPPVITWLRNGERLQAT----PRVRILSGGRYLQINNADLGDTANYTCVASNIAGKTTREFILTVNVPPNIKG---GPQSLVILLNKSTVLEC--IAEGVPTPRITWRKDGA-VLAGNHARYSILENG-FLHIQSAHVTDTGRYLCMATNAAGTDRRRIDLQVHVPPSIAPGPTN-------MTVIVNVQTTLACEATGIPKPSINWRKNGHLLNVDQNQNSYRLLSSGSLVIISPSVD-DTATYECTVTNGAGDDKRTVDLTVQVPPSIADEPTDFLVTKHAPAVITCTASGVPFPSIHWTKNGIRLLPRGDGYRILSSGAIEILATQLNHAGRYTCVARNAAGSAHRHVTLHVHEPPVIQPQPSELHVILNNPILLPCEATGTPSPFITWQKEGINVNTSG--RNHAVLPSGGLQISRAVREDAGTYMCVAQNPAGTALGKIKLNVQV-PPVISPHLKEYVIAVDKPITLSCEA-DGLPPPDITWHKDGRAIVESIRQRVLSSGSLQIAF--VQPGDAGHYTCMAANVAGSSSTSTKLTVHVPPRIRSTEGHYTVNENSQAILPCVADGIPTPAINWKKDNVLLANLLG-KYTAEPYGELILENVVLEDSGFYTCVANNAAGE-DTHTVSLTVHVLPTFTELPGDVSLNKGEQLR-LSCKATGIPLPKLTWTFNNNIIPAHFDSVNGHSELVIERVSKEDSGTYVCTAENSVGFVKAIGFVYVKEPP---VFKGDYPSNWIEPLGGNAILNCEVKGDPTPTIQWNRKGVDIEISHRIRQLGNGSLAIYGTVNEDAGDYTCVATNEAGVVERSMSLTLQSPPIITLEPVETVINAGGKIILNCQATGEPQPTITWSRQGHSISWDDRVNVLSNNSLYIADAQKEDTSEFECVARNLMGSVLVR-VPVIVQVHGGFSQWSAWRACSVTCGKGIQKRSRLCNQPLPANGGKPCQGSDLEMRNCQNKPCPVDGSWSEWSLWEECTRSCGRGNQTRTRTCNNPSVQHGGRPCEGNAVEIIMCNIR-PCPVHGAWSAWQPWGTCSESCG-KGTQTRARLCNNPPPAFGGSYCDGAETQMQVCNERNCPIHGKWATWASWSACSVSCGGGARQRTRGCSDPVPQYGGRKCEGSDVQSDFCNSDPCPTHGNWSPWSGWGTCSRTCNGGQMRRYRTCDNPPPSNGGRACGGPDSQIQRCNTDMCPVD--GSWGSWHSWSQCSASC-----GGGEKTRKRLCDHPVPVKGGRPCPGDTTQVTRCN-VQACP--GGPQRARGSVIGNINDVEFGIAFLNATITDSPNSDTRIIRAKITNVPRSLGSAMRKIVSILNPIYWTTAKEIGEAVNGFTLTNAVFKRETQVEFATGEILQMSHIARGLDSDGSLLL-------DIVVSGYVLQLQSPAEVTVKDYTEDYIQTGP--GQLYAYSTRLFTIDGISIPYTWNHTVFYDQAQGRMPFLVETLHASSVESDYNQIEETLGFKIHASISKGDRSNQCPSGFTLDSVGPFCADEDEC--AAGNPCSHSCHNAMGTYYCSCPKGLTIAADGRTCQDIDECALGRHTC-HAGQDCDNTIGSYRCVVRCGSGFRRTSDGLSCQDINECQES-SPCH-QRCFNAIGSFHCGCEPGYQLKGRKCMDVNECRQNV--CRPDQHCKNTRGGYKCIDLCPNGMTKAENGTCIDIDECKDGTHQCRYNQICENTRGSYRCVCPRGYRSQGVGRPCMDINECEQVPKPCAHQCSNTPGSFKCICPPGQHLLGDGKSCAGLERLPNYGTQYSS-YNLARFSPVRNNYQPQQHYRQYSHLYSSYSEYRNSRTSLSRTRRTIRKTCPEGSEASHDTCVDIDECENTDACQHECKNTFGSYQCICPPGYQLTHNGKTCQDIDECLEQNVHCGPNRMCFNMRGSYQCIDTPCPPNYQRDPVSGFCLKNCPPNDLECALSPYALEYKLVSLPFGIATNQDLIRLVAYTQDGVMHPRTTFLMVDEEQTVP-FALRDENLKGVVY---TTRPLREA----ETYRMRVRASSYSANGTIE--YQTTFIVYIAVSAYPY 5635          

HSP 2 Score: 1158.67 bits (2996), Expect = 0.000e+0
Identity = 898/3157 (28.44%), Postives = 1451/3157 (45.96%), Query Frame = 1
Query:  136 LLLTILYSVIVIDGAQYREVIGSSDPSTGISLAIVFDSTGSMGNDLKQVKRGSRRILNNHLQKGYKKFIKDFVLVQVHDPDVGPXXXXXXXXXXXXYLDYVFTQGGGDCPEMTISGIEMALEASRPHSLIYVFTDSSAKDYEITPRVLNLIQKKQSQVVFVLTGFCNSTEEIGFQVYKQIATISSGQIYILGKGDVKEFMKIIERAVETVKVHILQEESSNFGSKTYSFPIDSHITQFTIQVTNFKANESIKVAIRDPEGRELTESNGLIRLLKSVKTVYFASKENPAPGMWTLEVTTKSSNHSVRITGASEVDFLPGFSTIPEPSNDRTSRQPIKGAKNYLMANVTGNFLPGTIEWLYIMSVNGSSIIQLPANQTENQIYISQYPFEI-------PVDGHFYIKLSGKDSRGNEMQRYSRIAIFSRDPLPVSVSCPAKIQVKRGHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNVTLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKNASIEPFKDAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGS----PVTIDGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYF----INQ--DNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRIMAK-DNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQI--SKEGIS-----DYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDS-KMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKI--------IQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAINIGESLN--FTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGG-RVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTY-METIXXXXXXXXXXQLHFMNVDKSHIT---RYTCIATNEAGSARKLFDPVLTYPPKIV-SLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFR---RVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSI-DRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSS-GGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVN-KEGGIFKCIARNEVGSIMKVYKLEVIMPALV-----RLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGI-FRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKI--ESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPG---NNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIF----RPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVS---------LPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWK-----------SFRCEATSHPKPDIKWMFNGRAIESK---LNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESI----KRTILMCKVEGK-VDSIVWLKNG--VIVQNSSRLYINDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPP-VFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNG-SLRIIGVQKEHSGVYFCVASSNQGEVHSQPIYLTVQIP 9321
             L  +LYS +  D +   E+     P    +LA VFD TGSM +DL QV  G+ +IL   L++  K+ + +F LV  HDP++GP   TT  K F   L  ++ QGGGDCPEM+I  I++ALE S P S IYVFTD+ +KDY +T  VL LIQ+KQSQVVFVLTG C+    IG++VY++IA+ SSGQ++ L K  V E +K +E AV+  KVH+L  +       T+  P D  + + T+ ++      S  + IR+P G+ + +  GL  LL    +    + + P  GMWT++ T+ S  HSVRITG S +DF  GFS  P     +T  +P++G   Y++ N +G   P  I+ L ++S++GSS+  +P      + Y  + P+ I       P +  F++K++G D      QR S ++  S  P    V+ P K         ++ C V S +P+ +++ +N      T   +   K +++V L+I +     +G Y    V       +  G  R Q    V  PPP + VP N ++ P + A L C + S + +  L W         +N +  R+    +     +  L + S   +D GEY C+   EGG S A  F+     P  +V  K  SF     ++  C A   P P  +W +N   +  +  R  + +D     + I N  P+D+G   C A NSAG D+    L YI  PK++ +     + L GD   + C  +G+P P++ W F G     P T    +II+  +G L I   +    G + CVA N AG +     LD+G  P       ++    G N+T+ C V+G P P +KW R      N+PI    R F    I+Q    +L I  L   D+  YIC+A+NQ GK+Q    + ++G+ AP I  + S   V+E   +  + C ++   P     W+KN   +  +  I  + D +L I+ V+ +D   YTC+A N  GT      + V   P  I   +  +   +G  + L C+  G+PKP + W K G  L      +     DGS L V S   E +G + CTATN      ++ +++V   P++   + G+S     +  + + E V L C + S  P P I W K  Q +     R       + +K+      ++G Y C ATN   + ++  ++ + V PK     K +K+  + G+++ + C   G P P   WS   S + L      ++N       L I Q      GIYTC  TN+ G+ +    + + E P +          F ++     +  I   C A G P P IKWL   + +     G  ++ E+   L++        GEY C+A NE G  ++   + V  P +      + +T   +++       C +  TP   I W+K+ + + +S      +   +G  L LF     D+G Y C AINI  +    F + VL+ PTI+G +    V ++    D+ + C  +G P P   W+KD   L  G   VE+ + G+ L +K  RR+D   YQC V+N AG+  K+  + +++PPSI G ++      L  S   L C   G P P I W    + I S        +  ++++ ++ ++    YTC   N AG+A K F   +  PP I  +L     + ++    L L C +   P   + W KDG  ++ N  + I   G +L +++AQE D G Y C+ ++  G  +  + VD+++PP+I+   +     V +   L L C   G P P I W KDG  ID R   ++LL  +G  L +     ++ G Y+C+A NT G     F+V V   PT+   G     V +     V L+C+ +GIP P+ITWLKD  P+N       +I  + + L+I      DAGRY+CVA N  G+ +  + + +  PPS+ D  ++LNE ++ V + ++L C A G+P P I ++KD           N+  S    +      Q++ + SA+ +D+G+Y+C A N+ G   + YS++V   P    SN    V    N    LEC   G+  P   +TW + G P+SS    +++   G  + + + +  D G Y C A N   +     ++ V++ P     +    +  + +  V++ C+    PPPTL W +    +L    + P   I    SV++I + Q  D   Y C ATN  G  EK + +++ +PP I       +   ++ N+ I+  C   +  +  P ++W K+ SP+L          + G+ L I   +  ++  Y+C A N+AG     + L V   P      S   E I V  G S++ +C  +G P P++ W     P+         I +   +L + +++  + G + C+A N  G   K Y L V  P  +       + I V E++  S S+ C A G P P I W +DG  +      +  S   +L +     ED G+YTC   N   ++ K   + ++ PP I  E+  + + V+  + V L C V G     I W+  G       +  I+   +FL      I  V+  H+G Y C+A++ AG++    +L V V P I          + T +LN+   + C+     P   ITW ++G  L   +N             + + ++ G  +C+A N AGE    +++ V + P ++          P  V     +++T+ C+    P  +++W KDGQ L++        N    + I + +  DTG Y C+      E       ++I   P F    ++ N++   R             S  CE  + P P + W  +G  + S    L   G   + +   + E+AG Y C+A N  G     + + V+  P ++   SD P E      K  ++ C   G       W K+G  ++  +  +   N   L I   +  D G Y C+A N+AG A+   +L V  PP V      N++  +   + L C   G+P P +SW KN++ IK +    ++  G +L+II  +    G Y C+A +  GE   +   LTV +P
Sbjct:   11 FLFALLYSSLAQDASPQSEIRAEEIPEGASTLAFVFDVTGSMYDDLVQVIEGASKILETSLKRP-KRPLFNFALVPFHDPEIGPVTITTDPKKFQYELRELYVQGGGDCPEMSIGAIKIALEISLPGSFIYVFTDARSKDYRLTHEVLQLIQQKQSQVVFVLTGDCDDRTHIGYKVYEEIASTSSGQVFHLDKKQVNEVLKWVEEAVQASKVHLLSTDHLEQAVNTWRIPFDPSLKEVTVSLS----GPSPMIEIRNPLGKLIKKGFGLHELLNIHNSAKVVNVKEPEAGMWTVK-TSSSGRHSVRITGLSTIDFRAGFSRKPTLDFKKTVSRPVQGIPTYVLLNTSGISTPARIDLLELLSISGSSLKTIPV-----KYYPHRKPYGIWNISDFVPPNEAFFLKVTGYDKDDYLFQRVSSVSFSSIVPDAPKVTMPEKTPGYYLQPGQIPCSVDSLLPFTLSFVRNGV----TLGVDQYLKESASVNLDIAKVTLSDEGFYECIAV-------SSAGTGRAQTFFDVSEPPPVIQVPNNVTVTPGERAVLTCLIIS-AVDYNLTW--------QRNDRDVRLAEPARIRTLANLSLELKSVKFNDAGEYHCMVSSEGGSSAASVFLTVQEPPKVTVMPKNQSFTGGSEVSIMCSATGYPKPKIAWTVNDMFIVGSH-RYRMTSD---GTLFIKNAAPKDAGIYGCLASNSAGTDKQNSTLRYIEAPKLMVVQSELLVAL-GDITVMECKTSGIPPPQVKW-FKGDLELRPSTF---LIIDPLLGLLKIQETQDLDAGDYTCVAINEAGRATGKITLDVGSPPVFIQEPADVSMEIGSNVTLPCYVQGYPEPTIKWRR----LDNMPIF--SRPFSVSSISQLRTGALFILNLWASDKGTYICEAENQFGKIQSETTVTVTGLVAPLIGISPSVANVIEGQ-QLTLPCTLLAGNPIPERRWIKNSAMLLQNPYITVRSDGSLHIERVQLQDGGEYTCVASNVAGTNNKTTSVVVHVLP-TIQHGQQILSTIEGIPVTLPCKASGNPKPSVIWSKKGE-LISTSSAKFSAGADGS-LYVVSPGGEESGEYVCTATNTAGYAKRKVQLTVYVRPRVFGDQRGLSQDKPVEISVLAGEEVTLPCEVKS-LPPPIITWAKETQLISPFSPRHTFLPSGS-MKITETRTSDSGMYLCVATNIAGNVTQAVKLNVHVPPKIQRGPKHLKV--QVGQRVDIPCNAQGTPLPVITWSKGGSTM-LVDGEHHVSNP---DGTLSIDQATPSDAGIYTCVATNIAGTDETEITLHVQEPPTVEDLEPPYNTTFQER---VANQRIEFPCPAKGTPKPTIKWLHNGRELTGREPGISIL-EDGTLLVIASVTPYDNGEYICVAVNEAGTTERKYNLKVHVPPVIKD--KEQVTNVSVLLNQLTNLFCEVEGTPSPIIMWYKDNVQVTES---STIQTVNNGKILKLFRATPEDAGRYSCKAINIAGTSQKYFNIDVLVPPTIIGTNFPNEV-SVVLNRDVALECQVKGTPFPDIHWFKDGKPLFLGDPNVELLDRGQVLHLKNARRNDKGRYQCTVSNAAGKQAKDIKLTIYIPPSIKGGNVTTDISVLINSLIKLECETRGLPMPAITWYKDGQPIMSSSQALYIDKGQYLHIPRAQVSDSATYTCHVANVAGTAEKSFHVDVYVPPMIEGNLATPLNKQVVIAHSLTLECKAAGNPSPILTWLKDGVPVKANDNIRIEAGGKKLEIMSAQEIDRGQYICVATSVAGEKEIKYEVDVLVPPAIEGGDETSYFIVMVNNLLELDCHVTGSPPPTIMWLKDGQLIDERDGFKILL--NGRKLVIAQAQVSNTGLYRCMAANTAGDHKKEFEVTVHVPPTIKSSGLSERVVVKY--KPVALQCIANGIPNPSITWLKDDQPVNTAQG-NLKIQSSGRVLQIAKTLLEDAGRYTCVATNAAGETQQHIQLHVHEPPSLEDAGKMLNETVL-VSNPVQLECKAAGNPVPVITWYKD-----------NRLLSGSTSMTFLNRGQIIDIESAQISDAGIYKCVAINSAGATELFYSLQVHVAPSISGSNNMVAVV--VNNPVRLECEARGI--PAPSLTWLKDGSPVSSFSNGLQVLSGGRILALTSAQISDTGRYTCVAVNAAGEKQRDIDLRVYVPPNIMGEE--QNVSVLISQAVELLCQSDAIPPPTLTWLKDGHPLL----KKPGLSISENRSVLKIEDAQVQDTGRYTCEATNVAGKTEKNYNVNIWVPPNIGGSDELTQLTVIEGNL-ISLLCE--SSGIPPPNLIWKKKGSPVLTDSMGRVRILSGGRQLQISIAEKSDAALYSCVASNVAGTAKKEYNLQVYIRPTITNSGSHPTE-IIVTRGKSISLECEVQGIPPPTVTWMKDGHPL--IKAKGVEILDEGHILQLKNIHVSDTGRYVCVAVNVAGMTDKKYDLSVHAPPSIIGNHRSPENISVVEKN--SVSLTCEASGIPLPSITWFKDGWPVSLSNSVRILSGGRMLRLMQTTMEDAGQYTCVVRNAAGEERKIFGLSVLVPPHIVGENTLEDVKVKEKQSVTLTCEVTGNPVPEITWHKDGQPLQEDEAHHIISGGRFLQ-----ITNVQVPHTGRYTCLASSPAGHKSRSFSLNVFVSPTIAGVGSDGNPEDVTVILNSPTSLVCEAYS-YPPATITWFKDGTPLESNRNIRILPGGRTLQILNAQEDNAGRYSCVATNEAGEMIKHYEVKVYIPPIINKGDLWGPGLSPKEVKIKVNNTLTLECEAYAIPSASLSWYKDGQPLKSDDHVNIAANGHT-LQIKEAQISDTGRYTCVASNIAGE-DELDFDVNIQVPPSFQKLWEIGNMLDTGRNGEAKDVIINNPISLYCETNAAPPPTLTWYKDGHPLTSSDKVLILPGGRVLQIPRAKVEDAGRYTCVAVNEAGEDSLQYDVRVLVPPIIKGANSDLPEEVTVLVNKSALIECLSSGSPAPRNSWQKDGQPLLEDDHHKFLSNGRILQILNTQITDIGRYVCVAENTAGSAKKYFNLNVHVPPSVIGPKSENLTVVVNNFISLTCEVSGFPPPDLSWLKNEQPIKLNTNTLIVPGGRTLQIIRAKVSDGGEYTCIAINQAGESKKK-FSLTVYVP 3055          

HSP 3 Score: 433.721 bits (1114), Expect = 1.936e-120
Identity = 400/1575 (25.40%), Postives = 649/1575 (41.21%), Query Frame = 1
Query: 1324 IKLSGKDSRGNEMQRYSRIAIFSRDPLPVSVSCPAKIQVKRGHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNVTLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKNASIEPFKD-AELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDE--KEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTD-PRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILS--LDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYG-ENITI--------RCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNSLIIKGL--SMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQ---VVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRI--MAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIG-DFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKAS--DSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNS--PIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNK--NITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAIN-IGESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRW----TYMETIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGP--TLDPGGKRYYKVERTV--GGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTI 5934
            I  +G+  +   +  Y   +I   D   +SV     + V+ G  + + C   +  P +I WYKN   I  T++ +V+      + L I +A     G Y         + + V G       + V  PP      +   +E   +   L C+        +  W K+  R E  ++   RI        +  SKL I  +  SD+G Y C+A +  G ++   F+     P+ +  E   ++S +  +++   C A   P P   W  +G+ +   +  RI +      S + I      D+G+  C A N AG ++    L+    P I     +  K + L      + C ATG P P+I W  NG P+ +  +I +      + I R + +    + CVA+N AG   K +NL + F P       N+D S G E IT+         C  +G P P + WLR        P+ L D +     + ++++ L    ED   Y C A N+ G+V +   +++  +  P I  ++  +   V+V + L+  + C +    P   ++W+K+G+ +  ++++  +     L I T + ED   YTC+A +  G    +  + V   P I G D    I       + L+C++   P P I W + G  L   P +RI+    G  L + +        +TC A+N      +EF ++V  PP I K G     I   ++  L C I  G P+P+I W K+G  L     R  I  +   L +   +  +TG Y C ATN   +D R   + + V P  +   + M  I   +    TL C+  G P P+  W     +L++ +N     NS   +    L+I     +    Y C  TN  G  K + D+ +   P I       +V       +TC ASG P P I W      + P   GY+++      ++  +    H G Y+C+A N  G   ++  + V  P +    P++   I  NPI+        C    TP   I W K  I++  S    R    L    L +      D+G Y C+A N  G +L    + +  P ++  H  + VI +++   L  +C ++G P P   W+KD   ++   R  + + G +L I  V+  D   Y C   N AG    +  + V VPP I       T    + S   L C   G PTP I W      +  +          +L   NV       YTC+A N AG         +   P    L  D    + K  +LRLSC +   P+  + W  +  +I  +   +  N  ++L +    + D G Y C   N +G  K    V +  PP  K +  +   +  LGGN  L C  +G P P I+W + G  I+    +       L +  T+  DAG Y C+A N  G  + S  + +   P  TL+P       VE  +  GG ++L C  +G P P ITW + G  I+     R  ++ N+  L I   Q  D   + CVA+N  G + + + V +
Sbjct: 3038 INQAGESKKKFSLTVYVPPSIKDHDSESLSV-----VNVREGTSVSLECESNAVPPPVITWYKNGRMI--TESTHVEILADGQM-LHIKKAEVSDTGQYVC-------RAINVAGRDDKNFHLNVYVPPSIEGPEREVIVETISNPVTLTCDATGIPPPTI-AWLKNHKRIENSDSLEVRIL-------SGGSKLQIARSQHSDSGNYTCIASNMEGKAQKYYFLSIQVPPSVAGAEIPSDVSVLLGENVELVCNANGIPTPLIQWLKDGKPIASGETERIRV--SANGSTLNIYGALTSDTGKYTCVATNPAGEEDRIFNLNVYVTPTIRGNKDEAEKLMTLVDTSINIECRATGTPPPQINWLKNGLPLPLSSHIRLLAAGQVIRIVRAQVSDVAVYTCVASNRAGVDNKHYNLQV-FAP------PNMDNSMGTEEITVLKGSSTSMACITDGTPAPSMAWLRD-----GQPLGL-DAHLTVSTHGMVLQLLKAETEDSGKYTCIASNEAGEVSKHFILKV--LEPPHINGSEEHEEISVIVNNPLE--LTC-IASGIPAPKMTWMKDGRPLPQTDQVQTLGGGEVLRISTAQVEDTGRYTCLASSPAGDDDKEYLVRVHVPPNIAGTDEPRDITVLRNRQVTLECKSDAVPPPVITWLRNGERLQATPRVRILSG--GRYLQINNADLGDTANYTCVASNIAGKTTREFILTVNVPPNI-KGGPQSLVILLNKSTVLEC-IAEGVPTPRITWRKDGAVLAGNHARYSIL-ENGFLHIQSAHVTDTGRYLCMATNAAGTDRRRIDLQVHVPPSIAPGPTNMTVIVNVQ---TTLACEATGIPKPSINWRKNGHLLNVDQN----QNSYRLLSSGSLVIISPSVDDTATYECTVTNGAGDDKRTVDLTVQVPPSIADEPTDFLVTKHAPAVITCTASGVPFPSIHWTKNGIRLLPRGDGYRILSSGAIEILATQLN--HAGRYTCVARNAAGSAHRHVTLHVHEPPVIQPQPSELHVILNNPIL------LPCEATGTPSPFITWQKEGINVNTS---GRNHAVLPSGGLQISRAVREDAGTYMCVAQNPAGTALGKIKLNVQVPPVISPHLKEYVIAVDKPITL--SCEADGLPPPDITWHKDGRAIVESIRQRVLSSG-SLQIAFVQPGDAGHYTCMAANVAGSSSTSTKLTVHVPPRIRSTEGHYT--VNENSQAILPCVADGIPTPAINWKKDNVLLANLLGKYTAEPYGELILENVVLEDSGFYTCVANNAAGEDTHTVSLTVHVLPTFTELPGDVS--LNKGEQLRLSCKATGIPLPKLTWTFNNNIIPAHF--DSVNGHSELVIERVSKEDSGTYVCTAENSVGFVKAIGFVYVKEPPVFKGDYPSNWIE-PLGGNAILNCEVKGDPTPTIQWNRKGVDIEISHRIRQLGNGSLAIYGTVNEDAGDYTCVATNEAGVVERSMSLTLQSPPIITLEP-------VETVINAGGKIILNCQATGEPQPTITWSRQGHSISW--DDRVNVLSNNS-LYIADAQKEDTSEFECVARNLMGSVLVRVPVIV 4526          

HSP 4 Score: 182.57 bits (462), Expect = 1.477e-44
Identity = 142/514 (27.63%), Postives = 226/514 (43.97%), Query Frame = 1
Query: 1894 SSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIK--THTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQE-----SQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRIMAKDN-TLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPII-IGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVK 3408
            S  L I  A   D G Y+CVA++  G   A+G IK      P  S   KE     +  IT SC A   PPP  +W  +GR         +IV  +++       ++I+ V+P D+G   C A N AG      KL+    P+I S +    +  E  Q  + C A G+P P I W+ +   +         E  G L +  +     G + CVA N+AG    + +L +   P   +   ++  + GE + + C+  G P P++ W       +N  I       +N  + L+I+ +S ED   Y+C A+N  G V+    I    +  P +         +E      I+   V+  P   I W + G +IE S+RI    N +L I     ED   YTC+A N+ G  +  + L +Q+ PII +   +T I+A  G  I+L CQ  G+P+P I W + G  ++ +  + ++     + L +    +E    F C A N   +V+    V V+
Sbjct: 4040 SGGLQISRAVREDAGTYMCVAQNPAGT--ALGKIKLNVQVPPVISPHLKEYVIAVDKPITLSCEADGLPPPDITWHKDGR---------AIVESIRQRVLSSGSLQIAFVQPGDAGHYTCMAANVAGSSSTSTKLTVHVPPRIRSTEGHYTVN-ENSQAILPCVADGIPTPAINWKKDNVLLANLLGKYTAEPYGELILENVVLEDSGFYTCVANNAAGEDTHTVSLTVHVLPTFTELPGDVSLNKGEQLRLSCKATGIPLPKLTWT------FNNNIIPAHFDSVNGHSELVIERVSKEDSGTYVCTAENSVGFVK---AIGFVYVKEPPVFKGDYPSNWIEPLGGNAILNCEVKGDPTPTIQWNRKGVDIEISHRIRQLGNGSLAIYGTVNEDAGDYTCVATNEAGVVERSMSLTLQSPPIITLEPVETVINA--GGKIILNCQATGEPQPTITWSRQGHSISWDDRVNVL---SNNSLYIADAQKEDTSEFECVARNLMGSVLVRVPVIVQ 4527          
BLAST of Hemicentin-1 vs. Ensembl Human
Match: HMCN2 (hemicentin 2 [Source:HGNC Symbol;Acc:HGNC:21293])

HSP 1 Score: 1093.57 bits (2827), Expect = 0.000e+0
Identity = 849/3139 (27.05%), Postives = 1405/3139 (44.76%), Query Frame = 1
Query:  211 PSTG-ISLAIVFDSTGSMGNDLKQVKRGSRRILNNHLQKGYKKFIKDFVLVQVHDPDVGPXXXXXXXXXXXXYLDYVFTQGGGDCPEMTISGIEMALEASRPHSLIYVFTDSSAKDYEITPRVLNLIQKKQSQVVFVLTGFCNSTEEIGFQVYKQIATISSGQIYILGKGDVKEFMKIIERAVETVKVHILQEESSNFGSKTYSFPIDSHITQFTIQVTNFKANESIKVAIRDPEGRELTESNGLIRLLK---SVKTVYFASKENPAPGMWTLEVTTKSSNHSVRITGASEVDFLPGFSTIPEPSNDRTSRQPIKGAKNYLMANVTGNFLPGTIEWLYIMSVNGSSIIQLP----ANQTENQIYISQYPFEIPVDGHFYIKLSGKDSRGNEMQRYSRIAIFSRDPLPVSVSCPAKIQVKRGHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNVTLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKNASIEPFKDAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRI--EHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNS--LIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNR-IMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEI------GSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDS-KMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVV--FIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFA-PYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLD-GSTLTLFEVKHLDSGIYKCLAINIGESL--NFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGG-RVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRW----TYMETIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELR---LSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRI-DFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGS--IRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENH--RVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKF------PTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVN-KEGGIFKCIARNEVGSIMKVYKLEVIMPA--LVRLDKI-EVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRYGTKTDSRTG--ILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRV--GEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHS--GVYRCVANNDAGYQEIRITLEVLVQPKIFRPTE----TETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDS-GLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSL--PISVTGDE------GSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENE-INIYDLKPEDTGNYICIGERSGAE-----------------ASTASTYLSIFTRPKFVYK--PKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAI----ESKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESI-----KRTILMCKVEGK-VDSIVWLKNGVIVQNSSRLYINDFN--LIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPP-VFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKY-DFVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQGEVHSQPIYLTVQIP 9321
            P+TG  +LA VFD TGSM ++L QV  G+ RIL   L +   + I ++ LV  HDPD+GP   T     F + L  ++ QGGGDCPEM++  I+ A+E + P S IYVF+D+ AKDY     +L L+Q KQSQVVFVLTG C      G+  Y++IA  SSGQ++ L K  V E +K +E A++  KVH+L  +    G  T+  P D  + + TI ++        ++ ++DP GR L E  GL  LL    S K V F  +    PG+W+++V + S  HSVRITG S +DF  GFST P    + T   P++G    L+ N TG   PG ++ + +   +G  ++ LP    +N + +Q++    PF  P +  FY+K+ GKD  GN + R S ++     P    VS   +I       + V+C V S +P+ +   + +A++   +     F+ + N + EI RA++  +G Y    V       +  G  R +  + V  PPP++    N ++ P + A L C V   +             Y L   + +R+      +        L I     +D G Y CVA +  GV+ A  ++     P  S+      F     +  SC A   P P  SW    + L   D RI +  D Q + I I  V P+D+G   C+A N  G D+  + L Y   P + +++    +   G++  + C A+GVP P++ W   G  + +        + G L I   ++   G + C A N  G +     L +G  P++ +   ++    G +  + C+  G+PPP V W RG      + +  G      Q +S  L  + ++ EDQ+ Y+C+A+N  GKVQ   ++ ++G A P+IA +     V+E      + C+V+  +P     WLK+G+ +   +R  +  D +L +     E    Y+C+A N  G+   D+EL VQ  P I       I   +G    L C   G P P I W K    LT   G    +S +G+ L +   + + AG + CTATN      +E ++SV   P+I   G  + ++       + E V L+C    G+P P + W K+ +P+  I  R  +    + L++      ++G YEC A+N   S S  + + + V P+     +++K+    GE L LNC  +G P P   WS K  ++   R P G  +            +R+   G Y C+ +N  G      ++ +LE P         ++        +L C A G P P++ W       P +      V E + +L +   +    G+Y C A NE G   + + + V+  P I       N++    + G ++T  C  N  P  EI W K+     + +PK      LD G +L    ++  DSG+Y C A N   +   +F L+VL  P++LG  +++ V+ +    D+ + CW+ G P P+  W KD   ++ GG  +++   G+ L I      D+  YQC   + AG+  ++F + V  PP+I G +       ++     L C   G PTP I W      + T    +      QL       S    YTC A+N  G+A K     +  PP I       + +++K    R   L C +   P  T+ W  +G  +  +    +   G+ L L +  E+  G+Y C+ S+  G     ++V++ +PP +      G     +G  L L C + G P P I+W ++G    +   V ++  G  L ++      +G + C A N  G      +V V   P++   G     +       V L+C+  G+PTP++ W KDG+ +           G + Q+E + ++  D G Y+C A N  G+ +  + + +  PP+I+   + N+ +++    + L C A+G P P++++FK            ++  S    + VS + ++L +  A+ +D+G Y+C ASN  G   + Y +RV  PP        P         R L C   G   P   + W + G P+S  G+  +++ P G  +T+ + +  D+G Y C A + V +      ++V + P     +L   +  V N +V + C+    PPP L W++  + +    E  P   +    +++Q+      DA  Y C A N  G  EK + ++V + P    R    E+H   V+E       C         P I W K+  P+             G+ L +   +  + G YTCE  N+ G  S    L V  PP+       PT  S+ ++ +          +C A G P P++ W     P+     +   + N  + L +        G + C+A N  G   + ++L V++P   +  LD +  +     +  ++LC A G P P I+W R G+     G  T    G  +L++T  +E+D+G Y+C  +N+  +  ++  V ++ PP IE+     +++V  G+   L C V G    ++ W+  G         G+   +S  G+++  ++ + S  G Y C+A N  G +     L VL+ P I    E     E T  +N  + + C+ L   P P ITW ++G      +N      + GL I N+ K ED G  TC+  N  GE    + + V + P +S   P++  G +       S++T+ C+    P PT+ W KDGQ +     +R +   E   + I   +  D+G Y+C+      E                     S    I +R +       + + +V E       C+  + P PD+ W    + +    E  +   GR  + +  VR+ENAG Y C A N VG     + L V+  P V +  +++  E +         L C   G  V +I WL+NG+    S RL + +    L ++ A+  D   Y C+A N AG A+    L V+ PP +  L    ++A L   + LPC    +P P ++WYK+ + +   + V  L    +L++   +   SG+Y C A +  G    + + L+V +P
Sbjct:   31 PTTGDATLAFVFDVTGSMWDELMQVIDGASRILERSLSR-RSQAIANYALVPFHDPDIGPVTLTADPTVFQRELRELYVQGGGDCPEMSVGAIKAAVEVANPGSFIYVFSDARAKDYHKKEELLRLLQLKQSQVVFVLTGDCGDRTHPGYLAYEEIAATSSGQVFHLDKQQVTEVLKWVESAIQASKVHLLSTDHEEEGEHTWRLPFDPSLKEVTISLS----GPGPEIEVQDPLGRILQEDEGLNVLLNIPDSAKVVAFKPEH---PGLWSIKVYS-SGRHSVRITGVSNIDFRAGFSTQPLLDLNHTLEWPLQGVPISLVINSTGLKAPGRLDSVELAQSSGKPLLTLPTKPLSNGSTHQLW-GGPPFHTPKE-RFYLKVKGKDHEGNPLLRVSGVSYSGVAPGAPLVSMAPRIHGYLHQPLLVSCSVHSALPFRLQLRRGEARLGEER----HFQESGNSSWEILRASKAEEGTYECTAV-------SRAGTGRAKAQIVVTDPPPQLVPAPNVTVSPGETAVLSCRVLGEAP------------YNLTWVRDWRVLPASTGRVAQLADLSLEISGIIPTDGGRYQCVASNANGVTRASVWLLVREAPQVSIHTSSQHFSQGVEVKVSCSASGYPTPHISWSRESQALQ-EDSRIHV--DAQGTLI-IQGVAPEDAGNYSCQATNEVGTDQETVTLYYTDPPSVSAVNAVVLV-AVGEEAVLVCEASGVPPPRVIWYRGGLEMILAPE---GSSSGKLRIPAAQERDAGTYTCRAVNELGDASAEIQLAVGHAPQLTELPRDVTVELGRSALLACRATGRPPPTVTWRRGDGQPLGLRLGAGRGSRSRQPDSGVLFFESVAPEDQAPYVCEARNVFGKVQAEARLIVTGHAPPQIASSAPTVRVLEGQ-PVSLPCIVLAGRPLPERHWLKDGRPLPPGSRHSIRADGSLHLDRALQEHAGRYSCVATNTAGSQHRDVELVVQVPPRIHPTATHHI-TNEGVAASLPCVASGVPAPTITWTKETNALTSR-GPHYNVSKEGT-LLIAQPSAQDAGAYVCTATNTVGFSSQEMRLSVNTKPRIHMNGSRNADVPLQVTAKAGEEVTLDC-EAKGSPPPLVTWTKDSRPVPPITNRYGLLPSGS-LRLAQVQVGDSGHYECTASNPAGSASHRYVLGVQVPPQVQPGPRVLKVLV--GEALDLNCVAEGNPEPQLSWS-KDGVVLQGRGPQGSVH---------FAAIRTSDAGRYRCEASNSAGVDAWEVELRVLEPPHWGADETSGLLERVAGENASLPCPARGTPKPQVTWRKGPSSEPLHGQPGVAVLE-EGSLFLASVSPADSGDYECQATNEVGSTSRRAKLVVYVPPSIREDGRKANVSG---MAGQSLTLECDANGFPVPEIVWLKDA----QLIPKVGGHRLLDEGQSLHFPRIQEGDSGLYSCRAENQAGTAQRDFHLLVLTPPSVLGAGAAQEVLGL-AGADVELQCWTSGVPTPQVEWTKDRQPVLPGGPHLQVQEDGQVLRITGSHVGDEGRYQCVAFSPAGQQARDFQLRVHAPPTIWGSNETGEVAVMEDHLVQLLCEARGVPTPNITWFKDGALLPTSTKVVYTRGGRQLQLGRAQSSDAGVYTCKASNAVGAAEKATRLDVYVPPTIEGA--GGRPYVVKAVAGRPVALECVARGHPSPTLSWHHEGLPVAESNESRLETDGSVLRLESPGEASSGLYSCVASSPAGEAVLQYSVEVQVPPQLLVAEGLGQVTTIVGQPLELPCQASGSPVPTIQWLQNGRPAEELAGVQVASQGTTLHIDHVELDHSGLFACQATNEAGTAGAEVEVSVHEFPSVSIIGGE--NITAPFLQPVTLQCIGDGVPTPSLRWWKDGVALA--------AFGGNLQIEKVDLR--DEGIYTCAATNLAGESKREVALKVLVPPNIEPGPV-NKAVLE-NASVTLECLASGVPPPDVSWFKG-----------HQPVSSWMGVTVSVDGRVLRIEQAQLSDAGSYRCVASNVAGSTELRYGLRVNVPPRITLPPSLPGPVLVNTPVR-LTCNATGAPSP--TLMWLKDGNPVSPAGTPGLQVFPGGRVLTLASARASDSGRYSCVAVSAVGEDRQDVVLQVHMPPSILGEEL--NVSVVANESVALECQSHAMPPPVLSWWKDGRPL----EPRPGVHLSADKALLQVDRADVWDAGHYTCEALNQAGHSEKHYNLNVWVAPVFPLR----ESHTLTVREGHPTRLSCECRGVPF--PKISWRKDGQPLPGEGAGLQHVSAVGRLLYLGQAQLAQEGTYTCECSNVVGNSSQDLQLEVHVPPQIAGPREPPTQVSVVQDGVA-------TLECNATGKPPPTVTWERDGQPVG--AELGLQLQNQGQSLHVERAQAAHTGRYSCVAENLAGRAERKFELSVLVPPELIGDLDPLTNITAALHSPLTLLCEAMGIPPPAIRWFR-GEEPVSPGEDTYLLAGGWMLKMTQTQEQDSGLYSCLASNEAGEARRNFSVEVLVPPSIENEDLEEVIKVLDGQTAHLMCNVTGHPQPKLTWFKDGR----PLARGDAHHISPDGVLLQVLQANLSSAGHYSCIAANAVGEKTKHFQLSVLLAPTILGGAEDSADEEVTVTVNNPISLICEAL-AFPSPNITWMKDGAPFEASRNIQLLPGTHGLQILNAQK-EDAGQYTCVVTNELGEAVKNYHVEVLIPPSISKDDPLAEVGVKEVKTKVNSTLTLECESWAVPPPTIRWYKDGQPVTP--SSRLQVLGEGRLLQIQPTQVSDSGRYLCVATNVAGEDDQDFNVLIQVPPMFQKVGDFSAAFEILSREEEARGGVTEYREIV-ENNPAYLYCDTNAIPPPDLTWYREDQPLSAGDEVSVLQGGR-VLQIPLVRAENAGRYSCKASNEVGEDWLHYELLVLTPP-VILGDTEELVEEVTVNASSTVSLQCPALGNPVPTISWLQNGLPFSPSPRLQVLEDGQVLQVSTAEVADAASYMCVAENQAGSAEKLFTLRVQVPPRIAGLDLEQVTAILNSSVSLPCDVHAHPNPEVTWYKDSQALSLGEEVFLLPGTHTLQLGRARLSDSGMYTCEALNAAGR-DQKLVQLSVLVP 3036          

HSP 2 Score: 855.514 bits (2209), Expect = 0.000e+0
Identity = 665/2556 (26.02%), Postives = 1124/2556 (43.97%), Query Frame = 1
Query: 1903 LIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEK-EISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTD-PRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTN-IDGSYGENITIRCQVEGQPPPRVKW------LRGIAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVES--KPPAVISWLKNGKEI--EYSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFK--TFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDY-EIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPK----ASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFI-------DNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNIT----------------YNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAIN-IGES-LNFTLVVLISPTILGKHSSK-SVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTY-METIXXXXXXXXXXQLHFMNVDKSHIT---RYTCIATNEAGSARKLFDPVLTYPPKI--VSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRRVL-LSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGG--KRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINR--LPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYII-KVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENM---QITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTF-NNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVL----CTAEGYPKPVIKWTRDGKGI-FRY--GTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKV--SLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETR-WKSFRCEATSHPKPDIKWMFNGRAIESKLNSNGRGSITLQ--SVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTI-LMCKVEGK-VDSIVWLKNGVIVQNSS-RLYINDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQGEVHSQPIYLTVQIP-GGWSA 9336
            L I  A  SD G Y CVA +  G +E    ++ +  P  ++        + N  +  +C A   P PT  W  +G  + P   P + +    +   + +++ +  DSG   C A ++ G D   + L     P IL  +L   + +  +   + C +  +P P ++W  +G P+     + ++     L ++R +    G + C A N AG S K +NL++   P      ++ +    G    + C+  G P P++ W      L G   G     A+G   ++ Q          +  +  Y C+  N  G   + +Q+ +     P+IA  +     V S ++  +  L   +  KPP  ++W ++G+ +  E   ++  +  +L ++  +A     Y+C+A+N  G A+   EL V   P +IGD    T I A     + L C+  G P P I W +G  P++  PG    +   G  L +    E+ +G ++C A+N+     + F V V  PP I  E + +  ++   +   L C +T G+P PK+ W+K+G+PL        I+    +L+V   N    G Y C A N V   ++ FQ+++L+AP     A DS   ++       ++L C+   FP+P   W    +  +  RN   I   P   + L I   + E  G YTC  TN  G A  +Y V +L  P I + +  + V +       ++T+TL C +   P P I+W    + + P++   +++GE +  L ++       G Y C+A N  G+D ++  V +  P +  K  + +                  Y  I+        C  N+ PP ++ W++ +  +      D   +   G  L +  V+  ++G Y C A N +GE  L++ L+VL  P ILG        + +N  + + + C + GNP P   W ++        R+++   G+ L +     +D + Y C   N+AG  +K F + V VPP I G+ + +    L  S+ +L C+V   P P++ W    + ++    +      H + + ++ ++    YTC A N AG  +KL    +  PP        P     +    +  LSC +DA P  T+ W+KDG+ +    R      G +L +  AQ SD G+Y C VSN  G   + +T+ + +PP+ +        QVA G  L L C   G P P + W KD   ++   V  +   G  L ++      AG Y C+AENT  +    F V V   P +   G  + ++ +E   G  V L+C   G P P + WLKDG P+ +   P  R+ + G S  L +  ++ASDAG Y+CVA N  G+      V +  PP+I +    +  ++ + G+ + + CP  GSP  ++++ KDG  L +            +R L+      L +   +  D+G++ C A++  G     ++++V+ PP  +    +  V         L C   GV  P   ++W + G PL S    +    G  + +E V   D+G Y C A +E  +    F + V   P    +   T++       +++ C+  G P P + W++  Q +   +         R   V+++ N+Q  DA  Y C A +  G IEK F + V  PP I+    GP   R    +   Q+   CSV       P I W ++    ++   D +  F   G+ L +    + +SG Y+C A+N AG  S  F + + + P   +        + V +  +    C A+G P P + W    +P+ P     F I     +   P + ++ G + C+A N  GS                       +R G    VL    C A G PKP++ W +DG+ + FR   G      +  L +T    +D+ ++ C  +N++ +  +   V +  PP I   +    V +   V+L C   G     + W   G  Q+ +   G Y+      L I +    H+G Y C A N AG     + L V   P + +P  +    V    + + C+   GIP+P ITW++ G+ ++   +        L I ++   ED G+  CIAKN AG      ++ V++ P +   LP  ++  EGS   + CK  G P+P +TW KDGQ +    G +F      E+ + +L+ +D G Y C  E +   A     +L+I   P F   P  +++    R W   RC A   P P I W  N R +   ++    GS TLQ  +V  E++G Y C A+NRVG  +    + V   P ++        E +  +I L C V G  V  I W+K+G+ ++ S  R  + + +L I + +  D G YQC+A N  G A+  V L+++S PVF + P +++   G+ + L C A G P PTI W +  + ++       + +GSL +  V+   +G Y CVA +  G   ++   +    P G W +
Sbjct: 1949 LRIEQAQLSDAGSYRCVASNVAGSTELRYGLRVNVPPRITLPPSLPGPVLVNTPVRLTCNATGAPSPTLMWLKDGNPVSPAGTPGLQVFPGGR--VLTLASARASDSGRYSCVAVSAVGEDRQDVVLQVHMPPSILGEELNVSV-VANESVALECQSHAMPPPVLSWWKDGRPLEPRPGVHLSADKALLQVDRADVWDAGHYTCEALNQAGHSEKHYNLNVWVAPVFPLRESHTLTVREGHPTRLSCECRGVPFPKISWRKDGQPLPGEGAGLQHVSAVGRLLYLGQAQ--------LAQEGTYTCECSNVVGNSSQDLQLEVH--VPPQIAGPREPPTQV-SVVQDGVATLECNATGKPPPTVTWERDGQPVGAELGLQLQNQGQSLHVERAQAAHTGRYSCVAENLAGRAERKFELSVLVPPELIGDLDPLTNITAALHSPLTLLCEAMGIPPPAIRWFRGEEPVS--PGEDTYLLAGGWMLKMTQTQEQDSGLYSCLASNEAGEARRNFSVEVLVPPSIENEDLEEVIKVLDGQTAHLMCNVT-GHPQPKLTWFKDGRPLARGDAH-HISPDGVLLQVLQANLSSAGHYSCIAANAVGEKTKHFQLSVLLAPTILGGAEDSADEEVTVTVNNPISLICEALAFPSPNITWMKDGAPFEASRN---IQLLP-GTHGLQILNAQKEDAGQYTCVVTNELGEAVKNYHVEVLIPPSISKDDPLAEVGVKEVKTKVNSTLTLECESWAVPPPTIRWYKDGQPVTPSSR-LQVLGEGR-LLQIQPTQVSDSGRYLCVATNVAGEDDQDFNVLIQVPPMFQKVGDFSAAFEILSREEEARGGVTEYREIVENNPAYLYCDTNAIPPPDLTWYREDQPLSAG---DEVSVLQGGRVLQIPLVRAENAGRYSCKASNEVGEDWLHYELLVLTPPVILGDTEELVEEVTVNASSTVSLQCPALGNPVPTISWLQNGLPFSPSPRLQVLEDGQVLQVSTAEVADAASYMCVAENQAGSAEKLFTLRVQVPPRIAGLDLEQVTAILN-SSVSLPCDVHAHPNPEVTWYKDSQALSLGEEVFLLPGTHTLQLGRARLSDSGMYTCEALNAAGRDQKLVQLSVLVPPAFRQAPRGPQDAVLVRVGDKAVLSCETDALPEPTVTWYKDGQPLVLAQRTQALRGGQRLEIQEAQVSDKGLYSCKVSNVAGEAVRTFTLTVQVPPTFENPKTETVSQVA-GSPLVLTCDVSGVPAPTVTWLKDRMPVESSAVHGVVSRGGRLQLSRLQPAQAGTYTCVAENTQAEARKDFVVAVLVAPRIRSSGVAREHHVLE---GQEVRLDCEADGQPPPDVAWLKDGSPLGQDMGPHLRFYLDGGS--LVLKGLRASDAGAYTCVAHNPAGEDARLHTVNVLVPPTIKQGADGSGTLVSRPGELVTMVCPVRGSPPIHVSWLKDGLPLPL-----------SQRTLLHGSGHTLRISKVQLADAGIFTCVAASPAGVADRNFTLQVQVPPVLEPVEFQNDVVVVRGSLVELPCEARGVPLP--LVSWMKDGEPLLS----QSLEQGPSLQLEAVGAGDSGTYSCVAVSEAGEARRHFQLTVMEPPHIEDSGQPTELSLTPGAPMELLCDAQGTPQPNITWHKDGQALTRLENNS------RATRVLRVENVQVRDAGLYTCLAESPAGAIEKSFRVRVQAPPNIV----GPRGPRFVVGLAPGQLVLECSVEAE--PAPKITWHRDG---IVLQEDAHTQFPERGRFLQLQALSTADSGDYSCTARNAAGSTSVAFRVEIHTVPTIRSG----PPAVNVSVNQTALLPCQADGVPAPLVSWRKDRVPLDPRSP-RFEILPEGSLRIQPVLAQDAGHYLCLASNSAGS-----------------------DRQGRDLRVLALLPCEASGSPKPLVVWWKDGQKLDFRLQQGAYRLLPSNALLLTAPGPQDSAQFECVVSNEVGEAHRLYQVTVHVPPTIADDQTDFTVTMMAPVVLTCHSTGIPAPTVSWSKAGA-QLGARGSG-YRVSPSGALEIGQALPIHAGRYTCSARNSAGVAHKHVFLTVQASP-VVKPLPSVVRAVAEEEVLLPCEA-SGIPRPTITWQKEGLNVATGVSTQVLPGGQLRIAHA-SPEDAGNYLCIAKNSAGSAMGKTRLVVQVPPVIENGLP-DLSTTEGSHAFLPCKARGSPEPNITWDKDGQPVSGAEG-KFTIQPSGELLVKNLEGQDAGTYTCTAENAVGRARR-RVHLTILVLPVFTTLPGDRSLRLGDRLW--LRCAARGSPTPRIGWTVNDRPVTEGVSEQDGGS-TLQRAAVSREDSGTYVCWAENRVGRTQAVSFVHVKEAPVLQGEAFSYLVEPVGGSIQLDCVVRGDPVPDIHWIKDGLPLRGSHLRHQLQNGSLTIRRTERDDAGRYQCLAENEMGVAKKVVILVLQSAPVFQVEPQDMTVRSGDDVALRCQATGEPTPTIEWLQAGQPLRASRRLRTLPDGSLWLENVETGDAGTYDCVAHNLLGSATARAFLVVRGEPQGSWGS 4399          

HSP 3 Score: 236.498 bits (602), Expect = 7.175e-61
Identity = 217/818 (26.53%), Postives = 341/818 (41.69%), Query Frame = 1
Query: 6973 IGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRYGTKTDSR-----TGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERN-----GITLSKVKNYYT-TTDSGLFIFNSLKIEDEGSLTCIAKNVAG----EDRLTFQITVELLPKV-SLPISVTGDEGSSVTIICKV-EGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESK---LNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRT-------ILMCKVEGKVDSIV-WLKNGVIVQNSSRLY--INDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQGEVHSQPIYLTVQIPGGWSA 9336
            +G+  ++    N  S  IL     E G Y C A + AG       + VT PP       +    +TV  G +    C   G    ++ W  +D  + P          +  +     +  +GG ++C+A N  G       L V     V +         G    V C+A GYP P I W+R+ + +     + DSR      G L I     ED G Y+C  TN++  D ++V +    PP + +    ++V VGE+ +L C   G  P R+ WY  G   I +      +  S   L I   ++  +G Y C A N+ G     I L V   P++       T  +  + L + C+   G P P +TW R      G+ L   +   +   DSG+  F S+  ED+    C A+NV G    E RL   +T    P++ S   +V   EG  V++ C V  G+P P   W KDG+ L    G+R    ++  +++     E  G Y C+   +    S       +   P  ++     ++  E    S  C A+  P P I W     A+ S+    N +  G++ +    +++AG Y C A N VG       L V  KPR+ +  S +    ++ T        L C+ +G    +V W K+   V   +  Y  +   +L + Q +  D+G Y+C ASN AG A  +  L V+ PP     P  +   +GE L L C AEG P P +SW K+  ++     +     GS+    ++   +G Y C AS++ G V +  + L V  P  W A
Sbjct:  466 LGEERHFQESGN-SSWEILRASKAEEGTYECTAVSRAGTGRAKAQIVVTDPPPQ----LVPAPNVTVSPGETAVLSCRVLGEAPYNLTWV-RDWRVLPASTGRVAQLADLSLEISGIIPTDGGRYQCVASNANGVTRASVWLLVREAPQVSIHTSSQHFSQGVEVKVSCSASGYPTPHISWSRESQAL-----QEDSRIHVDAQGTLIIQGVAPEDAGNYSCQATNEVGTDQETVTLYYTDPPSVSAVNAVVLVAVGEEAVLVCEASGVPPPRVIWYRGGLEMILAP-----EGSSSGKLRIPAAQERDAGTYTCRAVNELGDASAEIQLAVGHAPQLTELPRDVTVELGRSAL-LACRA-TGRPPPTVTWRRGDGQPLGLRLGAGRGSRSRQPDSGVLFFESVAPEDQAPYVCEARNVFGKVQAEARLI--VTGHAPPQIASSAPTVRVLEGQPVSLPCIVLAGRPLPERHWLKDGRPLPP--GSRHSIRADGSLHLDRALQEHAGRYSCVATNTAG--SQHRDVELVVQVPPRIHPTATHHITNEGVAASLPCVASGVPAPTITWTKETNALTSRGPHYNVSKEGTLLIAQPSAQDAGAYVCTATNTVGFSSQEMRLSVNTKPRIHMNGSRNADVPLQVTAKAGEEVTLDCEAKGSPPPLVTWTKDSRPVPPITNRYGLLPSGSLRLAQVQVGDSGHYECTASNPAGSASHRYVLGVQVPPQVQPGPRVLKVLVGEALDLNCVAEGNPEPQLSWSKDGVVL-----QGRGPQGSVHFAAIRTSDAGRYRCEASNSAG-VDAWEVELRVLEPPHWGA 1253          

HSP 4 Score: 227.254 bits (578), Expect = 4.320e-58
Identity = 167/587 (28.45%), Postives = 251/587 (42.76%), Query Frame = 1
Query: 10372 NSSLGEIRGLLNGEDIGVVFLNAT-WDSKNSKKIYFNISLTDIKNKYLSCFKVFTGLLTPLLWYEAYEVGLAGNGKSVSKGHFQMETNMEFADGSKMNLDHXXXXXXXXXXXXXXXX--GQCPDAVMSANPADITLDSYKEIVVQMNPALGKLNSDSSRYFKIKNEIEPYQWTTGITVTKTR-TQPITVQQLLVQDLSVRTDLPKGMLEFSVSSLIAEDDDSKSCPPGFTLIKSQRFCEDVNECKNAKFHKCDQICENTVPRFKCNCRSGFMLSSDGKSCQDINECSKNISPCSEPNHECINTPGSYMCKPKCAPGLRRSFDKLTCGDINECVEKPNICD-SQLCINTHGSYYCLCRHGYKKMKNS--CIDIDECSLGIAKCGLHQKCRNTPGSFFCENLCYDGYQLINE--QCYDLDECSSGTANCSKSSTC-------TNLPG-SY-----------------RCECNDGFYTSGSTCIDVNECQTNSSQCIYGCKNTYGSYECICPPNFIQSRDKKSCLKKHEICKTGFTWTSDRGCIDIDECTSYTNPHSCQHQCINTYGSYHCL---CPQGFSLNPKTMKCL 12021
              S G + G++NG   GV  LN +     +S     + S+  +        +V    + P+ W  A E G A NG S++ G F+ E+++EFA G  + +      L     L   ++  G  P+++  A   D+ +  ++E  VQ  P  G+L   S++ F         +    I     R  QP  VQ L    +S   D     L F +++ +  +++   CP GF L     FC D +EC       C   C N   RF C C +GF L+ D ++C+D++EC+ +   C E    C+N  GSY C P C PG R + D   C D++EC+E  + C  +QLC NT G + C C  GY+    S  C+D++EC L + K   +Q C N  GS+ C  LC  G  L+ +   C  L+         S             ++PG SY                 R  C  GF      C D++EC+   + C + C+NT GSY+C+CP  +                       S + C DI+EC   +        C NT GSY C+   CP  +   P    C 
Sbjct: 4394 QGSWGSMTGVINGRKFGVATLNTSVMQEAHSGVSSIHSSIRHVPANVGPLMRVLVVTIAPIYWALARESGEALNGHSLTGGRFRQESHVEFATGELLTMTQVARGLDPDGLLLLDVVVNGVVPESLADA---DLQVQDFEEHYVQTGP--GQLFVGSTQRFFQGGLPSFLRCNHSIQYNAARGPQPQLVQHLRASAISSAFDPEAEALRFQLATALQAEENEVGCPEGFELDSQGAFCVDRDECSGGP-SPCSHACLNAPGRFSCTCPTGFALAWDDRNCRDVDECAWDAHLCRE-GQRCVNLLGSYRCLPDCGPGFRVA-DGAGCEDVDECLEGLDDCHYNQLCENTPGGHRCSCPRGYRMQGPSLPCLDVNEC-LQLPKACAYQ-CHNLQGSYRC--LCPPGQTLLRDGKACTSLERNGQNVTTVSHRGPLLPWLRPWASIPGTSYHAWVSLRPGPMALSSVGRAWCPPGFIRQNGVCTDLDECRVR-NLCQHACRNTEGSYQCLCPAGY-------------------RLLPSGKNCQDINECEEESIECGPGQMCFNTRGSYQCVDTPCPATYRQGPSPGTCF 4948          

HSP 5 Score: 194.126 bits (492), Expect = 5.333e-48
Identity = 125/465 (26.88%), Postives = 191/465 (41.08%), Query Frame = 1
Query: 11296 CAPGLRRSFDKLTCGDINECVEKPNICDSQLCINTHGSYYCLCRHGYKKM--KNSCIDIDECSLGIAKCGLHQKCRNTPGSFFCENLCYDGYQLIN-EQCYDLDECSSGTANCSKSSTCTNLPGSYRCECNDGFYTSGST--CIDVNECQTNSSQCIYGCKNTYGSYECICPPNFIQSRDKKSC--LKKH---------------------EICKTGF-TWTSDRG-----------------------CIDIDECTSYTNPHSCQHQCINTYGSYHCLCPQGFSLNPKTMKCLDVDECRTNLGICSEKKLCINTPGNYSCIEPKCPKSYHFDIKLKACVSNCTEKSEICLSQSSRIQYIVVHMTGSLAQPVEVRVINTMKQ---KENNCQFTEKDVTPNIPITYESLQGSIILKPSWRNFNESIFLNQPYYLLFEVACWSSPDKHQQIFQKSFYIYVTLSKYPF 12525
            C  G         C D +EC   P+ C S  C+N  G + C C  G+       +C D+DEC+     C   Q+C N  GS+ C   C  G+++ +   C D+DEC  G  +C  +  C N PG +RC C  G+   G +  C+DVNEC      C Y C N  GSY C+CPP     RD K+C  L+++                      I  T +  W S R                        C D+DEC      + CQH C NT GSY CLCP G+ L P    C D++EC      C   ++C NT G+Y C++  CP +Y        C   C++  +      S +QY ++ +   +    +V  +    +     N  + +  +  P  P     L+  +    + R    +         L+ +   ++  +HQ +    F + + +S YP+
Sbjct: 4613 CPEGFELDSQGAFCVDRDECSGGPSPC-SHACLNAPGRFSCTCPTGFALAWDDRNCRDVDECAWDAHLCREGQRCVNLLGSYRCLPDCGPGFRVADGAGCEDVDECLEGLDDCHYNQLCENTPGGHRCSCPRGYRMQGPSLPCLDVNECLQLPKACAYQCHNLQGSYRCLCPPGQTLLRDGKACTSLERNGQNVTTVSHRGPLLPWLRPWASIPGTSYHAWVSLRPGPMALSSVGRAWCPPGFIRQNGVCTDLDECRVR---NLCQHACRNTEGSYQCLCPAGYRLLPSGKNCQDINECEEESIECGPGQMCFNTRGSYQCVDTPCPATYRQGPSPGTCFRRCSQ--DCGTGGPSTLQYRLLPLPLGVRAHHDVARLTAFSEVGVPANRTELSMLEPDPRSPFALRPLRAGLGAVYTRRALTRAG--------LYRLTVRAAAPRHQSV----FVLLIAVSPYPY 5059          

HSP 6 Score: 192.971 bits (489), Expect = 1.105e-47
Identity = 161/657 (24.51%), Postives = 274/657 (41.70%), Query Frame = 1
Query: 1759 AELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKI 3729
            A L C   S S   ++ W+K   + +     R +   Y+  P   S+ L++ +    D+ ++ CV  +E G +  +  +  H  P  + D+ + +      +  +C +   P PT SW   G +L     R S         ++I    P  +G   C A+NSAG+    + L+  + P +  L        E ++  + C A+G+P+P ITW+  G  V    +  +    G L I        G ++C+A NSAGS+     L +   P I++ + ++  + G +  + C+  G P P + W +    G  +  A G ++ I     L++K L  +D   Y C A+N  G+ +  V + I  +  P   FT            ++ +       P   I W  N + +          +TL    V  ED   Y C A+N+VG  +    + V+  P++ G+  +++    G  I L C  +GDP P I W K G PL    G  +        LT+     + AG + C A N+     K   + +++ P    E   D  + S ++V L C  T G P+P IEW + GQPL     R         L +      + G+Y+C A N + S +    + +   P+ S   M  +
Sbjct: 3775 ALLPCEA-SGSPKPLVVWWKDGQKLDF----RLQQGAYRLLP---SNALLLTAPGPQDSAQFECVVSNEVGEAHRLYQVTVHVPPTIADDQTDFTVTMMAPVVLTCHSTGIPAPTVSWSKAGAQL---GARGSGYRVSPSGALEIGQALPIHAGRYTCSARNSAGVAHKHVFLTVQASPVVKPLPSVVRAVAE-EEVLLPCEASGIPRPTITWQKEGLNVATGVSTQVLPG-GQLRIAHASPEDAGNYLCIAKNSAGSAMGKTRLVVQVPPVIENGLPDLSTTEGSHAFLPCKARGSPEPNITWDK---DGQPVSGAEG-KFTIQPSGELLVKNLEGQDAGTYTCTAENAVGRARRRVHLTI--LVLP--VFTTLPGDRSLRLGDRLWLRCAARGSPTPRIGWTVNDRPVTEGVSEQDGGSTLQRAAVSREDSGTYVCWAENRVGRTQAVSFVHVKEAPVLQGEAFSYLVEPVGGSIQLDCVVRGDPVPDIHWIKDGLPLR---GSHLRHQLQNGSLTIRRTERDDAGRYQCLAENEMGVAKKVVILVLQSAPVFQVE-PQDMTVRSGDDVALRCQAT-GEPTPTIEWLQAGQPLRA--SRRLRTLPDGSLWLENVETGDAGTYDCVAHNLLGSATARAFLVVRGEPQGSWGSMTGV 4403          
BLAST of Hemicentin-1 vs. Ensembl Human
Match: TTN (titin [Source:HGNC Symbol;Acc:HGNC:12403])

HSP 1 Score: 573.163 bits (1476), Expect = 1.840e-162
Identity = 632/2575 (24.54%), Postives = 1050/2575 (40.78%), Query Frame = 1
Query: 1807 KWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSE---AVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDP-RISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGN--IIINETI-GTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSY----GENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRY-FINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVE--SKPPAVISWLKNGKEIEYSNR--IMAKDNTLVIKTVK--AEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGIS-DYEIGSKENVELNCIITSGNPSPKIEWYKNGQPL-VEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITIL--VAPKASDSKMIKIYTKEGEKLTLNCKIDG-FPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIV---GGNITFSCVMNSTPPAEIKWF--KNEIDIYKSLPKDRFKIS-LDG-STLTLFEVKHLDSGIYKCLAINIG--ESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKT--LLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXX------XXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELI--RNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLG---LDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFR---RVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPT--LDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDG--TRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNK-EGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISST----ILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNY--YTTTDSGLFIFNSLKIEDEGSLTCIAKNVAG--EDRLTFQITVELLPKVSLPISVTGDE---GSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRF-NSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTR--PKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLNSN-----GRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPR-VRVYQSDDPSESIKRTILMCKVEGKVD-SIVWLKNGVIVQNSSRL---YINDFNLI-INQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYD---FVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQG 9279
            KW+K      L  +K++RI  +K +     ++L   SA   D+G+Y     +E G S        +     P  +   + +  + N +    C+   + P   SWF +G+E+  +D  RI+ V     + ++I  V   D+G   C+A NS G  +    L     P  ++   +K++ L G    ++ +  G     I W F G+   + G    I  E +  +L++  ++ +  G + C  +N AG    S NL   F      FV  ++ S     G+   + C+V G PP ++ W    A    I  +   R  F+     L +  + +ED   Y+C+AQN+ G          S I   K +   +K+      LK+  V L+ E    PP  I+W K+   +    +     +D+ + ++ +K  A D   Y C   N+VG++     + ++  P  I   ++    + G     Q   KG     + W K    +T +  +R+    + + L +  I  +H G + C A ND         +SVK P  I++E +S D   G    +++     SG      +W+K+GQ L +    ++ +    +ILK+    + ++G Y  +  N+V   S   +I +L  + P +   K+ K+ + +G  + L C + G  P   + +     I   ++  F   +   +   L I+Q+     G YTC  TN  G  + S  + + E P  ++      V  +  + L  +  G     IKW    K +   A       +   +L +  A +   G Y C   N+ G     + + V  P   +K P+      P++V   G + TF C +  TP   + W+   NEI   +     +  IS +DG +T  +   +  +SG Y C A N     S +  L V   PT + +     V+     +D+ + C   G P     W K+N ++ S  +  +T+      L I K   SD   YQC V+NE G    +  V +  PPS     +  T   LK S T     V+G P   I W   + I           + + + L   +VD  H  RYTC A NE+G  R     ++  P +IV  +  K   + +   + L C     P   ++W KDG+ I       ++  N      + +  + D G Y   V N  G    D     +D  IPPS  F  K       LG ++++ C   G      +W KDG  I      R++  +    L VN+    D   Y C   N  G    S  + V   P+  + PG     + +     TV  + ++ G P   I W KD + +   P     + G++  L + ++ AS  G+Y+C   N  G       + +  PP   + ++    I+K GD  RL C   GSP   + +F++ + L          AS K R+       ++ + +    DSG + C A N  G       V V+ PP F  S+  P V    N   SLEC L G   PP ++ W +    L S    +I+     T I + NV   D GEY C AQNEV   + V  V++   PRF        + A +   +Q S E  G  P  + W ++++E++ + E   +   +   + +Q    +P +A  Y C   N GG  E    + V+ P  I++++ GP    V E    T  C V      +  + W K+   +       +  +N   SL IL+ +  ++G YT + +N  G+ S T V+ V S    P  F+   +     LG S   +C   GS   S+ WF++   I          S+N   L + S++  + G + C+A N  GS      L V  P     +   +    G + +      G P   + W R  + +    R     +     LE+ +     +G YTC  +N   Q S +  + +  P           V  G+ ++L     GT P  + W   G N  +S     +  E   + E   I++  ++D +G Y C   N+AG       +  L  P      E     V ++V  +QC++  G P+  ++W +    L     Y  Y T +    +FN + I D G  TC A+N  G    +  F+I    LP  S    +   E   G  VT+ C++ G     V W +DG  L++    +  F ++   + I       +G Y C        AS+++   +   +  P F  KP   +V+       F C  T      I W  + + I    N           + +  V   ++G+Y C A N VG    S  L V   P+ V+  ++   ++  +   L CK+ G  +  + W +N   +  S +    +IN   L+ IN+A ++D+G Y C A N  G+A     L VK+PPVFT  P  + A  G  +IL C   G P   + W K++K ++      + S   + SL I+ ++    G Y C A++  G
Sbjct: 4976 KWYKD--GRPLVASKKYRI-SFKNN----VAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGT--ASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPSFVTKPGSKDV-LPGSAVCLKSTFQGSTPLTIRW-FKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANL---FVKEPATFVEKLEPSQLLKKGDATQLACKVTGTPPIKITWF---ANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDH------CSSIVIVKESPYFTKEFKPIEVLKEYDVMLLAEVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPPSFIKKIESTSSLRGG-TAAFQATLKGSLPITVTWLKDSDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATITEEAVSIDVTQGDPATLQVKF---SGTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASEKYKFSFHD---NTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEKPQSQDVNPNTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKEPPQFIKKPS------PVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQ-----KHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVEVVKY---SDVELECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFIK-KIENTTTVLKSSAT-FQSTVAGSPPISITWLKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQIV--EKAKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPS--FTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPSFLVKPG-----RQQAIPDSTVEFKAILKGTPPFKIKWFKDDVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPKFVK-KLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELP---------ASDKYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVF--SSFPPIVETLKNAEVSLECELSGT--PPFEVVWYKDKRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFVSKLNSLTVVAGEPAELQASIE--GAQPIFVQWLKEKEEVIRESENI-RITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIVEKA-GPMTVTVGETC--TLECKVAG--TPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDV-SDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPSFVKEPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPAAFLKRLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILE---ILNSTKRD-AGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSV-SLQCQVA-GTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQLPP-SFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVSIDVIA-GESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVG 7464          

HSP 2 Score: 572.778 bits (1475), Expect = 2.683e-162
Identity = 652/2712 (24.04%), Postives = 1108/2712 (40.86%), Query Frame = 1
Query: 1429 KIQVKRGHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNVT-LEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKNASIEPFKDAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGG--VSEAVGFIKTHTLPAASVDEKEISFI--DNDSITASCRALSTPPPTFSWFLNGRELDPTDPR-ISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIINETIGT--LDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRG---IAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRI-MAKDNTLV---IKTVKAEDEAIYTCIAKNQVGTAKFDIELDV--QTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQI-----SKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPG-RVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSIL---DLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLI-VERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNK---NITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAINI-GESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEIT--NGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNV---FVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXXXXXXXXX------QLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGT--QLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRR---VLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYY-----KVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQME---IFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTP---PEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGT--RITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPV-ILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKEG---GIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGI---FRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVI---ISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIE--DEGSLTCIAKNVAGEDRLTFQITV-ELLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEI-NIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYK-PKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIES----KLN-SNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAK--PRVRVYQSDDPSESIKRTILM-CKVEGKVD-SIVWLKNGVIVQNSSRLYI----NDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKS---PPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIK--YDFVKSLIKN-GSLRIIGVQKEHSGVYFCVASSNQGE 9282
            K+   +G  I + C+V    P  I W+K+D +I  + ++  +F    N   LEI +      G Y               G+ +    +TV  PP  V  P++  + P    +L+  V  T+  + +KWFK     EL +     +       +  S+ L + +A  +D+G Y+C   ++ G   S+A  F+K    P   + +     +  +  S T  C+   TP    SW+L+G E+       IS ++ +  +  +IS  + ++SG  +C+A+N AG     I+L     P  +      E+    D + + C  TG P  ++TW  N   +       + + +    L I + + +  G++ C+ +N  GS   S  + +   P     + N       + T +  V G PP  + WL+    +    N+ I+     F++   +L I+ +       Y C A+N+ G V+      +  +  P     ++K V V       + C VV   P   + WLK+GK+I  S    M+ +N +    I++V  +D   YT   +N  G++  D  L V  Q  P       T +D   G  I ++C+  G      +W K G+ ++     R+V       L V ++  E    +TC  +N          ++VK PP        ++ I D        VE   I+  G P  KI+W+K+   LV  P   + + G  + L +Y  +  +TG Y C  TN+V SDS    + +   PK           K G+   L CKI G P     W      L   D  R  F  + + I  N+L      +E  G + C+  N  GS   S  VI+ E P    F        +  ++L C  SG P  ++ W +K K    ++  YK+  +N  T I +    +   GEY C A+NE G D    + TV      +K P +    +    ++ G        +    P  ++W K + ++ +     R     + +TL   + +  ++G Y C   N  G   N   ++++ P ++ + +    + + E   L   C   G P     WYKD   L S  + + +  N   +L I  V R D   Y   V N  G+      V+V    VPPS     ++ T   L G++  L C V+G     + W + +T          +       L   ++D S +  YTC+A N AGS        +  PP  V  +P+    +L    +  +      P   + WF+    +    R NI    T  +L L N   S  G Y C+VSN  G  + + T  + +     F  +   H V  G ++ L     G     + W+KDG  I       ++ ++    L + ++ + DAG+Y C  EN  G+     DV      TL+P    Y+      +E  VG +V L+C V+G P   ++W K    +   P YR     N   L    +  +D+G Y+C A+N+ G      +F       PPS  R   L +    VG  + L C  NGS    + +++DG    +     N   S+   +        L +     + SG Y C+ASN +G       +  R P   P FD   V   ++    ++   EC + G    P +ITW +    +  GG+  I+  G    + +  V + D+G+Y C A N+V K      + V   P+F K    +K+ A Q  ++Q+ C+ +G P   + W+R + E L +  +Y     +   +++ I     +D+  Y C A NG G       ++V  PP   ++   P      +   +   C +   + T P  ++W K+   +         + +   SL ILN ++ + G Y C+A N  G D+ +  +    PP+F    S   +T T+ +G +V  +   EG    S++W  KD      +  N  IS    + T+   + E    G + C  +N+ G       L V+ PA +      +   +G  F++ C   G P+   KW +DG+ +    ++     ++   L+I  A+  D G Y+    N + + + +V V +   I PP      K +   +G  V+L C V G+ P  + W+  GN  +S          +   L +  +    +G+Y CVA N AG  E    L V  +P  F  T  ++  VL  +      ++ G P   + W +    L   ++   + +  +      +++  + G  +C+  N AG    T  + V E    V      + + GS + +     G P  +V+W KD   +            ++ I  I +   ED   Y C+ E    +       +S+   P F+     ++ V+ E    + +C+    P+  I W      + S    K+   N   S+ +  V   + GEY C A N VG+V  S +L + A+  P     +  D  E++   +   C++ G     + W K+GV++++ + L      N   L I Q      G Y C ASN  G A     L++     PP F L P ++   LGE     C   G     I+W K+ + I+   ++  +L++N  +L ++ V K  +G Y C AS+  G+
Sbjct: 5610 KMDSIKGSFIDLECIVAGSHPISIQWFKDDQEI--SASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSAT-------NKAGHNQCSGHLTVKEPPYFVEKPQSQDVNPNTRVQLKALVGGTAP-MTIKWFKD--NKELHSGAARSVWK-----DDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKE---PPQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGL--ATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVEVVKYSDVE-LECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFIKKIENTTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDNVYIS-----FVDSVATLQIRSVDNGHSGRYTCQAKNESG-VERCYAFLL--VQEPAQIVEKAKSVDVTEKDPMTLEC-VVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPSFLVKPGRQQAIPD------STVEFKAIL-KGTPPFKIKWFKDDVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRMTFIDSVAVIQMNNL-----STEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIVETLKNAEVSLECELSGTPPFEVVW-YKDKRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSD--TCVCTV-----KLKEPPRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIVEKAGPMTVTVGETCTL--ECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTR-RLKNTGGVL-GASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPSFVK-EPEPLE-VLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAG--QASCTTRLFVKEPAAFLKRLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGR-----DVCGALVSTLEPP---YFVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQ--LKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGV---LLRDDENLQTSFVDNVAT------LKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPV--SIDVIAGESADFECHVTGAQ--PMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKV-AKQGESIQLECKISGSPEIKVSWFRNDSE-LHESWKY-NMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQK---PSPVGALKGSDVILQCEI---SGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLS---DTSTL-IGDAVELRAIVEGFQPISVVWL-KDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLEPARIIEKPEPMTVTTGNPFALECVVTGTPELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQ-EPPSFEQT-PDSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQ-DICEALVSVLEPPYFIEPLEHVEAVIGEP--ATLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKARKLPPFFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSVDLALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGK 8219          

HSP 3 Score: 555.829 bits (1431), Expect = 3.200e-157
Identity = 634/2617 (24.23%), Postives = 1054/2617 (40.28%), Query Frame = 1
Query: 1741 IEPFKDAE--LECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGREL--DPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTID--GNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDI---GFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRY---FINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNR--IMAKDNT--LVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPG-RVEIAGQKNILKVYGKNEDETGSYECKATNEV--SSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDK-NDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFID----NTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGST--LTLFEVKHLDSGIYKCLAIN-IGESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNG--GKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPS-INGISMRETPEFLKGSTTNLWCNVSGFPTPQIRW--TYMETIXXXXXXXXX-----XQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNIT--NRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTV---DIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFR---RVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEP--KVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGS--IRISPDGTRITVENVKQYDAGEYKCHAQNEVSKI--SLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVI---IPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPV-ILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKE-GGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQI--SSTILGEYQFLSEQ--GLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTET--ETTGVLNTVLQMQCKILEGIPQPVITWERNGITLS---KVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVE---LLPKVSLPISVT-GDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENE---INIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLNSNGRGSITLQS---------VRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGKVD-SIVWLKNGVIVQNSSRLYINDFN----LIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYK-NKKLIKYDFVKSLIKN--GSLRIIGVQKEHSGVYFCVASSNQGEVHSQPIYLTVQ 9315
            +E  K+AE  LEC +  T    V+ W+K   + +L+++K+++I     +   F + + IL+   SD GEY C A++E G    V  +K    P        ++ +  +            P    W     E+  +  + RI+ V +V  + ++ +  +P ++G+ IC+ KN  G+ E    L  +  P ++           G+  T+ C   G P+  + W  +G  +T            I +L I  +E+   G +     N+ G S  +  +D+      P     + N  G  G +  + C+V G  P  V W           I  G +Y   F +   +L +  L   D   Y C A N  G    S + R         +F +  + +     K V    V+   PP  ++W +  +E+   +R  I  +D    L +  +       YTC+  N  G A     L V+     +         + G  I+L+    G     + W+K G  +T      IV +     L + + T+  AG ++C   N+    V    VS   PP    E +   E    ++V L C + +G P   + WYK    L   P  R         L     N +++G Y CKA N +  +S    F+I     P +   ++  I    G  +TL C+++G   P +   ++  +L   R+   +  S +D    L I Q      G Y+C  +N  G+A  S  +   E PK   F D   V ID     +    C  +G    +I W    K I P          N   L + +      G+Y+C A N+ GKD  ++ ++V  P   +K    +        G +I   C ++ +P  ++ WF+N+ ++++S    ++ +S   S   LT+ E    DSG Y C A N +G++   T + + +P +  +  S   +   + +D+ + C   G P    +W KD  Q+ +  + +IT+     +L I  +  SD   Y C  TNE G D  +  V    PP  +  +S   T   L G    L   V GF    + W     E I        +     + L   + + S+  +Y C   N+AG   +    VLT       ++  +   +       L C     P  + +WFKDG  +  + + +IT  N+   L +  A+ SD G+Y   V N +G      +V   D ++PPS  F  K       LG ++ L C   G     + W +DG+ I      +   S++   L ++    +D G Y C+A N  G  + S  + V   P+ +   +    VE   G ++    ++ G P   + W K    +    S    +     +LE+  +Q  ++G YSC+  N  G       + +  P +  +   L ++ ++ G  + L     G+P  ++++ KD   +           S +  + ++++  +L +  +   D   Y C   N  G D+ E  V V  PP F    +EP   V     +  +L+C + G   P  +I+W +    L S  +  ++   +   + +  V   D GEY C A N V  +  S V  ++    P F+  +L   +       V   C   G  P  + WY+    +  D      F  +   + +QI          Y C+A+N  GT     ++ +    +PP      L P +  +      TF C V     T P+ I W K+N  I  G         N  +LT+L     ++G+YTC A N+AG+DS +  L V  PP+F       R    V+      ++C   GSP   ++W+  +  I           ++  VL + +++ E  G + C A N  GS      L+V  P + R     +    G    + C  +G P   + W +D + +    +Y   +++    + I +    D G Y C  TN +  D+    + + +PP+       I   VG++V L   +EG  P  + W+      +  S  I   Y   SE    L   RV   ++G Y C   NDAG QE   TL VL    I    E+   TTG   T   ++C +  G P+    W ++G  L+   K K  +    SGL I N +   D G  +   +N  G+D  T  + V    + P  +  +  T G  GSSV + CKV G P  +V+W  +G  + +  G +++    +    + +  L+  D+G+Y CI   + A +   S  L++   P FV KP   +V+  T   +F       P   + W F G    S+L    R +++L+          V +  +GEY CI  N  G    +  L + A  +     +D   E  K  IL     G    S+ W KNG+ V  S R  I        L I  +  +D G Y C   N++G+      +L+  PP F      +  ++G+   L C   G P   +SWYK + KL      K   +N   +L    V    SG Y C A ++ GEV S   +LTVQ
Sbjct: 6453 VETLKNAEVSLECELSGTPPFEVV-WYKD--KRQLRSSKKYKI-----ASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENV--ATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLE-PAVIVEKAGPMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFH-----EKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAG----SDECRAVLTVQEPPSFVKEPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPAAFLKRLSDH-SVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTE-LEPLEAAVGDSVSLQCQV-AGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNG-SAPIQVCWYRDGVL--LRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTARE-PKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKVAKQ---GESIQLECKISGSPEIKVSWFRNDSELHESW---KYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSP--VGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLSDTST---LIGDAVELRAIVEGFQPISVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAG--MRECSAVLTVLEPARIIEKPEPMTVTTGNPFALECVVTGTPELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPS--FIRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPSFE---QTPDSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKR--LADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQ---------SERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPPYF----IEPLEHVEAVIGEPATLQCKVDGT--PEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKARKLPPFFARKL-KDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANLQTSF--VHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFF---DLKPVSVDLALGESGTFKCHVTG---TAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGVQEPPRFIKKLEPSR---IVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKGADVHLECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISY---SENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIVEKPESIKVTTGDTCT---LECTVA-GTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIIN-VAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISS--GRKYQTTLTDNTCALTVNMLEESDSGDYTCIA-TNMAGSDECSAPLTVREPPSFVQKPDPMDVLTGTNV-TFTSIVKGTPPFSVSW-FKG---SSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEV-SASTFLTVQ 8978          

HSP 4 Score: 551.206 bits (1419), Expect = 7.423e-156
Identity = 673/2759 (24.39%), Postives = 1111/2759 (40.27%), Query Frame = 1
Query: 1381 AIFSRDPLPVSVSCPAKIQVKRGHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNVTLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXK---NASIEPFKDAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPT-DPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVR--IKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIIN--ETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFV----TNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFI----NQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEI----EYSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNI--LKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILES---PKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDG--STLTLFEVKHLDSGIYKCLAINIGESLNFTLVVLI-SPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKTLLIKKVRRS--DDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXXXXXXXXXQ-------LHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGE------LRLSCNSDAAPVATIEWFKDGELIRN--NLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTV---DIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRI---DFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGP----TLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGTRITVE--NVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTT---VQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATN--GGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPV-ILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVN-KEGGIFKCIARNEVGSIMKVYKLEVIMPA--LVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQG-LIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPT-ETETTGVLNTV---LQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIEDE--GSLTCIAKNVAGEDRLTFQITV---ELLPKVSLPIS-VTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNS-ENEINIYDLKPE--DTGNYICIG-ERSGAEASTASTYLSIFTR---PKFVYKPKLKNVVQETRWKSFRCE---ATSHPKPDIKWMFNGRAIESKLN-----SNGRGSITLQSVRSENAGEYKCIAKNRVGSV--EYSFMLEVIAKPRVRVYQSDDPSESIKRTI-LMCKVEGKVD-SIVWLKNGVIVQNSSRLYINDFN----LIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPV---------------FTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNK--KLIKYD--FVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQGEVHS 9291
            A+ +    P  V  P  ++V  G  +    +++   P+ +NW++   +++     N+ F+ T    LE++  +    G Y             V  N       T L         K   + S+EP K   LE + ++ +  + + W K    + +  +++  I   +K+       L IL++++ D G+Y C  E+E G       + T   P    + + +     DS++  C+   TP  T SW+    +L PT + R    N+V  + +  + V   DSGE  CKA+NS G    +   ++    LP   +  L       G   T+ C   G    ++ W  +G  +  D N+  +  + + TL I + + +  GQ+ C A+N  G++  S  L     P+   F      +ID   GE+    C V G  P R+ W +      N  I  G  Y I    N  +  I+K +   D   Y C A N  GK   S Q+ +     PK         V +      + C +  S P   +SW +N  E+    +Y+   +     L I    AED   Y C A N VG A     L V+  P+      + + A  G  ++LQC+  G P  ++ W K  + +      +I      + L + ++     G + C ATN+  +      V  K PP+  K+ +SD      + VEL  I+    P   + W K+   ++       I+   NI  L++       +G Y C+  N+         +T+L  P     K   +    G    L C + G P  + KW      L           + +    +   +M    +G+Y+ +  N  G +  +  V + +    P  I+        +  ++ L C  SG+    + W      I           EN  TL +        G Y+C+A N  G D+ ++++TV  P    +TP+       ++ G ++TF+ V+  TPP ++KWFK   ++   +P +   ISL+   + L LFEV+ L+SG Y CL  N   S + T  + +  P    K  +    ++   + + +     G P     W KD   +    R  IT   K+ +++ +  +  D + Y C + NEAG+D     V+V  PP    I   E  E + G    L C V G P  +I W Y E        +   Q       L    VD S +  Y+C A N  G+       V+    K   L P   R  LKD        +   C  + +    + W+KDG L+++  NL+ +  +    L +L   +S IG Y C  SN LG    +  +   +  +PP   F+ K  +  +ALG +    C   G    KI W KD   I      ++ L ++   LTV    + DAG+Y C A N  G+   S  + V   P     L+P   R  K +         EC + G P   + W KD   I     +R   + +   LE+  +   D+G Y+C A N  G       + +  PP I R +      +K G ++ L C   G+P  +++++KD   L          +  K +++       + + +    D G YQC A+N +G D    S+ ++ PP F     +  ++    +   L+ T+ G A+P + + ++  G  +    +I IS      T++   V+  +AG+Y C  +N+   +   F     L+P      +  K E+++ TT     + C   G P  +  W++  +E+ +D  +Y K       S ++I N+ P D+  Y+    N  G  +     ++S    P    R L   N        +   C VY    + P+ + W  E + I  G        +N  +LT+   +  +SG YTC A N+AG D  +  LTV  PP F        + + V  GT+V F    +G+P  S+ WF     + P D  N  + ++   L +  V+  + G + CI  NE G       L +  PA  + RL+   + +  G    +  T  G P   + W ++G  +    R    T  ++ ILEI  +  ED G+Y C   N   +DS S  ++I+ PP      + + V VG+   L C + GT    + WY  G+ ++  T   +  F +    L+ ++V  + SG Y C A N  G  E+  +  + VQ +   P+   +   V  TV   +   C I    P  V +W ++G  L    N  T+        N  K +    G  +C A N  G    + ++ +   +  P   + ++ V    G S    C V G     V+W KD + +++  G +++ +  EN  ++  LK +  D+G Y C      G ++ TA   L+I  R   P F  +  L   V+ET   SF+ E   A S P   + W  N   I+   N      N    + ++     +AG Y C   N  GS     S +++   KP V        + S    + L C V+G     I WLK G  ++ S R   +  +    L +      D+G Y C ASN AG    +  + +K  P                F   P +I               G PIP + W K K  +L +    F+        L I    K  SG+Y CVA +  GE+ S
Sbjct: 6812 AVLTVQEPPSFVKEPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTV-AELELFNIDISQSGEYTC----------VVSNNAGQASCTTRLFVKEPAAFLKRLSDHSVEPGKSIILE-STYTGTLPISVTWKKD--GFNITTSEKCNIVTTEKT-----CILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNV--ATLVFNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARL-TAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKD-----NKEIRPGGNYTITCVGNTPHLRILK-VGKGDSGQYTCQATNDVGKDMCSAQLSVK--EPPKFVKKLEASKVAKQGESIQLECKISGS-PEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQK-PSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKK-LSDTSTLIGDAVELRAIVEGFQPI-SVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVL-EPARIIEKPEPMTVTTGNPFALECVVTGTPELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSD--KGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPSFEQTPDSV----EVLPGMSLTFTSVIRGTPPFKVKWFKGSREL---VPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLAD--FSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPPYF--IEPLEHVEAVIGEPATLQCKVDGTPEIRISW-YKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVI----KARKLPPFFAR-KLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPF--FDLKPVSVDLALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGVQEPPRFIKKLEPS--RIVKQDEFTR----YECKIGGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPP-IFRKKPHPIETLK-GADVHLECELQGTPPFHVSWYKDKRELR---------SGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLSD--ISTVVGKEVQLQTTIEG-AEPISVVWFKDKGEIVRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAG-MQECFATLSVLEP----ATIVEKPESIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDN-KY-KISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGL--SGSSVVMECKVYG---SPPISVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQK----PDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEK--GKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYK-GDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVG--EVSASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAISGSEPISV-SWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSARLILTEGKNPPFFDIRLAPVDAVVGESADFECHVTGTQPIKVSWAKDSREIRS--GGKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQ--LNIKERLIPPSFTKR--LSETVEETEGNSFKLEGRVAGSQPI-TVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVIKEPKKPPVFDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKDKPAVAPATKKAAVDGRLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIES 9465          

HSP 5 Score: 533.102 bits (1372), Expect = 2.536e-150
Identity = 632/2677 (23.61%), Postives = 1094/2677 (40.87%), Query Frame = 1
Query: 1423 PAKIQVKRGHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNVTLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKNASIEPFKDAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSA---SESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGN---IIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRY-FINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEI----EYSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKN-ILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTI----TLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVF----APYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGST--LTLFEVKHLDSGIYKCLAIN-IGESL-NFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEIT--NGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETP-EFLKGSTTNLWCNVSGFPTPQIRWTYMETIX------XXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKD-GELIRN--NLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRRVLLSDDGYHLT-VNSTME--------TDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYK-VERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRS---LECTLMGVADPPAKITW--ERHGVPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSV--MQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQ------ITFHCSVYNYNMTKPV-ILWTKENSPILIGDTDYYLTF-NNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNK-EGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIE----VRERSGTSFSVLCTAEGYPKPVIKWTRDGKGI-----FRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLI---IDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIE--DEGSLTCIAKNVAGEDRLTFQITV-ELLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFR---FNSENEINIYDLKPEDTGNY-ICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKS-----FRCEATSHPKPDIKWMFNGRAIESKLN-----SNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRT--ILMCKVEGKVD-SIVWLKNG--VIVQNSSRLYIND--FNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKN 9159
            P + Q      ++   +++   P+ I W+K+D ++++     +  + +++  L +Y  +    G Y   +         V  ++   +++   PP     +  +  ++    + LEC + + S  + + WF++   +EL  + ++R+         F   + ++     S  D+G+++C A++  G +     +     P  S     +  + N  ++  C    TPP    W+ + R+L  +  +  I +    + I I NV   D GE  CKA+N  G D     +     P+ +S  L     + G+   ++ S  G     + W      V  +     I   E + TL   + E    G+++C   N  G       L +     I +    +  + GE  T+ C+V G P   V+W +    G  +  +   ++ F N+ +SL I  +  +D   Y    QN  GK   +  + +S  A P  +FT+  +          I+   V    P  ++W     +I    +Y         TL + ++ + D   YTC+A N  G+ +    L VQ  P  + + +  ++   G  +      +G P  K+ W +G R L       I      ++L +++I    +G +TC  +N+        ++ VK P    K  +SD+ +   +++ L    T   P   + W K+G  +        +  +K  IL++    + + G Y C+  NE   D     ++ L  P    +++  +    G+ ++L C++ G  TP    SW      L+  P   T    +   L+  ++     G YTC   N  G+A  S  V  ++  ++     + +  I+ T+    TLTC  +G+   ++ W     L+  +        +N  TL + +    H G+YSC A N  G    ++ +T      +P+ D+K  + ++     I G +  F C +    P  I W K+  +I    P   + I+  G+T  L + +V   DSG Y C A N +G+ + +  L V   P  + K  +  V    E   L   C   G+P  +  W++++S+L    +  ++  N    L I +    D   Y C   N  G+   +  + V  PP     + + +P   LKGS   L C +SG P  ++ W                    ++ LH +N++ S +  Y C ATNE GS           PP+ V    D    I    ELR +      P++ + W KD GE+IR   N R++  +    L L + + S+ G Y C + N  G+ + +  + ++ P  I    K     V  G    L CV  G P+   +W KDG      R L +D  +H+T +N            +D G Y    +N+ G+++ +  V V+    + P   R  K V   +G +VVLEC VSG    ++ W +DG  I   P  +     N   L +  ++ SD G Y+CVA N  G  E    +T+  PPS ++     E +   G  L       G+P   + +FK        +L P +  +      V++    L L+  +  +SG Y C  +N  G       + V+ P  F       ++  F+ +T S   LE T  G   PP  ++W  + + +  S   SI ++   T + +      D  +Y C  +NE  +      V V   P F   +    +EAV      + C+  G P   + WY++  ++ +     P + +   N+V  + I  +   D   Y+C A N  G +      +V++   I  R L P   R  +++       + F C +   N ++P+ + W K+   +L  D +   +F +N  +L IL       G+Y C A N  G  S +  L + S  + P  F +   ++ + LG S  F+C   G+    I W   +  I P       +  N   LT+  V K + G + C A N  G      +L V  P    + K+E    V++   T +   C   G P+  + W +D   I     FR  +  DS   +LE+ +   ED+G YTC   N     S S  + +  PP        I    G  V L C ++GT PF + WY       S     +Y+ +SE  L    I  V     G Y+C A ND G      ++ +   P+  +   ++ + V+   +Q+Q  I    P  V+ ++  G  + +  N + +    +      ++E  + G  TC  KN AG       ++V E    V  P S+    G + T+ C V G P+ +  W KDG+ L +   N+++   FN  + + I ++ P D+G Y   +    G ++ TAS  +S  T P     P     ++ET   S       C+    P   + W   G  I S        ++   ++T+  +   ++G+Y CIA N  GS E S  L V   P     Q  DP + +  T       V+G    S+ W K    ++  +   + + D    L +    +  +G Y CI SN AG+A    HL +K+P  F     + S   G+ LIL     G P  +++W KN
Sbjct: 6263 PGRQQAIPDSTVEFKAILKGTPPFKIKWFKDDVELVSGPKCFIGLEGSTSF-LNLYSVDASKTGQYTCHVTN------DVGSDSCTTMLLVTEPPKFVKKLEASKIVKAGDSSRLECKI-AGSPEIRVVWFRN--EHELPASDKYRM--------TFIDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIVETLKNAEVSLECELSGTPPFEVVWYKDKRQLR-SSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFVS-KLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIVEKAGPMTVTVGETCTLECKVAGTPELSVEWYKD---GKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDVSDRAVPP-SFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPSFVKEPEP-LEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPAAFLKR-LSDHSVEPGKSIILESTYTGTLPI-SVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFV-TELEPLEAAVGDSVSLQCQVAG--TPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTAS-SKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVSIDV-----IAGESADFECHVTGAQPMRITWSKDNKEIR---PGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKVAKQGESIQL--ECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVF---TQKPSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLSDTSTLIGDAVELR-AIVEGFQPISVV-WLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLEPARII--EKPEPMTVTTGNPFALECVVTGTPELSAKWFKDG------RELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVS-DRIVPPSFIRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPSFEQTPDSVEVL--PGMSLTFTSVIRGTPPFKVKWFKGSR-----ELVPGESCNISLEDFVTE----LELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVK-----RLADFSVETGSPIVLEATYTGT--PPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPPYFI--EPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTKLRS----APAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASS---AVLV---IKARKLPPFFARKLKDVHETLGFPVAFECRI---NGSEPLQVSWYKDGV-LLKDDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKL-ILSEHEVPPFFDLKPVSVDLALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGVQEPPRF-IKKLEPSRIVKQDEFTRYE--CKIGGSPEIKVLWYKDETEIQESSKFRM-SFVDS-VAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKGADVHLECELQGTPPFHVSWYKDKRELRSGK---KYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKL-SDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIVEKPESIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTS--DNKYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVP-----PSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPP--SFVQKPDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKN 8831          

HSP 6 Score: 531.946 bits (1369), Expect = 5.084e-150
Identity = 640/2720 (23.53%), Postives = 1103/2720 (40.55%), Query Frame = 1
Query: 1405 PVSVSCPAKIQVKRGHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNV-TLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKN-ASIEPFKDAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTL---PAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDG---NIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDI----GFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNSLI-IKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEI----EYSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKD--GDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAP---PQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPG---RVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLL-ITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQET-LIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAINIG--ESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEIT--NGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNV---FVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTY--METIXXXXXXXXXXQ----LHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDG-ELIR-NNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDG---SRIDFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPT-LDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGA---PPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRV---RTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRIS--PDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPV-ILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFY-KDMPISPYDMMNFVISNNAKVLTIPSVN-KEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVI---ISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQF-LSEQ--GLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITL---SKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPIS-VTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKP---EDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPK-LKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLN-----SNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAK--PRVRVYQSDDPSESIKRTILM-CKVEGKVD-SIVWLKNGVIVQNS----SRLYINDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLV---KSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLI----KYDFVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQGE 9282
            P  VS    + V  G   ++   ++   P  + W K   ++I  +++N++     NV TL+  +A   + G Y          Q+   G  R+ +   ++  P  +       ++   +   LEC V  T   + ++W+K      L ++++ +   Y K      S L ILS    D G Y    ++  G S     +        P+ +   K    +   S    C+   + P + +WF    ++       +  +D     ++++++   D G   C A N AG DE R  L+    P  +      E+ L G   T      G P  K+ W F G+   + G   NI   +T+  L++  I+ +  G++ CV +N+AG +  +  L +     F  R+ D         G++I +     G  P  V W +    G+NI  +        +   ++ I   +  D   Y C+ +N+ G+  +     +S +  P   F    + +  +    V +   V   P   +SW K   ++    EY         TLV   V   D   YTC A+N +GTA       +Q + +     +   D +   G  + L C+  G    ++ W + G  L  +  L+     + + L +      H+G ++C+A+N         +++ + P   P    + +S  ++ + E+ +  C +T   P  +I W K+ + +   PG    +   G    L++    + ++G Y C+ATN+V  D    Q+++   PK           K+GE + L CKI G  +P  K SW  +  +L  + +    S I+   LL I +  +E  G Y C+  N  G A  S  + +   P   Q          + + L C  SG P  ++ W+  +K +  N+  +K+  ++ +T L +    +   GEY C A NE G D  +  V    P   +K     ++    ++G  +    ++    P  + W K+  ++ +     R     + +TL L   +  +SG Y C   N       +  L VL    I+ K    +V   N      + C   G P     W+KD  +L +  +  IT  N   +L I     SD  +Y   V N  G+      V+V    VPPS   I   +    + G++  L C VSG     + W     E ++ P   S+ S+    L+   ++ S    YTC+A N AGS        +  PP      PD    +L    L  +      P   ++WFK   EL+   +  +++ +  T+L L   Q  + G Y CLV+N  G    + T  + +     F  +     V  G  + L     G P   + W KD    S+ +   + +++    L +  +   D  +Y C+ EN  GQ      V V   P  ++P       VE  +G    L+C V G P   I+W K+   +   P+Y+ +   N   L I  +  SD G YSC A N+ G +     + I A   PP   R   L +    +G  +   C  NGS    ++++KDG  L         DA+ +   +       L +    ++  G Y C+ASN +G       + +     PP FD   V   V+    ++ + +C + G A  P KITW +    +  GG+ +++   +   +TV  V + DAG+Y C+A N   K S    + V   PRF K    ++I   Q+   +  C+  G P   +LWY+ E EI  +  ++ +   +   +V+++ N+  +D+  Y C A N  G+      + V  PP   K+   P      +   +   C +     T P  + W K+   +  G     ++ N   S+ ILN  + + G Y C+A N  G D+    + + +PP+F    S     I+  +G  V  Q   EG+   S++WF  K   +   D +    S N   L    V     G + C  +N+ G       L V+ PA +      ++  +G + ++ CT  G P+   KW +DGK +    +Y     ++   L+I +    D+G Y+    N + +DS +  + +     PP      K      G  V++ C V G+ P  + W+  GN +ISS    +YQ  L++    L ++ + +  SG Y C+A N AG  E    L V   P   +  + +   VL         I++G P   ++W +    L    +       + + L +F+ +     G  TCI  N AG+   T  + ++   K    ++  + ++G  + +     G P  +VTWKK+G  +      R    +  +  I ++     ED G Y C  E +  + S ++  L I   P FV + + +K  V ++   S +C+    P+  + W      +           N   ++    V   ++GEY C A+N VG V  S  L V  +  P     Q  D  E++   ++  C + G    S+ W K+G  +++S    +    N   L I +      G Y C A+N  G A     L++   K+PP F +    + A +GE     C   G     +SW K+ + I    KY  +  L  +  L ++ V K  SG Y C A +  G+
Sbjct: 6537 PRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIR-ESENIRITFVENVATLQFAKAEPANAGKYIC--------QIKNDGGMRENMATLMVLEPAVIVEKAGPMTVTVGETCTLECKVAGTP-ELSVEWYKD--GKLLTSSQKHKFSFYNKI-----SSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSD-NVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPSFVKEPEPLEV-LPGKNVTFTSVIRGTPPFKVNW-FRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPAAFLKRLSDHSVEP----GKSIILESTYTGTLPISVTWKKD---GFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGR--DVCGALVSTLEPP--YFVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVS-IDVIAGESADFECHVTGAQPM-RITWSKDNKEIR--PGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKVAKQGESIQLECKISG--SPEIKVSWFRNDSELHES-WKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVR-NSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVK----KLSDTSTLIGDAVELRAIVEGFQPISVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLEPARIIEKPEPMTVTTGN---PFALECVVTGTPELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSF--IRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPSF-EQTPDSVE-VLPGMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAG--SASCTTHLFVKEPATFVKRLADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPPYFIEP----LEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKARKLPPFFARK--LKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLL-------KDDANLQTSFV--HNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPV--SVDLALGESGTFKCHVTGTA--PIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGVQEPPRFIKKLEPSRI-VKQDEFTRYECKIGGSPEIKVLWYKDETEI-QESSKF-RMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKK---PHPIETLKGADVHLECELQG---TPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLS----DISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIVEKPESIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGN-EISSG--RKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQ--KPDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFD-VDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNG--INVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQIL-ILEPPYFVKQLEPVKVSVGDS--ASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAISGSEPISVSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSARLILTEGKNPPFFDIRLAPVDAVVGESADFECHVTGTQPIKVSWAKDSREIRSGGKYQ-ISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGK 9160          

HSP 7 Score: 516.538 bits (1329), Expect = 2.356e-145
Identity = 662/2740 (24.16%), Postives = 1098/2740 (40.07%), Query Frame = 1
Query: 1447 GHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNVTLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKNASIEPFKDAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSK----LIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTL---PAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGN--IIINETIGTLDINRIEKNMKGQWVCVATNSAGSS--RKSFN-LDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRY---FINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQES----VQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCL--VVESKPPAVISWLKNGKEIEYSNRIM----AKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATN----DHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGR---VEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKM-VGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTP---NKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGST--LTLFEVKHLDSGIYKCLAINIG--ESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEI--TNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLK----------GSTTNLWCNVSGFPTPQIRWTYME----TIXXXXXXXXXXQLHFMNVDKSHITR---YTCIATNEAGSARKLFDPVLTYPPKIV-SLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGT--QLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRR---VLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTL--DPGG--KRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEI-----FMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEP-KVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGTR--ITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILA-DKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPV-ILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFY-KDMPISPYDMMNFVISNNAKVLTIPSVN-KEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGI-------FRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIIS----PPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQG---LIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKN---YYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVE----LLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLG-NRFRFNSENEINIYDLKPEDTGNYIC-IGERSGAEASTASTYLSIFTRPKFVYKPK-LKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLN---------SNGRGSITLQSVRSENAGEYKCIAKNRVG--SVEYSFMLEVIAKPRVRVYQSDDPSESIKRTI-LMCKVEGKVD-SIVWLKNGVIVQNSSRLYI----NDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSP---PVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIK--YDFVKSLIKNG-SLRIIGVQKEHSGVYFCVASSNQGE 9282
            G   +++C ++      + W+KN+ ++  + T  + F   S   L+I        G Y+ E V  +       G+      + +  PP  +   + A I    +A L+C V S +    + WFK   + +++++K++R+         FS K    L I S + +D GEY CV  +E G     G + TH L   P       ++  +   ++T       + P + +W + G+E+   D +I +      + + I +V+    G+  C A+N AG      +L      KI+      ++   GD  T+  +  G P+ K  W  +G P+       I     +  L     E +  GQ+    +N  GSS    +F  LD    P     + N+D        + C++ G  P RV W +         IA  DRY   F+    SL I  + M D   + C A N  G    S    VQ   S +  P      SK V+  S      VCL    +   P  I W K  KE+           A +++L +  VK  D   YTC   N  G  +    L V+     +   +     K GD   L C+  G P  KI W    R +      R+      + L +  +  E +G + C A N    DH + +    V VK  P  +KE     E+  + +V L   + +G P  +I W+K+   L    GR     I      L++      + G Y+C+ TNEV S     ++T L  P +   K+    +  G        + G    T  W   S  +    N      + +    L ++ +  +  G Y C   N  G  + S  + + E   I +      V   +  TL    SG      KW FK          YK+ V +    L +        GEY+   +N+ G+    + + V    +D+  P    K +     I G  I   C++  + P  I+WFK++ +I  S   +++K S   +T  L + +++  DSG Y C A N       +  L V   P  + K  S+   ++N  T + +     G       W+KDN +L SG    +   +   +L +   + +D   Y C ++N+ G         +FV         +E P+F+K          G +T   C ++G P  ++ W Y++    T      +S    L    +  + +     Y C A N+AG+A    +  +  PP  +  L P +   ++K  ++ L C     P   + W K+   IR++ +  +T+R +   LH+     SD G Y+C+VSN+ G    +  V +  PPS  F  K       L  +        G P   I W KD   +D      +   D    L + S     +GRY C A+N  G       V+  Y   L  +P    ++   V+ T    + LEC+V+G P   + WLKDG  I     +      N     I ++   D+G+Y+   +N FG          +D  I  PPS  +     + ++  G  + + C  +GS   +  +FKDG  +           S K RL+  +    L + + +  D+  Y C  SN  G D     + V+ PP F    V+P +     + T   +  L G   PP KI W +  V L SG    I  +G+   + + +V     G+Y CH  N+V   S    + V   P+F K    +KI    +++ ++ C+  G P   ++W+R E E+ A DK R    D +   +V+Q+ N+  +D+  + C A N  G+     ++ V  PP  +  S  P    +K N +++  C +   + T P  ++W K+   +         + N   S+ ILN  + + G Y C+A+N  G D+    + +  PP+F +  +    ++TV  G     Q   EG+    + W   K+  I   + +      N   L          G + C  +N+ G    +  L V+ PA++      +    G + ++ C   G P+  ++W +DGK +       F +  K  S    L I   + +D G YT    N + + S +  VV +S    PP      K+    +G   +L C V G+ P  + W+      +S     +YQ         L ++ +     G Y CVA N AG  E R  L V   P   +  E E   VL         ++ G P   + W R    L K      Y+  T + L +FN + I   G  TC+  N AG+   T ++ V+     L ++S     + + G S+ +     G    +VTWKKDG ++      N         + I +    D G Y C I   +G +   A   +S    P FV + + L+  V ++   S +C+    P+  + W + G   ++KL          +N   ++    V   ++GEY C A+N +G  S +  F ++    P     Q  D  +++   + L C++ G     + W ++GV++++   L      N   L I Q     +G Y C ASN  G A     L  + P   P F + P +I    GE     C   G     I+W K+ K I+   ++  + + N   LRI+ V K  SG Y C A+++ G+
Sbjct: 4679 GESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYF-VNSEAILDITDVKVEDSGSYSCEAVNDV-------GSDSCSTEIVIKEPPSFIKTLEPADIVRGTNALLQCEV-SGTGPFEISWFKD--KKQIRSSKKYRL---------FSQKSLVCLEIFSFNSADVGEYECVVANEVG---KCGCMATHLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTW-MKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKEPAKIIERAELIQV-TAGDPATLEYTVAGTPELKPKWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVDSVVNGTCRLDCKIAGSLPMRVSWFKD-----GKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPSFVTKP-----GSKDVLPGSA-----VCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKEPATFVEKLEPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSI----VIVKESPYFTKE-FKPIEVLKEYDVMLLAEV-AGTPPFEITWFKDNTILRS--GRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVT-LREPPSFIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEITEDDNIRMTFENNV--ASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATITEEAVSIDVTQGDPATLQVKFSGTKEITAKW-FKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINV----LDLIIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISAS---EKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEKPQSQ---DVNPNTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVG--TATSKATLFV---------KEPPQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSW-YLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVE---VVKYSDVELECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPS--FIKKIENTTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESG-------VERCYAFLLVQEPAQIVEKAKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNI--PPSFTKKLTKMDKVL--GSSIHMECKVSGSLPISAQWFKDGKEI---------STSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPSF---LVKPGRQQAIPDSTVEFKAILKGT--PPFKIKWFKDDVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPKFVKKLEASKIVKAGDSS-RLECKIAGSPEIRVVWFRNEHELPASDKYRMTFIDSV---AVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPP--VFSSFPPIVETLK-NAEVSLECEL---SGTPPFEVVWYKDKRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFVSKLN----SLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIVEKAGPMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISS----LRILSVERQDAGTYTFQVQNNVGKSSCTA-VVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSG---AKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPSFVK--EPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELFN-IDISQSGEYTCVVSNNAGQASCTTRLFVKEPAAFLKRLS---DHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGA--LVSTLEPPYFVTELEPLEAAVGDS--VSLQCQVAGTPEITVSW-YKG---DTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGK 7278          

HSP 8 Score: 514.612 bits (1324), Expect = 9.470e-145
Identity = 622/2612 (23.81%), Postives = 1040/2612 (39.82%), Query Frame = 1
Query: 1903 LIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKE-ISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDP-RISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEI--PLEGDQQTVR------CSATGVPQPKITWEFNGSPVTIDG--NIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQ---DNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKK----VIVCLVVESKPPAVISWLKNGKEIEYS--NRIMAKDNTLVIK--TVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISK--EGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVY--GKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDL-QRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGG--SAKMSYDVIILESP-----KIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFA-PYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKC-LAINIGESLN-FTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQL--ISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRW------TYMETIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELI--RNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRRVL---LSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLP-------CPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWER--HGVPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGN--SVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVIL-WTKENSPILIGDTDYYLTF-NNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRET---ITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKE-GGIFKCIARNEVGSIMKVYKLEV----IMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNG--ITLSKVKNYYTTTDSGLF-IFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISVTGDE------GSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSE------NEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWK-SFRCEATSHPKPDIKWMFNG---RAIESKLNSNGRGSITLQSVRSE--NAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESI---KRTILMCKVEG-KVDSIVWLKNGVIVQNSSRLYI----NDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFT-LLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIK--YDFVKSLIKNGSLRIIG-VQKEHSGVYFCVASSNQGEVHSQPIYLTVQIPGGWSAWQEWSKCSLSCGKGFISRKRLCNNPP 9414
            LII     S  G+Y C+AE+E G   +VG +     PA  ++  E I     D  T       TP     W+ +GR L  +   RIS  N+V  +Q+K  + +  DSG+   +  N  G        +      +L  D+A     PL      V       C   G    +++W  +G  +       I   E   +L+I R++ N  G + C ATNS GS   S  L +   P       + D   G  + ++   +G  P  ++W +G     N  +  G   +I +   ++SL +  +   D   Y C   N  G V+ S  + +   A      T  +++     LKK     + C V  + PP  I+W  N +EI+ S  +R+   ++T V++   V  ED   Y C A+N+ G+      + V+  P    +FK     K+ DV++L  +  G P  +I W K    L      +  I      L +       AG + C  TN+  + +   +V+++ PP   K  E  S    G+         +    P   + W K+   + E    + +  + N+  +Y  G      G Y C+A N+ +   R   +  +  P     + + I   +G+  TL  K  G    T KW      L L  +    +T++    + L I     +  G YT +  N  G  S K   +V+ L  P     K+ + +     FID    L CI +G+    I+W    + I  +        +N   L + +      G Y+C A N+ G +Q +  +TV   PY   K  ++++  N       +    ++  T P  IKWFK+  +++    +  +K     ++L LF  K  DSG Y C L+ ++G + +  TL V   P  + K S   V+   + T     C   G P  R  WY D +++  I    +   +G  T  I   R  +   Y C   N+AG    + ++ V  PP+   I   +  E +K S   L C V+G P  ++ W             +     +   LH    D S    Y CI +NE GS        L  PP  +    +    +LK      S  + + P++ I W KD +++   +N+ ++  +    L + +      G Y C   N+ G+++    + +  P  I    KA +  V     + L CV  G P+ K++W KDG +I   R       ++     + S M+ D+G+Y    EN  G +     ++V          K+  K+++ +G ++ +EC VSG    +  W KDG  I+    YR      S  LE+  ++  D   Y+C   N  G       +T+  PPS         +++K G +  +P           G+P   I +FKD   L          +  K  + +      L LYS   + +G Y C+ +N +G D     + V  PP+F       K+    + +R LEC + G   P  ++ W R  H +P S    +        I + N+   D+G++ C AQN     S    V V   P F  +     +E ++N  V + CE +G PP  ++WY+ ++++ + K    K+ I   N  + + I N+   D   Y C A N  G+      + +  PP+ + +     +  V          S+      +P+ + W KE   ++    +  +TF  N  +L     +   +G+Y C+ KN  G   +   L V  P       ++  E    +TV +G +   +C   G+P  S+ W+     ++      F   N    L I SV ++  G +    +N VG       ++V    + P+  R  K       G S  + C   G     + W  +   I    +Y T        L++      D G YTC   N    D     + +  PP      + + V  G+ V    ++ GT PF+++W+      +       Y   +   L +  +    SG Y CV +N+AG       L  + +P  F    ++ +      + ++      +P  V TW+++G  IT S+  N  TT  + +  I NS K  D G  +C  +N AG D     +   L+  +  P  VT  E      G SV++ C+V G P+ TV+W K    L+     R  F +       N++NI      D+G Y C  E S   AS+ + +     +    +  +LK++ Q      +  C         + W  +G   R  E+   S      TL+ ++++  ++G+Y C A N +G+   S  L      +   +     S  +   +     C V G +   I W K+   ++      I    N  +L I +    D+G Y C A+N  G+      L VK PP F   L  +  A  GE + L C   G P   +SW++N   +   + +  S I + +L  I     E SG Y C A +  G+  S    LTV+ P  ++  Q+ S      G   I +  +   PP
Sbjct: 4908 LIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKE-PAKIIERAELIQVTAGDPATLEYTVAGTPELKPKWYKDGRPLVASKKYRISFKNNV--AQLKFYSAELHDSGQYTFEISNEVGSSSCETTFT------VLDRDIAPFFTKPLRNVDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKG-----NKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKEPA------TFVEKLEPSQLLKKGDATQLACKVTGT-PPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPYFTKEFKPIEVLKEYDVMLL-AEVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPPSFIKKIESTSSLRGGT---AAFQATLKGSLPI-TVTWLKDSDEITE-DDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKND-AGIQRCSALLSVKEPATITEEAVSIDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISVTDT---VSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKMDSIKGSFID----LECIVAGSHPISIQWFKDDQEISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEKPQSQDVNPN-----TRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDT-STSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKEPPQFIKKPSPVLVLRNGQSTTF--ECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTF--IRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFIK-KIENTTTVLKSSATFQSTVAGSPPIS-ITWLKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQIV--EKAKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPS---------FLVKPGRQQAIPDSTVEFKAILKGTPPFKIKWFKDDVEL---------VSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPKFVKKLEASKIVKAGDSSR-LECKIAG--SPEIRVVWFRNEHELPASDKYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVF--SSFPPIVETLKNAEVSLECELSGTPPFEVVWYKDKRQLRSSK----KYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFVSKL---NSLTVVAGEPAELQASIEG---AQPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEP-------AVIVEKAGPMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTRRLK-NTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPSFVKEPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRL-FVKEPAAFLKRLSDHSVEPGKSIILESTYTGTLPISV-TWKKDGFNITTSEKCNIVTTEKTCILEILNSTK-RDAGQYSCEIENEAGRD-----VCGALVSTLEPPYFVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNI-----NDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDA-SCSTALTVKAPPVFT--QKPSPVGALKGSDVILQCEISGTPP 7413          

HSP 9 Score: 512.686 bits (1319), Expect = 3.559e-144
Identity = 625/2575 (24.27%), Postives = 1034/2575 (40.16%), Query Frame = 1
Query: 1921 SESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFID---NDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKL--------SYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIIN--ETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRY---FINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRI----MAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKN--ILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQ--GIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTC-----IASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENE-GGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAINI--GESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQL--ISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXXXXXXXX------XQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIR--NNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDF---RRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITW----------ERHGVPLSSG-GSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSV--MQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPV-ILWTKENSPILIGDTDYYLTF-NNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKE-GGIFKCIARNEVGSIMKVYKLEV----IMPA----LVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGI---FRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLP-------CIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQG----LIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTT-TDSGLFI-FNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKV-SLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSEN---EINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLNSNGRGSI-----TLQSVRSE--NAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRT-ILMCKVEGKVD-SIVWLKNGVIVQNSSRLYINDFNLI----INQAKSKDTGIYQCIASNSAGEAQGQVHLLVKS---PPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNK-KLIKYDFVKSLIKNG--SLRIIGVQKEHSGVYFCVASSNQGEVHSQPIYLTVQIP 9321
            +E   GEYVC A ++ G + A     T    AA V +++I  ++         +C   S P   F WF  GRE+  +D + SI +    S ++I   +  D GE  CKA N  G       L        +++S PK L+          G      C+ TG P  +  W+ +G+ ++   N  I+  E    L+++ +    +G + C A+N  G+      L I   P     +  +  +  + + + CQV+      V W +    G  +P   G  Y   F ++  +L I    ++D   Y+C A N+ G    S  + +     P          ++       + C  ++  P   ++W KN KE+  SN +    +  +  L I  VK ED   Y+C A N VG+     E+ ++  P  I   +   D   G   +LQC+  G    +I W K  + +      R+        L ++S      G + C   N+           +K PP   K+ + D      + V L   +    P   + W K GQ ++   G+++++      +L +        G Y C A NE  S +   ++ I+  P     +   I    G+  TL   + G P    KW +K     +    + I+      N   +    +EL   G YT + +N  GS+       +L+   I  F  K +  +D+ +  TC     IA   P  ++ W    K I  +        E   +L + R      G ++C A N  G KD   +++    P    K  +K+     ++ G  +        + P  I+WFK   ++         K +L+ S+L L+ VK  DSG Y C   N+  G   +  L V    T + K     ++   + T L   C   G P  +  W+ ++ ++   S  R+        L +  V   D   Y C   NEAG D  +  V V   P        +  E LK     L   V+G P  +I W    TI                 L  +    +    Y C  TNE GS+       L  PP  +          L+ G          +   T+ W KD + I   +N+R+   N    L+L   +    G Y C   N  G+ + +  + +  P +I    +A +  V  G    L     G  +   +W KDG  +      ++ ++D    L + ST + D+G Y    +N  G++     + V          K+  K++   G  + LEC+V+G    +I W KD   I+    Y++    N+  LEI  ++ +D+G Y+C A N  G  +    +T+  PP         +  +     ++L     G+    I +FKD   L          +   + +        L L++AK TDSG Y C  SN +G    + ++ V+ PP+F      P +     Q+ + EC + G   P  +++W          ++HG+    G  + +IS  G R  VEN     +G Y C A+N+    S    ++V   P F +      +E V+ + V++ CE TG PP  + W +  +EI + K    K+ +    SV  + IT   P D   Y C  +N GG+      +++  PP  +K+    EN         TF  +V     + P+ I W K++  IL  D + Y++F ++  +L I +  +  SGRYTC+AKN +G +     L V  P +         +++ V     +  +C   G+P   + W      I P    +    NN     I SV K+  G +     N+ GS      L V    I P+    L ++DK+      G+S  + C   G      +W +DGK I    +Y      R+  LE+ + + EDT  YTC  +N    D+ S  + +  PP       S +V+ G Q  +P        I++GT PF+I W+      +S    G   F+  +G    L +  V    +G Y C   ND G       L V   PK  +  E           +++CKI  G P+  + W RN   L     Y  T  DS   I  N+L  ED G   C A+N AG    + ++ V+  P   S P  V   + + V++ C++ G P   V W KD + L++    +++  S+N    I+I ++   D G Y C  +      +   T + +   P+FV K     VV     +       + P   ++W+     +  + + N R +      TLQ  ++E  NAG+Y C  KN  G  E    L V+ +P V V ++   + ++  T  L CKV G  + S+ W K+G ++ +S +   + +N I    I   + +D G Y     N+ G++     + V     PP FT    N    LG   IL C   G    +++W+  K K++     ++   +   +L++  +     G Y CVA++  G    + + LTVQ P
Sbjct: 4351 TEDHQGEYVCEALNDSGKT-ATSAKLTVVKRAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESD-KCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRPKSLTT-------FVGKAAKFICTVTGTPVIETIWQKDGAALSPSPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHFIKELEPVQSAINKKVHLECQVDEDRKVTVTWSK---DGQKLP--PGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVR--EPPSFVKKVDPSYLMLPGESARLHCK-LKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEP-ADIVRGTNALLQCEVSGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMATHLLKEPPTFVKK-VDDLIALGGQTVTLQAAVRGSEPI-SVTWMK-GQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGEL-IVKEPAKIIERAELIQVTAGDPATLEYTVAGTPELKPKW-YKDGRPLVASKKYRIS---FKNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDR-DIAPFFTKPLRNVDSVVNGTCRLDCKIAGSLPM-RVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPSFVTKPGSKD-----VLPGSAVCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKEALE-SSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKEPATFVEKLEPSQLLKKGDATQL--ACKVTGTPPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPYFT--KEFKPIEVLKEYDVMLLAEVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPPSFIKKIESTSS--LRGGTAAFQATLKGSLPITVTWLKDSDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATI--TEEAVSIDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEKPQSQD--VNPNTRVQLKALVGGTAPMTIKWFKDNKEL---------HSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKEPPQF-IKKPSPVLVLRNGQSTTFECQITGT--PKIRVSWYLDGNEITAIQKHGISFIDGLATFQIS--GAR--VEN-----SGTYVCEARNDAGTASCSIELKVKEPPTFIRE--LKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSK----KYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFIKKI---ENTTTVLKSSATFQSTVAG---SPPISITWLKDDQ-ILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQIVEK----AKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKLTKMDKV-----LGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPP-------SFLVKPGRQQAIPDSTVEFKAILKGTPPFKIKWFKDDVELVS----GPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPKFVKKLEASKIVKAGDSSRLECKIA-GSPEIRVVWFRNEHELPASDKYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIVETLKNAEVSLECELSGTPPFEVVWYKDKRQLRS--SKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCT-VKLKEPPRFVSKLNSLTVVAGEPAELQASIEGAQPI-FVQWLKEKEEV-IRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVL-EPAVIVEKAGPMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAV-LTVQEP 6819          

HSP 10 Score: 506.138 bits (1302), Expect = 3.601e-142
Identity = 619/2592 (23.88%), Postives = 1029/2592 (39.70%), Query Frame = 1
Query: 1741 IEPFKDA-----ELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGV--SEAVGFIKTHTLPAASVDE-KEISFIDNDSITASCRALSTPPPTFSWFLNGREL-DPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLE---GDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIINETIGT--LDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGS----YGENITIRCQVEGQPPPRVKWLRGIAG-----GYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNR--IMAK--DNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIII---GDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKG-GRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPL-VEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEV--SSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFK--KKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISL--DGSTLTLFEVKHLDSGIYKCLAIN-IGESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGG--RVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLK----------GSTTNLWCNVSGFPTPQIRWTYMETIXXXXXXXXXXQ-------LHFMNVDKSHITRYTCIATNEAGSARKLFDPVLT---YPP----KIVSLDPDKKRWILKDGEL-RLSCNSDAAPVATIEWFKDGELIR--NNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLF-CVSEGRPKPKIEWRKDGSRIDFR---RVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRT-----DSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRIS----PDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEV---FLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPV-ILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKE-GGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFR----YGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIIS---PPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGY--QEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPV-ITWERNGITLSKVKNYYTTTDSGLFIFNSLKIE--DEGSLTCIAKNVAGEDRLTFQITVE--LLPKV---SLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRF-NSENEINIYDLKPEDTGNYIC-IGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIE-----SKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRV-----------RVYQSDDPSESIK-----RTILMCKVEGK-VDSIVWLKNG-VIVQNSSRLYI----NDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAA 9120
            +EP + A      L+C V  T   + + W+K        +TK      Y+       + L+    + +D+GEY C AE+  G   S+ V  I+   LP +   + K+I       +T +CR   + P    W+ +G  L D  + + S V++V  + +KI       SG+  C A N  G      +L+     K    D+ K + ++   G+     C  TG    +ITW  +   +   GN  I     T  L I ++ K   GQ+ C ATN  G    S  L +   P+   FV  ++ S     GE+I + C++ G P  +V W R  +       YN+        FIN    L I   S ED   YIC+A N  G    S  + +    AP + FTQ    V       VI+   +   PP  + W+K+ K++  S +  I +K  D +L I  ++A D   Y C A N+VG+      +  +  P  +    D  T I    GD + L+   +G     + W K  G  +      RI    + + L + S    ++G + C   ND         ++V  P +I  E      + +     L C++T G P    +W+K+G+ L  +    +    +   LK+      + G Y  +  N V  S+ +    ++  + P +   K+  +    G  + L C++ G    +  W    +  ++   P   ++   +   L ++ +     GIYTC   NV GS + S  + + E P   Q  D   V    ++T T +  G P  K+KW FK  ++L+P  +    +     E  + E    +  G+YSCL  N+ G     + + V  P     T  K +    +  G  I        TPP  + W K+E  I +S   +R  I++    + L + E    D   Y CL  N  G+ +   LV ++ P    +        I E   L   C  +G P  R  WYK++++L S    +++  N   +L+I KV  SD   Y C   N  G              ++  I  R+ P F            G      C ++G    Q+ W Y + +      +  +        L  +  D+SHI +Y C A+N  G+A      +L+    PP    K VS+D       L  GE     C+        I W KD   IR   N ++ +      L +L   + D G Y C  SN  G D  +  + +  PP  +F  K    ++        + C   G P+ K+ W KD + I      R+   D    L +++    D+G Y C A N  G    S  ++V   P      K+ + +E   G  V LEC + G P   ++W KD   +     Y+         + I+ + A+D G Y C A N  G       + + APP   +   L++    VG E++L     G+   ++ +FKD    ++   S N   SY + +   Q  ++    + K T     D+G+ +C A+      V+E +  V  P     +         T  T +LECT+ G   P     W + G  L+S    +IS      G +I   NV   D+G Y    QN V K S   +++V    + P F +    T    +  ++V M C+  G PP ++ W+ +  EI + + +Y +  +      + +  ++  D+  Y C ATN  G+ E    ++V  PP  +++   P+   V     +TF   V     T P  + W K +S ++ GD       ++   L + +  + +SG YTC   N AG+ S T  L + +P KF    + +    +++ G  +  +    G+P  S+ W    + ++P    N   +  + +L IPS   E  G + C   N  G      ++ ++ P         V+   G S S+ C   G P+  + W + G    R    Y     +    L        D+G Y C   N + + S S  + +     PP      + +   VG  V+  C + G+ P  + WY  G     S  +      +   L I +  +  +G Y C A N  G      R+ L     P  F         V+      +C +     QP+ ++W ++   +     Y  +          LK++  D G  TC A N  G+D  T Q+ ++  L+P      L  +V   EG+S  +  +V G    TV W K+   +Q        F N+   + +      D G Y C +   +G+   T+S  +    +P    +      V E  +    C         I+W+  GR I+     S   ++G   + L+ V   ++G+Y C A N  GS      + +  KP V           R++   +P +SI+         + KV G  + ++ W K     +    R++I    ++  L I      D+G+Y+C+A N  GE +  V+L V        + G++ A L +  IL   A
Sbjct: 7012 LEPLEAAVGDSVSLQCQVAGTP-EITVSWYKG-------DTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNV--ATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDI-KPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPK---FVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNM-------SFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVK---APPV-FTQKPSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLSDTSTLI----GDAVELRAIVEGFQPISVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLEPARII-EKPEPMTVTTGNPFALECVVT-GTPELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGN--EIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPSFEQTPDSVEVLPGMSLTFTSVIRGTPPFKVKW-FKGSRELVPGESCNISLEDFVTELELFE-VQPLESGDYSCLVTNDAGSASCTTHLFVKEP----ATFVKRLADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQS---ERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPPYFIEPLEHVEAVIGEPATL--QCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVG---------AVASSAVLVIKARKLPPFFARKLKDVHETLGFPVAFECRINGSEPLQVSW-YKDGVLLKDDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSVD-------LALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGVQEPP--RFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFR---KKPHPIETLKGADVHLECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKK--LSDISTVVGKEVQLQTTIEGAEPISVVWFKDKG--EIVRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFAT----LSVLEPATIVEKPESIKVT---------TGDTCTLECTVAGT--PELSTKWFKDGKELTSDNKYKISFFNKVSGLKII--NVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETN--GLSGSSVVMECKVYGSPPISVSWFHEGNEISSGR-KY-QTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQK---PDPMDVLTGTNVTFTSIVKG---TPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDY----SIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYK-GDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAISGSEPISVSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSARLILTEGKNPPFFDIRLAPVDAVVGESADFECHVTGT--QPIKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTKRLSETVEETEGNSFKLEGRVAGSQPITVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVIKEPKKPPVFDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKDKPAVAPATKKAAVDGRLFFVSEP-QSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDERKKQEKIEGDLRAMLKKTPILKKGA 9498          

HSP 11 Score: 491.886 bits (1265), Expect = 6.846e-138
Identity = 624/2607 (23.94%), Postives = 1030/2607 (39.51%), Query Frame = 1
Query: 1753 KDAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILS---ASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPA--ASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDP-RISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPV--TIDGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRG---IAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVV-ESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSN--RIMAKDNTLVIKTVKAE--DEAIYTCIAKNQVGTAKFDIE---LDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQ-ISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQ--KNILKVYGKNEDETGSYECKATNEVS----SDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYK-MVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAP--YIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLF----EVKHLDSGIYKCLAIN-IGESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGG--RVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVF---VPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXXXXXXXXXQLH----FMNVDKSHIT---RYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNI--TNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLF-CVSEGRPKPKIEWRKDGSRIDF---RRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHG---VPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVF---LKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKE-GGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQG-LIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLS---KVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVE---LLPKVSLPISVTGDE-GSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFN-SEN--EINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLNSNGRGSITLQSVRSE---------NAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGKVD-SIVWLKNGVIVQNSSRLYINDFN----LIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYK-NKKLIKYDFVKSLIKN--GSLRIIGVQKEHSGVYFCVASSNQGEVHSQPIY 9303
            K   LEC V      V + W K     +L   K ++I         F  K+  L    A   D+G YVC A +E G S     +     P+    VD   +  +  +S    C+   +P    +WF N +EL  ++  R+  VN   E+ + I++VK +DSG   C+A N  G D    ++     P  +      +I + G    ++C  +G    +I+W  +   +  +    +   +++  L+I        G++ CV  N  G         +   P     V ++    G+ +T++  V G  P  V W++G   I     I ++     F N    LII  + +     Y C A+N+ G  Q SV   I    A  I   +  QV   +    +  V    E KP     W K+G+ +  S   RI  K+N   +K   AE  D   YT    N+VG++  +     LD    P      +  +D+       L C+  G    ++ W K G+ +      RI      + L +  +    AG FTC ATN   +      + V+ PP  ++K G  D   GS   V L        P   I W+K  + LV   G   I  +  ++ L++Y     ++G+Y CK +N       S + F +       K   S+++    K+G+   L CK+ G  TP  K +W ++  +++ +     +       L +T +  E  G Y C+  N  GS   S  VI+ ESP   +      V  +  + L    +G P  +I W FK   I  +   YK  + ++  +L + +  +   GEY C   NE G    ++ VT+  P  +I      K I     + GG   F   +  + P  + W K+  +I +    D  +++ + +  +L+    EVKH   G Y C A N  G      L+ +  P  + + +    I++ +     +     G       W+KD  +L  G   ++ +T+    L I    + D   Y   V N+ G       +NV    +PPS       +  + +KGS  +L C V+G     I+W + +              H    F+ + +   T    YTC ATN+AG  +      +  PP  V  +  + + +  +  ++L          TI+WFKD + + +    ++   +  T L L  A+ +D G Y C +SN +G      T+ +  PP  +F  K     V   G    F C   G PK ++ W  DG+ I       +   D      ++     ++G Y C A N  G    S +++V   PT     +    VE      V LEC V+G P   +TWLK+   I     Y      +   L I     SD G Y C+  N  G       V +  PPS  + +I N   + +           GSP  +I + KD   LD  D   N   S+   +   Q R      S     SG Y C A N  G +     + V+ P +         V+       +LEC + G   P  K+ W + G   VP S   S+    +     +++V + D+G+Y    +N+    S    + V    + P F K    TK++ V  +++ M C+ +G  P +  W++  +EI +   +Y      R  S +++ N++ +D   Y C  +N  G       ++V  PP  +   + P   +   +  + F   +      K  I W K++  ++ G   +     +   L + +  + ++G+YTC   N  G DS T +L VT PPKF         +  V+ G S   +C   GSP   ++WF  +  +   D       ++  V+ + +++ E  G F C A+N  GS     K+ V  P +       V        S+ C   G P   + W +D + +    +Y   + +    + I +    D G Y C   N++  D+    V +  PP+  S   S+ V  GE   L   +EG +P  + W       I  +      F+     L   +    ++G Y C   ND G +E   TL VL +P +        T  +     ++CK+  G P+  + W ++G  L+   K K  +    S L I  S++ +D G+ T   +N  G+   T  + V    + P  +  +  TG   G+S  + CKV G    +V W  +   +  V G +++   S+N   + +  L   D GNY C+     A +      L++   P FV +P+   V+   +  +F       P   + W    R    +L    R +I  +   +E          +GEY C+  N  G    +  L V          SD   E  K  IL     G +  S+ W K+G  +  S +  I        L I  +  +D G Y C   N AG       +    PP F      + A +G+ + L C   G P  T+SWYK + KL      ++   N   +L    V    SG Y C A ++ G   S+ ++
Sbjct: 4586 KKVHLECQV-DEDRKVTVTWSKD--GQKLPPGKDYKI--------CFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVREPPSFVKKVDPSYL-MLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVN--SEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEPADI-VRGTNALLQCEVSGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMATHLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMS-----FSNGVAVLIIPDVQISFGGKYTCLAENEAGS-QTSVGELIVKEPAKIIERAELIQVTAGDPATLEYTVAGTPELKP----KWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRN-VDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPSFVTKPGSKDVLPGSA--VCLKSTFQGSTPL-TIRWFKGNKELVS-GGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKEPATFVEKLEPSQLL----KKGDATQLACKVTG--TPPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPYFTKEFKPIEVLKEYDVMLLAEVAGTPPFEITW-FKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPPSFI------KKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEITED---DNIRMTFENNVASLYLSGIEVKH--DGKYVCQAKNDAGIQRCSALLSVKEPATITEEAVS--IDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFT--KKLKKMDSIKGSFIDLECIVAGSHPISIQW-FKDDQEISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFV--EKPQSQDVNPNTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKEPP--QFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFI---RELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFIK-KIENTTTV-LKSSATFQSTVAGSPPISITWLKDDQILDEDD---NVYISFVDSVATLQIR------SVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQI--VEKAKSVDVTEKDPMTLECVVAGT--PELKVKWLKDGKQIVP-SRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKK--LTKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEI-STSAKYRLVCHERSVS-LEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPSFL---VKPGRQQAIPDSTVEFKAILKGTPPFK--IKWFKDDVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPKF---VKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIVETLKNAEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVL-EPAVIVEKAGPMTVTVGETCTLECKVA-GTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRIL-SVERQDAGTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKI--VSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANV-AGSDECRAVLTVQEPPSFVKEPEPLEVLP-GKNVTFTSVIRGTPPFKVNWFRGAR----ELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPAAFLKRLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTASSKTVF 7093          

HSP 12 Score: 450.669 bits (1158), Expect = 2.177e-125
Identity = 570/2418 (23.57%), Postives = 963/2418 (39.83%), Query Frame = 1
Query: 2299 ILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNI--IINETIGTLDINRIE-KNMKGQWVCVATNSAGSSRKSFNLDI--GFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQD---NSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSN--RIMAKDNT--LVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPG-RVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTK----EGEKLTLNCKIDGFPTPTKKWSW---KSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPII---VGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDG--STLTLFEVKHLDSGIYKC-LAINIGESLNFTLVVLISPTILGKHSSKSVININEETD--LYITCWSEGNPAPRYLWYKDNSQLISGGRVEIT--NGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTY--METIX----XXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVS-LDPDKKRWILKDGEL-RLSCNSDAAPVATIEWFKDGELIRNN--LRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRR---VLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVR---TPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRIS-PDGTR-ITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQ-ITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNG-QSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQL--GTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVN---KEGGIFKCIARNEVGSIMKVYKLEVIMPA--LVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFR----YGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQ--PKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTD--SGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSL-PISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENE---INIYDLKPEDTGNYIC-IGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLNS-----NGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDP-SESIK--RTILMCKVEGKVD-SIVWLKNGVIVQNSSRLYINDFNL-----IINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKL-------IKYDFVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQG 9279
            ++   L   +  EGD   +  S T   +  + W F    V  D     + ++   TL I+++  ++ +G++VC A N +G +  S  L +     P IK  +  ++ + G      C+++  P  R +W +     Y       D+  I      +SL I    + D   Y C A N++G V  +  + ++  A P    ++ K +          +C V  + P     W K+G  +  S   RI   +N   L +  +  +D  +Y+C A N+ G      EL +  KP  I + +    A +  V  L+CQ   D K  + W K G+ L      +I      + L +     + +GT+ CTA+N+  +      V+V+ PP   K+    Y +   E+  L+C +  G+P  ++ W+KN + L E    R+     + IL +     +++GSY C+A N+V SDS   +I I   P       IK         G    L C++ G  T   + SW   K  I   ++       S +    L I    S   G Y C   N  G        ++ E P  ++  D  +     T+TL     G+    + W+  +++I  +             LI+       GG+Y+CLAENE G       + V       K P K I    +I    G   T    +  TP  + KW+K+   +  S    +++IS     + L  +  +  DSG Y   ++  +G S   T   ++   I     +K + N++   +    + C   G+   R  W+KD  ++ +  R  I    G  +L I +V  +D   + C  TN  G    +  + V  PPS   ++   + + L GS   L     G     IRW     E ++         +  S L    V  S    YTC  +N AG      +  +  P   V  L+P +   +LK G+  +L+C     P   I WF +   I+ +   R++       L L +    D G Y C   N+ G D  +  V  ++  S  F  +    +V    ++ L     G P  +I W KD + +   R     + D    L +   +  DAG YQC   N  G +  S  V +   P+     K+        GGT   +  + G     +TWLKD   I    + R     N   L +  ++    G+Y C AKN  G       +++  P +I    +  +  +  GD   L    +G+      +FKDG  L +           K ++ V+    +L + S ++ DSG Y     N +G    +  + V     PP F T  ++ K++        LEC + G    P  I W +    +S+    + S  D T  + +  ++  D+G Y C A N+        ++ V   P F +      +    NT VQ+     G  P T+ W++  +E+ +   R    D    ++ +++   +  D+ TY C  +N  GT   K  + V  PP+ +K+   P    V  N Q  TF C +      +  + W  + + I      + ++F +G  +  I   + + SG Y CEA+N AG  S +  L V  PP F       RE   V++   + V  +C   G+P   + W   +  I       + +++   V  +        + G ++CI  NE GS     ++ +  P   + +++      +S  +F    T  G P   I W +D + +      Y +  DS    L+I       +GRYTC   N+   +     +++  P +I    KS+ V   + + L C+V GT   ++ W   G   + S         +     I  V K  SG Y     ND G       L VL Q  P  F    T+   VL + + M+CK+   +P     W ++G  +S    Y       S     N+L++ED  + TC   NVAG+D  +  +TV+  P   + P        S+V     ++G P   + W KD   L  V G +     E     +N+Y +    TG Y C +    G+++ T  T L +   PKFV K +   +V+        C+    P+  + W  N   + +         +    I + ++ +E++G++ C A+N  GS   S  + V   P   V+ S  P  E++K     L C++ G     +VW K+   +++S +  I   N      I+N   + D G Y C A N  G       + +K PP F     +++   GE   L  + EG     + W K K+        I+  FV+++    +L+    +  ++G Y C   ++ G
Sbjct: 4290 MIHTPLVDTVSEEGDIVHLTTSITNAKE--VNWYFENKLVPSDEKFKCLQDQNTYTLVIDKVNTEDHQGEYVCEALNDSGKTATSAKLTVVKRAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYE-----SDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTE-AYPPTFLSRPKSLTTFVGKAAKFICTVTGT-PVIETIWQKDGAALSPSPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHFIKELEPVQSAINKKVH-LECQVDEDRKVTVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVREPPSFVKKVDPSYLMLPGESARLHCKL-KGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPP-----SFIKTLEPADIVRGTNALLQCEVSG--TGPFEISWFKDKKQIRSSKKYRLFSQKSLV---CLEIFSFNSADVGEYECVVANEVGKCGCMATHLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIV-------KEPAKIIERAELIQVTAGDPATLEYTVAGTPELKPKWYKDGRPLVAS---KKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDI-APFFTKPLRNVDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPSF--VTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKEPATFVEKLEPSQ---LLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSIV--IVKESPYFTKEFKPIEVLKEYDVMLLAEVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPPSFI---KKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATITEEAVSID--VTQGDPATLQVKFSGTKEITAKWFKDGQELTL---------GSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSF-TKKLK-KMDSIKGSFIDLECIVAG--SHPISIQWFKDDQEISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEKPQSQDVNP--NTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKD--DTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKEPPQFIKK---PSPVLVLRNGQSTTFECQITGTPKIR--VSWYLDGNEI-TAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTF------IRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIR--SSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFIKKIENTTTVLKSSATFQ--STVAGSPPISITWLKDDQILDEDDNVYISFVDS-VATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQIVEKAKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISA-QWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPSFLVKPGRQQAIPDSTVEFKAILKGTPPFKIKWFKDDVEL--VSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCT--TMLLVTEPPKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPP---VFSSFPPIVETLKNAEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKIASKNFHTSIHILN-VDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENV---ATLQFAKAEPANAGKYICQIKNDGG 6617          

HSP 13 Score: 139.428 bits (350), Expect = 1.898e-31
Identity = 366/1756 (20.84%), Postives = 637/1756 (36.28%), Query Frame = 1
Query: 4318 GGNITFSCVMNSTPPAEIKWFKNEIDIYKS------LPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAINIGESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSE-GNPAPRYLWYKDNSQLISGGRVEITNGGKT--LLIKKVRRSDDSVYQC-HVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXX------XXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLL---NAQESDIGIYKCLVSNKLGLDKQA----WTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRI---DFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFD-VQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITW-LKDGIPINRLPSYRYRIIGNSK--QLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEP-KV-----NWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGT--RITVENVKQYDAGEYKCHAQNEVSKISL-VFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEIL-ADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPA--EGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQG---LIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQ--PKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLS---KVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVEL----LPKVSLPI----------SVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERS-GAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGKVDSIVWLKNGVIVQNSSRLYI----NDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKS-------------------------PPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKN----GSLRIIGVQKEHSGVYFCVASSNQGE 9282
            G +  F   +   P  E +W+KN + I +S       P+D          L + +V   DS      AINI    +    +L+    L   + +    + +E D   T   E   P  +  WYKD  ++  G +  + +  K   L I  +  SD   Y C  V +E  +      V   V   +  +   E PE   G    L C VS     + +W + +                   L   +V K     Y+ +   +  + +    P    P  I+    D+K  + +   ++L        V  + W KDG+ ++ + RV+I     Q H+L   +  + D G Y   +   LGL        ++VD++ P             V  G    L C         ++W  +  +I   D  + ++      L +N T  +D G Y+ I        ++S + +++  G        R      T      +E   SGI    + W  KD       PS +Y+I  + K  +L ++ M   D G+Y+  A       +  + V  GA      ++ L +  +    E    C    +P+    + +DG  L + +   ++   +K+RL+++          A + D              D+ EY+ +V T        VE  K+     N    +T+    T+         + W ++GV L S     IS  GT   + ++N    D   Y        +   L V  V++  KP+         + A++N TV      +    P + W+ +  EI  +DK R       R    + + NI P DA  Y  TA  G    + K  +  +   K MK      N  V E    +F C V ++N+     +W K    I + +    +       L I+N  +++S  YT     + G D  +  LTVT     P   +   + I  +   ++ F+     EG    S  W    + I   D            L I +V+            +  S   +Y     +     +  I+V E+    F    +    P   ++W +D + +    R   + +     L I   +  D G+YT      +S     V+   +   +I S KK + V   ++ ++   V        HWY  G  +I+  +   ++++ E+    + I   R+  +G Y  VA    G     +TL V     P++ +  E +   V +      C ++ G PQP I+W +    LS   K K  +   +  L +  +   ED    TC AKN  G    +  ++VE+     P   +P+               EG      C+V G       + KD +   +      +F    ++ I +  PED G Y  +   + G  +STA+  L     P+ +   +++  + E   K F   ++S    + + + +     SK+N       TL+            ++++ V   ++    E      ++   + D S     T+ +  +      I W  NGV++  S+        +D +LII   K +D G Y C+ASN  G+     +L + S                         PP F      I    G   I      G P PT++W+K  K +      ++I N    G+  +   Q+E SG+Y C A +  GE
Sbjct: 2092 GSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNV------CELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSG---ELECIVSP-ENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMKP---RPIAILQGLSDQK--VCEGDIVQLEVKVSLESVEGV-WMKDGQEVQPSDRVHIVI-DKQSHMLLIEDMTKEDAGNYSFTIP-ALGLSTSGRVSVYSVDVITP--------LKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVEKIKIIRG-------LRDLTCTETQNVVFEVELSHSGI---DVLWNFKDK---EIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGK--LTVAGGA-----ISKPLTDQTVAESQEAVFECEV-ANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIA----------ATKLD--------------DIGEYTYKVATSKTSAKLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPK--------DVTALENATVAFEVSVSHDTVP-VKWFHKSVEIKPSDKHR---LVSERKVHKLMLQNISPSDAGEY--TAVVGQLECKAKLFVETLHITKTMK------NIEVPETKTASFECEVSHFNVPS---MWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTF----VCGNDQVSATLTVT-----PIMITSMLKDINAEEKDTITFEVTVNYEGI---SYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSE---PDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDV---RIRSIKKEVQVIEKQRAVVEFEV-NEDDVDAHWYKDGI-EINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVA----GRNRSSVTLYVNAPEPPQVLQ--ELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFP-EDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEA---PESILHERIEQEI-EMEMKEF---SSSFLSAEEEGLHSAELQLSKINE------TLE-----------LLSESPVYPTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGE 3702          

HSP 14 Score: 133.265 bits (334), Expect = 1.201e-29
Identity = 320/1573 (20.34%), Postives = 610/1573 (38.78%), Query Frame = 1
Query: 2011 PAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSA---TGVPQPKI--TWEFNGSPVTI--DGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVT---NIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQD---NSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAF-TQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRIMAKD----NTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQ--LTVYSITEEHAGTFTCTATNDHAA---VVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPG-RVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITI--LVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFN---DKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQ-ETLIVERAASMHGGEYSCLAENEGGKDQKNSI-VTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHL--DSGIYKCLAINIGESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKT--LLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVS--GFPTPQIRWTY----METIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGT--QLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDF-RRVLLSDDGYH--LTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTV------VLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKD-----ASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKN 6558
            P  +V   + + ++ D IT  C      P    WF +G E+ P+ P+ SI  D     +KI     +D GE +C          V ++   I + K          PL G +  V  +A     + +P +   W+  G P+T   D  II +     L ++  +  M G+     +  A +++ + NL +   P I  F+T   ++     +     C+V  +P    +WL+G        I   DR+ + +D   +S++IK  + ED++ Y+ +A+++H     S ++ I GI   ++ F T  K V  +   K+  V  V  S     + W KN + +  +  +  +D    +++  K +  +D +     A      AK  +   ++  P   G  + +    + D ++LQC+      P ++W K G+   ++P    VI  DG +  L +    +   G +TC    D  +    +++ ++ +  P       +   E+   E       I+  +      W   G+ L++ P   ++  G+ + L ++    D+TG  + +A N  SS     +  +  L+ P      +  +    GE  T +C++     P + W  K   L+        +   +  + L +  ++ E  G       +     K   ++ + E P  ++F    +   V    T  L C  S     K+KW FK       +  Y++V + +   L++          Y+C A     KD K S  + V  P+++   P  ++      +     F C + S   A++KWFK+  +I K     ++ I   G+   L   K L  D   Y C       S    L VL    +  K+ +   I ++E   + + C     P    +WYK + ++I  GR EI   G+   L+I+     D   Y C + +   + K    V+     +   IS  +  E L+G      C++S   FP   ++W      +E+ +   ++++  +   +  D +     T +     G+AR      LT   K+  + P K   + +  E+  +C  +    A  +WF++ E I ++ +  I  +     L + +A   D   Y   ++N  G + ++    I+    ++        +     ++  +C    R    ++W K+G  + F  RV    D Y   LT+      D G Y   A    GQ     ++ +   PT          VE     TV      V  C +S      + W ++G  I     Y++   G+  +L I   +  D   Y+C  ++   +  +F++                E  +++   +R P     +P  ++ F  + N  D  ++   ++        K +++   +   L +   K  D G Y+  A +      +E +      P+  T++     +   +  + L   +   A P A+  W +   PLS+  +I  + + T   +   K+ D G YK   QN+  K     N++V   P   +N
Sbjct: 12590 PYFTVKLHDKTAVEKDEITLKCEVSKDVP--VKWFKDGEEIVPS-PKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEK----------PLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGE----VSFQAANAKSAANLKVKELPLI--FITPLSDVKVFEKDEAKFECEVSREPK-TFRWLKGTQE-----ITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHT----SGKLIIEGI---RLKFLTPLKDVTAKE--KESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMSSEAKLTV---LEGDPYFTGKLQDYTGV-EKDEVILQCEISKADAP-VKWFKDGK--EIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRP-------LHSVEVMETETARFETEISEDDIH--ANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRP------LKDVTVTAGETATFDCELSYEDIPVE-WYLKGKKLEPSDKVVPRSEGKV--HTLTLRDVKLEDAGEVQLTAKDF----KTHANLFVKEPP--VEFTKPLEDQTVEEGATAVLECEVSRE-NAKVKW-FKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDA-----KDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMA---RFECEL-SRENAKVKWFKDGAEIKKG---KKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTS--GMLTVLEEEAVFTKNLAN--IEVSETDTIKLVC-EVSKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGK--VKVHEL---AAEFISKPQNLEILEGEKAEFVCSISKESFP---VQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVM--VGAARAAAH--LTVIEKLRIVVPLKDTRVKEQQEVVFNCEVNTEG-AKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWC-KVNRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTA----GQDKSVAELLIIEAPT--------EFVEHLEDQTVTEFDDAVFSCQLSR-EKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKSRARLFVE----------------EIPVEI---IRPPQDILEAPGADVVFLAELNK-DKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAA----PKIKTAD----QDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLST-KTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRN 14022          

HSP 15 Score: 129.798 bits (325), Expect = 1.427e-28
Identity = 159/622 (25.56%), Postives = 250/622 (40.19%), Query Frame = 1
Query: 5425 LGGNLYLFCVSEGRPKPKIEWRKDGSR-IDFRRVLLSDDG--YHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLK--------DGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNS-LDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLY--QCNASNAIGY-DVMEYS--VRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGS-----------------IRISPDGTRITVENVKQYDAG-EY----KCH---AQNEVSKIS--LVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKI----MKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNP---KSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFP 7137
            LG    L C   GRP P I+W + G   I  R+  +S DG  + LTV +  + D G Y CIA N  G+ + S  + +   P   PG     K    VG T+ L  +  G P PA+TW          + I I     Y + ++ N         + + AG+Y     N FG ++  +DV I   P      I+ E ++K    +    PA+           DG S +  + +   +     +  LVS    + T      T++  Y  + +A N  G  D +E S  V +++P E   +  +P +   T  +    C           + W+    P S GG+                 I ++ +  R TV +VK    G EY    KC     ++E S+IS  +    +V ++   +K +L   +     +   + C+ TG+P P + WYRQ +EI+AD  +Y   +   G   + I ++  DDA  Y   ATN GG++     + V +P KI        +G  +    E + I    S        PVI W K     LI +  +Y         +++ P   +  ++G Y   AKN  G D  T  L V   P  P
Sbjct: 31473 LGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKN-------VQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPAD-----------DGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAVTKDS----CV----------VAWKP---PASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRN-LNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFS----GKPDPVITWQKGQD--LIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPP 32052          

HSP 16 Score: 126.331 bits (316), Expect = 1.484e-27
Identity = 367/1792 (20.48%), Postives = 627/1792 (34.99%), Query Frame = 1
Query: 2851 IAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRIM---AKDNT--LVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIII--GDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIA---GQKNILKVYGKNEDETGSYEC-----KATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKND--LLITQMRSELQGIY--TCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNT-ITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPI-IVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSL------PKDRFKISLDGS--TLTLFEVKHLDSGIYKCLAINIGESLNFTLVVLISPTILGKHSSKSVIN--INEETDLYITCWSEGNPAPRYLWYKDNSQ--LISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNL-WCNVSGFPTPQIRWTYMETIXXXXXXXXXX------QLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIR--NNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFR---RVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVS--GIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYI--IKVGDELR--LPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAI--------GYDVMEYSV--------RVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQ------MSCECTGYPPPTLLWYRQEQ--------EILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGP----------ENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSP---------------------------------------------------PKFPTDFS--------IFRETIT---VQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKEG-GIFKCIARNEVGSIMKVYKLEV---------------IMPALVRL----------DKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGK----GIFRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVII 7677
            + APKI      Q V + +     V +V   KP     W KNG +IE S+RI     +DN   LVI+ V AED A     A N  G       L VQ K +I    + +  +  +   +   +C+T  +P  K++W K G  +      R+        L++ +I    A  ++C    D         +   A  +  KE + D E+    + EL CI++  N   K  WY N   L +  G+  I    G++N L V    +++ G Y       K T ++    R     I +    SD K+      EG+ + L  K+      + +  W     ++Q  P    +  IDK    LLI  M  E  G Y  T     +  S ++S   + + +P       K V  I+ T   L C  S      +KW    + I P+     +V   ++ L++ R  +   G Y  +     G+ + N                 N++   I I+ G    +C        E++   + ID+  +       P  ++KI   G    LT+  +   D G Y   A   GE++    +     T+ G   SK + +  + E  +    C    NP  +  W +D     L +  R E     + L+I   +  D   Y   V       K   +  V +  ++  +++ ET + +   T  L   NV G     ++W     +         S       L   N      + Y         SAR   + V     KI+    D            +S + D  PV   +WF     I+  +  R+    +  +L L N   SD G Y  +V  +L    + +   + I  ++K          +    +  F V      P + W K+G  I+     ++++    + L + +T   D+  Y  +     G   +S  + VT  P +     +    E     T+  E  V+  GI   +  WLK+G+ I      + R    +  L I  +   DA  Y+ VA        ++++          R+    ++I  IKV ++ R    C  +  P+  + + KD   L + D    +   Y  RLL+          S + +D+G Y   A   +        G DV   S+        + R   EF+ +  +   +W+ +    +E               ERH   +      RI     R+ +   +Q DAGEY   A    S ++L  N            +    ++ +Q  TVQ           +G P P + WY++EQ        + L D + Y           + +    P+DA  Y C A N  G       +SV +P  +      P          ++    E     F C V   ++    + W  ++  I          F +   L I     ++ G YT  A N  GQ S T  L++ +P                                                   P +PT F         IF + ++   + +G          G P P I WF+  + ++P     FV   +   L I     E  G + C+A N+ G  +    L++               +  +L +L          +   +R   G       T  G P P + W ++ K     ++       + +G   + D + ED+G Y C   N + + + + +++++
Sbjct: 2075 MEAPKIFERIQSQTVGQGSDAHFRVRVV--GKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECET-SEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKE-LQDIEVPESYSGELECIVSPENIEGK--WYHNDVEL-KSNGKYTITSRRGRQN-LTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPR----PIAILQGLSDQKVC-----EGDIVQLEVKVS---LESVEGVWMKDGQEVQ--PSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPL------KDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIV----GRVETNC----------------NLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYA---GENMTSGKL-----TVAGGAISKPLTDQTVAESQEAVFEC-EVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSAKLKVEA-VKIKKTLKNLTVTETQDAV--FTVELTHPNVKG-----VQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVETV-----KIIKKPKDVTALENATVAFEVSVSHDTVPV---KWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVV-GQLECKAKLFVETLHITKTMKNIEVPETKTASFECEVSHFNV------PSM-WLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVC----GNDQVSATLTVT--PIMITSMLKDINAEEK--DTITFEVTVNYEGI---SYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEA---------RHIEFRKHIKDIKVLEKKRAMFECEVS-EPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIP---------STRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKD---GIEINFQ---------VQERHKYVVER----RIH----RMFISETRQSDAGEYTFVAGRNRSSVTLYVNAP----------EPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEY----------TLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLK---VSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLSKINETLELLSESPVYPTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLVL 3712          

HSP 17 Score: 124.79 bits (312), Expect = 4.988e-27
Identity = 211/989 (21.33%), Postives = 391/989 (39.53%), Query Frame = 1
Query: 1741 IEPFK-----DAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTL---PAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGREL-DPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGI--DEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIIN--ETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDI-------GFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNI---PIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNR----IMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIG-------DFKTFIDAKDGDVIVLQCQTK-------GDPKPKIEWRKGGRPLTMEPGLRIVISPDG--SQLTVYSITEEHAGTFTCTATNDHAAV-----------VKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQ-ITILVAPKASDSKMIKIYTKEGEKLT----------LNCKIDGFPTPTKKWSWKSSILDLQ-RNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGST--LTLFEVKHLDSGIYKCLA 4503
            +EP K      A L+C +  T   + + W+K     +L+ T  +++ H++ +     + L+      +D+GEY+C AE+  G   A  F+        P+ S   +++       +   C    + P + SW+ +G+ L D  + + S +++   + + I       +G+  C A N  G      R+ L+    P    + LA    + G+     C  TG    K++W  +   +   G   I+  E    L + +++K   GQ+ C A N  G    +  L+I        F  R+ + V   +G+   +  +  +V G  P  V W +      NI   P +  +  F N    L ++   M D   Y C   N  G    +  I I     P + F Q    V  S  + V +   V+   P  I WLK G+EI+ S+R      +    L ++ V   D   Y C A N  G+     ++ ++ KP +         D + F  ++   + V++  T        GDP P ++W KG +   +  G R+ I   G  ++L +   T+  +G + C A N+H  +            K+ K+       + K  I     G +E +++  ++ + +P  + E Y     + +  G ++      +LK     E+ET   E +       D + F+ +   +  + S ++ + +  K+ E  T          ++ KI+    P  K SW      L+  + F I+    D++ L +   + + QG Y      V G    S  + ++E        D ++     T T+TC  S  P  K +W    +++ P       V      L +    +   G+Y+C  E+     + ++ + + A  I      +NI    +    + TF C + S   A + W+K   ++ +S    ++    DG    +T+  V   D G+Y  +A
Sbjct: 8894 LEPVKVSVGDSASLQCQLAGTP-EIGVSWYKG--DTKLRPTTTYKM-HFRNN----VATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAISGSEPISVSWYKDGKPLKDSPNVQTSFLDNT--ATLNIFKTDRSLAGQYSCTATNPIGSASSSARLILTEGKNPPFFDIRLAPVDAVVGESADFECHVTGTQPIKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTKRLSETVEETEGN---SFKLEGRVAGSQPITVAWYKN-----NIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVIKEPKKPPV-FDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKDKPAVAPATKKAAVDGRLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKG-KWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDERKKQEKIEGDLRAMLKKTPILKKGAGEEEEIDIMELLKNVDPK-EYEKYARMYGITDFRGLLQAF---ELLK--QSQEEETHRLEIEEIERSERDEKEFEELVSFIQQRLSQTEPVTLI-KDIENQTVLKDNDAVFEIDIKIN---YPEIKLSWYKGTEKLEPSDKFEISIDG-DRHTLRVKNCQLKDQGNYRL----VCGPHIASAKLTVIEPAWERHLQDVTLKE-GQTCTMTCQFS-VPNVKSEWFRNGRILKPQGRHKTEVEHKVHKLTIADVRAEDQGQYTCKYEDL----ETSAELRIEAEPIQFTKRIQNIV---VSEHQSATFECEV-SFDDAIVTWYKGPTELTES---QKYNFRNDGRCHYMTIHNVTPDDEGVYSVIA 9834          

HSP 18 Score: 117.472 bits (293), Expect = 7.721e-25
Identity = 380/1832 (20.74%), Postives = 673/1832 (36.74%), Query Frame = 1
Query: 3388 EFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNI--LKVYGKNEDETGSYECKATN---EVSSDSRFF-QITILVAPKASDSKMIKIYTKEGEKL-TLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTC---DGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGK---DQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLF--EVKHLDSGIYK----CLAINIGESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVE-ITNGGKT-LLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGI---SMRETP------EFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELI--RNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPK-IEWRKDGSRIDFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENT-----HGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSK--QLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFF-------KDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTL--MGVADPPAKITWERHGVPLSSGG--SIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTK-IEAVQNTTVQMSCECTGYPPPTLLWYRQEQEI-LADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRV-KENMQITFHCSVYNYNMTKPVILWTKENSPI--LIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNA-KVLTIPSVNKEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDK-------------IEVRERSGTSFSVLCTAEGYPKPVIKWTRDGK----GIFRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPT----ETETTG------------VLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNY---YTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGE-----------------DRLTFQITVELLPKVSLPIS---------VTGDEGSSVTIICKVEGKPKPTVTWKKDGQSL-----QNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIF 8511
            E   S++AP     E I    +G   +      +  G P P+ EWYKNG  +           + N+  L +     +++ S   KA N   E SS +    Q   L+       ++  +  KE + + T  C+      P  K  W    +++        +S    + L I  + +     Y+C   +  NV  +AK+  +  ++E  K +Q  +    +   +  L CI S     + KW      +  N          ++ L V+       GEYS + + +        K   + +     D K           +  G+I    V  S    E  W K+  ++    P DR  I +D  +  L   ++   D+G Y      L ++    ++   V +I+P           +N+ E T   + C           WY ++ Q+    RV+ I  G K  L+I +   SD+  Y+  V    G  + N +++V     I G+   +  ET       E        LW     F   +I+ +    I +   +   + L+ M  D+    +YT  A     S +      LT     +S  P   + + +  E    C   A P +  EW +DG+ +   NN+R        +L +   +  DIG Y    + K+   K +  + +    ++K   K   +         +F V    P  K ++W K+G       VL S++ Y ++V  T+ +   +   I + +      G+   S  + V     +    K+   V      TV  E  VS    P + W    + I   PS ++R++   K  +L +  +  SDAG Y+ V      + ++F++                 +I K    + +P     S    ++ F       K+G  ++M         S K +++V  +   L + +    DS  Y     N       + S  +   P   TS ++  +N     T + E T+   G++       W ++GV + S     +R       + + NV   DA +Y   A    S  +L      +++ R  + + + K I+ ++       CE +  P  T+ W + +QE+ + D+ +  K   +     + I + +  DA  Y   A  GG     K     +    +  RS+  E   + K+   + F  +  + +       W K+   I   + +   Y+       + I   +  ++G YT     +AG++  +  L V +P   P       + +TVQ G    F     G P P I W+ ++  +S      F+       +L I +  ++  ++ C A+N+ G       L V +P +V  D+              +     G      C   G    V  +++D K      FR     D  T  LEI +A  ED G YT   +N + Q S + ++       +E+P+  +  R+ +++ +                    + SS+ L       E+GL        HS   +    N+        TLE+L +  ++ PT    E E TG             +  V  +   ++ GIP+P I W  NG+ L+   +Y   +   D  L I  + K+EDEG  TC+A N  G+                 D  T     + L K+  P           +   +G        V G+P PTVTW K+ + L       ++ N    N      + D + ED+G YIC  E    E++ A+  L + 
Sbjct: 2070 ELSPSMEAPKIF--ERIQSQTVGQGSDAHFRVRVV-GKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLIT---FTQELQDVVAKEKDTMATFECETS---EPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESY---SGELECIVSPENI-EGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQK-----------VCEGDIVQLEVKVSLESVEGVWMKDGQEVQ---PSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPL--------KDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIV----GRVETNCNLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLW----NFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEG---KYTFYAGENMTSGK------LTVAGGAIS-KPLTDQTVAESQEAVFECEV-ANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEY----TYKVATSKTSAKLKVE---AVKIK-KTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGV------VLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKII----KKPKDVTALENATVAFEVSVSHDTVP-VKWFHKSVEIK--PSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETL---------------HITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEM---------SEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGND------QVSATLTVTPIMITSMLK-DINAEEKDTITFEVTVNYEGIS-----YKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATL------YVEARHIEFRKHIKDIKVLEKKRAMFECEVS-EPDITVQWMKDDQELQITDRIKIQKEKYVHR---LLIPSTRMSDAGKYTVVA--GGNVSTAKL---FVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAH-----WYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTF----VAGRNRSSVTLYVNAPE--PPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFED--TYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANL------SLEAPESILHERIEQEIEMEM-----------------KEFSSSFLS----AEEEGL--------HSAELQLSKINE--------TLELLSESPVY-PTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVI-GIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFT-KLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNP---NGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLVLL 3713          

HSP 19 Score: 106.686 bits (265), Expect = 1.518e-21
Identity = 357/1800 (19.83%), Postives = 647/1800 (35.94%), Query Frame = 1
Query: 2335 EGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNII---INETIGTLDINRIEKNMKGQWVCVATNSAG-SSRKSFNLD-----IGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNS------LIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQ-VVVESTLKKVIVCLV----VESKPPAVISWLKNGKEIE----YSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAK--DGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCT------ATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVE--IAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIP-PNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKH---LDSGIYKCLAINIGESLNF---TLVVLISPT-ILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRW------TYMETIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGT--QLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPP-SIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFR-RVLLSDDGY--HLTVNSTMETDAGRYQCIAENTHGQTDI---SFDVQVTYGPTLDPGGKRYYKVERTV--GGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSK--QLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTP---------PEFDTSNVEPKVNWFTN--QTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRIS--PDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKI--MKRSLGPENHRVKENMQITF----HCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFN-NGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTS-------------------------PPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFY--KDMPISPYDMMNFVISNNAKVLTIPSVNKEGGIFKCIARNEVGSIMKVYKLEVIM 7410
            +G     R    G P P+  W  NG  +     I      + +  L I  +        +  A N AG +S  +F L      I F   ++D V     +     T  C+   +P  +VKW +       + +  GD+Y ++ D        L I     ED S  + + +N    V+ + ++ + G     + F +  Q + V  +    + C+V    +E K      W  N  E++    Y+         L +K V  ED+  Y+ +   +  T K    L ++ +PI I   +   D K  +GD++ L+ +   +    + W K G+ +     + IVI      L +  +T+E AG ++ T      +T+   +V   + V V  P       + D  +       L C ++  + +  ++WY N +  ++   RV+  + G K  L +   +  + G Y+      V ++       I +     D    +      E    +  ID        W++K   +          +  I K  L +  M  + +G YT        S K++     +  P      D++V      +    +A  NP  K +WL   K +P  N +  +  G ++  LI+        GEY+          + ++ + V A  + +K   KN+T   +    +  F+  +       ++W KN + +  +   +++ IS+ G+  +L  +K+   +D  +Y      +G S      T+ ++  P  +    ++     ++   D     W   +     +   D  +L+S  +V        L+++ +  SD   Y   V  +     K F   + +  ++  I + ET       T +  C VS F  P + W        M      ++     QL  MN        YT +  N+  SA     P++     I S+  D            ++ N +     + +W K+G  I++  +  +  +     L++ N    D   Y  +        K   T  + +    I+F       +V L     +F      P   ++W KD   +    R+ +  + Y   L + ST  +DAG+Y  +A        +     DV++           R  K E  V      V+E  V+     A  W KDGI IN     R++ +   +  ++ I   + SDAG Y+ VA      + ++++     PP + +   L    ++ G   R     +G P P I+++K+   L            +K + L   +   L L  A   D+ +Y C A N  G      S+ V  P         P +  + + P  +  T+  Q    +C + G      K++W      +      R++   D  ++ +      D G Y   A N V ++S                           +T  +S E     P ++L  R EQEI  + + +    +      +    +Q           +    T+E   E S + P K    K   GP   +   N  I+       SV    + KP I W   N  +L    DY   F+ +  SL IL  K ++ G YTC A N  G+   +  L + S                         PP F  +    R       G    F+    G P P++ WF   K +  S Y  +    + +   +      ++ G++ C A N +G      +L V++
Sbjct: 2091 QGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMA---TFECET-SEPFVKVKWYKD-----GMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDEN----VKTTAKLIVEGAV---VEFVKELQDIEVPESYSGELECIVSPENIEGK------WYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCK----LKMKPRPIAI--LQGLSDQKVCEGDIVQLEVKVSLESVEGV-WMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSV---YSVDVITP-------LKDVNVIEGTKAVLECKVSVPDVT-SVKWYLNDE-QIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKL-IVGRVETNCNLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVL------WNFKDKEIKPSSKYKIEAHGKIYK--LTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAISKP----LTDQTVAESQEAVFECEVA--NPDSKGEWLRDGKHLPLTNNIRSESDG-HKRRLIIAATKLDDIGEYTYKV----ATSKTSAKLKVEA--VKIKKTLKNLT---VTETQDAVFTVELTHPNVKGVQWIKNGVVLESN---EKYAISVKGTIYSL-RIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVE---IKPSDKHRLVSERKVH------KLMLQNISPSDAGEYTA-VVGQLECKAKLFVETLHITKTMKNIEVPET------KTASFECEVSHFNVPSM-WLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVTPIM-----ITSMLKDINAEEKDTITFEVTVNYEG---ISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAG------KATSTATLYVEARHIEFRKHIKDIKV-LEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRI-----------RSIKKEVQVIEKQRAVVEFEVNEDDVDA-HWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAP--EPPQVLQE--LQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLL---------STGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTD---LKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVS---------------------------STANLSLEA----PESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQ----------LSKINETLELLSE-SPVYPTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFF-NGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAKSLEKLGGPCPPHFLKELKPIR----CAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLVLL 3713          

HSP 20 Score: 103.605 bits (257), Expect = 1.187e-20
Identity = 303/1571 (19.29%), Postives = 573/1571 (36.47%), Query Frame = 1
Query: 1759 AELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIP----LEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNI--IINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNI---PIALGDRYFINQDNS---LIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRIMAKDN----TLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYS-------ITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEI--PGRVEIAGQKNILKVYGKNEDETGSYECKAT-NEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLF--EVKHLDSGIYKCLAINIGESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKD----NSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXX------XXXXXXXQLHFMNVDKSHITRYTCIATNEAGSAR----------KLFDP---VLTYPPKIVSLDPDKKRWILKDGE-LRLSCNSDAAPVATIEWFKDGELIRNN--LRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRRVLLS--DDGYH---LTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPAN-----------------------GSPNPNIAFFKDGNSL---DMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIG 6216
             ELEC V  +  N+  KW+ +    ELK+  ++ I   +   N     L +   ++ D GEY  V + +    +    +K    P A +       +    I      +S       W  +G+E+ P+D R+ IV D Q   + I ++  +D+G        +       + LS      + S+D+   +     +EG +  + C  +      + W  N   +  D  +  I+  T   L INR   + +G +  +     G    + NL +    +I   + ++  +  +N+    ++            GI   +N     I    +Y I        L +  +  +D+  Y   A    G+   S ++ ++G A   I+   + Q V ES  + V  C V  + P +   WL++GK +  +N I ++ +     L+I   K +D   YT     +V T+K   +L V+   I     K     +  D +     T  + K  ++W K G  + +E   +  IS  G   T+YS       I +E    F        A +  E    +K P  ++          + EN  +   ++  + +  ++W+      VEI    +  +  ++ + K+  +N   + + E  A   ++   ++ F  T+ +        M  I   E +  +  C++  F  P+  W      +++      +    + +  ++ T      +  + C    V  +  ++  ++I    K I   +K  +  + T+    I+        KWL     I           +   +L +         +Y+ +A    GK    + + V A +I+ +   K+I    ++      F C + S P   ++W K++ ++  +   DR KI  +     L     +  D+G Y  +A   G +++ T  + +    +   S K  + + E+    +      +    + WYKD    N Q+    +  +      + I + R+SD   Y    T  AG ++ +  + V  P     +   +      G        +SG P P+I W   E + S       L       L  +         YTC A N+ G A           ++  P   +  YPP I++   D    +  +G+  R  C      +  + W+   + I+ +   R+       QL +  A   D G Y  + SN +G       + +  P SI        H+                   +IE   +    +F    LS  ++G H   L ++   ET     + ++E+    T    + + T GP      K     + ++G    L   V GIP P I W  +G+ +     Y++   G+   L I+  +  D G Y+C+A N +G+      + I +     ++      + K  ++L  PCP +                       G P P + +FK+   L     + +  N + S               +   +R DSGLY C A N +G
Sbjct: 2284 GELECIV--SPENIEGKWYHN--DVELKSNGKYTITSRRGRQN-----LTVKDVTKEDQGEYSFVIDGKKTTCK----LKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSD-RVHIVIDKQSHMLLIEDMTKEDAG--------NYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIV----GRVETNCNLSVE-KIKIIRGLRDLTCTETQNVVFEVELSHS---------GIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYA----GENMTSGKLTVAGGA---ISKPLTDQTVAESQ-EAVFECEV--ANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTY----KVATSKTSAKLKVEAVKIK-KTLKNLTVTETQDAVFTVELTHPNVK-GVQWIKNG--VVLESNEKYAISVKG---TIYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVT----------ALENATVAFEVSVSHDTVPVKWFHKS---VEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETLHIT-----KTMKNIEVPETKTASFECEVSHFNVPSM-WLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVT-PIMITSMLKDINAEEKDTITFEVTVNYEGIS-------YKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVA----GKATSTATLYVEARHIEFRKHIKDIK---VLEKKRAMFECEV-SEPDITVQWMKDDQELQIT---DRIKIQKEKYVHRLLIPSTRMSDAGKYTVVA---GGNVS-TAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAH-WYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEY----TFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDT---VTSEGQPARFQCRVSGTDLK-VSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESI-------LHE-------------------RIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLSKINET----LELLSESPVYPTKFDSEKEGT-GPIFI---KEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGS-----------GTFIVNDPQREDSGLYICKAENMLG 3701          

HSP 21 Score: 100.523 bits (249), Expect = 9.132e-20
Identity = 193/937 (20.60%), Postives = 328/937 (35.01%), Query Frame = 1
Query: 6670 LADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIP------PKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPV--ILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDF--------------SIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGI---FRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNK----------ISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSK---VKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQ------------------------------ITVELLPKVSLPIS-----VTGDEGSSVT------IICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENE---INIYDLKPEDTGNYICIGERSGAEASTA----------STYLSIFTRPKFVYKPKLKNVVQET-RWKSFRCE------ATSHPKPDIKWMFNGRAIESKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGKVDSIVWLKNGVIVQNSSRLYI----NDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVK----SPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKN 9159
            L+  ER  +FDI      M+               A     T E+K+E+    P      P+I  R     +HRV       F  +V     +KP   + W      +      +Y   +   +L IL+  +D+SG Y     N  G+ S    L VT       D+              S+F E    +     +F+  +E   + S+      M  +   + ++  S +A++ +     K           E  S  +  K  +    L +   + V E     FS  C  +G P P + W R G+ +    R+   T       EI+  +  D G Y+    N             Q ++  +  + SPP+++SP+    V+  E V  P  V+   P      +P   + + T   ++  +S    I   ++ + S             +EI   L  +V+  + R  E                         +TW ++G  L +    + +Y+   +     N+L   D+G   C      G  +   Q                              +T +  PK   PIS     VTG + ++V+         K  G+P+PT  W KDG+++    G +++ + +     + I+     D+G Y C  + S    S++          +    + T+      P+ K VVQE    K+ R E      A S  K  +K   +   I  ++  +   S+    V  E       I K    S E     E+      + + +       +R +L   + G  D + W+ NGV + NS         +D  L I QA  +D GI  CI+    G  + Q  L +       P F   P + + N G+ ++  C   G P P I W+KN
Sbjct: 33255 LSRFERSARFDIFSRYESMK--------------AALKTQKTSERKYEVLSQQPFTLDHAPRITLRM---RSHRVPCGQNTRFILNV----QSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDVTG-----GDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHSASAEMKSAALEEKS---------LEEKSTTRKIKTTLAARILTKPRSMTVYEGESARFS--CDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEPR--VKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPKITQFLKAEAS-------------KEI-AKLTCVVESSVLRAKE-------------------------VTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQ--GGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEE-------ITKTSQASEEVRTHAEI------KAFSTQMSINEGQRLVLKANIAGATD-VKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKN 34097          

HSP 22 Score: 100.138 bits (248), Expect = 1.126e-19
Identity = 246/1207 (20.38%), Postives = 432/1207 (35.79%), Query Frame = 1
Query: 5968 LNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASN---AIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGT--RITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTI-PSVNKEGGIFKCIARN-EVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCV--ANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKI-LEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFN--SLKIEDEGSLTCIAKNVAGED---RLTFQITVELLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSE---NEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIES--KLNSNGRGSI---TLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIK-----------RTILMCKVEGKVDSIVWLKNG-VIVQNSSRLYIND---FNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQGEVHSQPIYLTVQIPGGWSAWQEWSKCSLSCGKGFISRKRLCNNPPPSEFGMTCIGEDFEKRD 9465
            L +Y     DE+ L C  + +  P + +FKDG      ++ P+K+A  K       +++ML L  A ++D G Y C+      +   D+ +  +++  P           V     +T   E     +++      W+  G  L       I  +G    + + N +    G     A N  S   L     V    R  K+   T  E     T    CE + Y    + WY + +++    +  P+ +       + + +++ +DA     TA +     +    + V  PP    + L  E+  V+E       C V   N     + W K  + IL       +     + L I +   ++   YTC+AK+     +   V     PP    +F      + V+      F+C         + WF     I      + +     ++L I   +  +   + C  R      ++ V + E +      L  IEV E    +  ++C     P   + W +  + I    RY   T+ R  IL I +A  ED G Y C   +  S+    V V  ++   I  P+ ++ +  GE+    C +     F + W        S           ++ L++        G Y  +  A   A +  +   L ++V  K  R  E +   V N      C++  EG       W RN   +     Y       ++        ++D+ +      N  GE+        +  E L  V     +   E  SVT  CKV  +   T+ W K+G+ +     NR  +  +   + + I D    D G YI     +G + S A   L I   P    +      V E     F C+  S  K ++KW  NGR I+   K      GSI    ++  R ++  EY C  ++R              K R R++  + P E I+             + + ++      + WL+N  V+VQ      +++     L I   K +D G Y+ IA +    A+    L + + P       ++  ++G+ L +    + YP     W+K  + +    + +  +  S RI+  +K   G Y  V  +  G+         + +PG           +L   + F     L    P ++ G   IG   E+RD
Sbjct: 12951 LQDYTGVEKDEVILQCEISKADAP-VKWFKDGK-----EIKPSKNAVIK----ADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRPLH--------SVEVMETETARFETE---ISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGE-----TATFDCELS-YEDIPVEWYLKGKKLEPSDKVVPRSE--GKVHTLTLRDVKLEDAGEVQLTAKD----FKTHANLFVKEPPVEFTKPL--EDQTVEEGATAVLECEVSRENAK---VKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVV-----PPHV--EFLRPLTDLQVREKEMARFECEL-SRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLTVLEEEAVFTK--NLANIEVSETD--TIKLVCEV-SKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPS--SRTDGKVKVHELAAEFISKPQ-NLEILEGEKAEFVCSI-SKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIEKLRIVVPLKDTRVKEQQEV-VFN------CEVNTEGAKA---KWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKV-NRLNVTLKWTKNGEEVP--FDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVT---AGQDKSVAE--LLIIEAPTEFVEHLEDQTVTEFDDAVFSCQL-SREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDR--------------KSRARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAK----LELAAAPKIKTADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVR--------NLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRD 14057          

HSP 23 Score: 92.4337 bits (228), Expect = 2.537e-17
Identity = 404/1998 (20.22%), Postives = 728/1998 (36.44%), Query Frame = 1
Query: 1729 KNASIEPFKDAELECNVFSTSSNVVLKWFK---SIPRYELKNTKRFRIEH--YKKSPNAFSSKLIILSASESDNGEY---VCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEG----DQQTVRCSATGVPQPKITWEFNGSPVTIDG----NIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSY---GENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVES---TLKKVIVCLVVESKPPAVISWLKNGKEI----EYSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPK-IEWYKNGQPLVEIPG--RVEIA--GQKNILKVYGKNEDETGSYECKATNEVSSDS--------RFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKII--QFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEI---DIYKS--------LPKDRFKISLDGS--TLTLFEVKHLDSGIYKCLAINIGESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGK--TLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFV-PPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXXXXXXX------XXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVD-----IMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRK-DGSRIDFRRVLLSDDGYH--LTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQAS--DAGRYSCV--AKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVM--------EYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHG--VPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQ--ITNIQPDDADTYACTATNGGGTIE---KKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKEGGIFKCIARNEVGSIMKVYKLEVI-MPALVRLDKIEVRE 7449
            ++  ++P   A   C++   + N+  KWFK    IP      T+  R  +  Y K  NA     I   A E +   Y   + + E E  + + +  +  +   +AS D  EIS  D                   W L G  L P+ P   I  +  +  + +  VK   +GE++ +A N+       I  + +++ K + LD A  +PL+     +++  R       +  + W  +  P  I      +II +     L IN  + + +G +         S+R         G R+K F++ ++      GE  T  C++  +    V W +  A  +     L       + + L +K ++++D    I   + Q  ++  + Q+++   A P        +  VE    TLK    C V +  P   + W K+G+EI    +YS +       L IK    +D+  Y C      GT K    + V+ + I +      ++   G+    + +   +P    +W+  G+PLT  P   I+       L +++      G  +  A N  +A      + VK  P I    +SD ++  K+  +  C ++     PK   W K  Q   EI G  R E+   G K+ + +     ++   Y  +A ++ +S          +F      V  K  +S +  +          N ++  F    +  + +S  +  +     IT   +  +D   +Q+R E  G+           AK++    +LE       +  D + V  D  I L C  S    P +KW    K I P+          +  LI+++A     G+Y+C    + G D+ +  + +    I +  P  ++               VM +    E   F+ EI   DI+ +        L     +I  +G   +L L   +   +G     A N+  S +      + P ++G       + +         C       P   WY    +L    +V   + GK  TL ++ V+  D    Q        +D K    N+FV  P +      E     +G+T  L C VS     +++W    T                 +L   +     I  YTC A +   S       +   PP +  L P     + +    R  C   +   A ++WFKDG  I+   + +I ++G    L+        I KCL+ ++     +  T        ++     F       +V+    + L C    +P  ++ W K D   I+  R  +  +G    L + +    DAG Y C   ++  +TD    V       +     +   +E   G      C +S    P + W +D   +      +Y +I + K+  ++   A+  D G Y  +  A      + +   + I  P        L +  +K   E+   C  N +      +F+  N   +FD       S K  +L       L +  A   D   Y  + +N  G +V         E  +R+  P + D   +E K   F  +   L  TL           W ++G  VP  +  S R+      +T+++    D GEY   A  + S   L+    +   P  +   L  +     +  V  SC+ +      + WYR  +EI   K    K+   +  S+ +  I + + DD   YAC   +         ++  + +I PP+ +  + G +         + F   +   N  K  + W + N  ++ GD    ++      L I + K  + G Y   AK+   +      L + + PK  T      + + V +G  +    P +  P     WF ++ P+S   +       + ++L     +K  G +K + +N+ G       L+VI +P  VR   +EV E
Sbjct: 12240 RDQHVKPKGTAIFACDIAKDTPNI--KWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPED-IAEYAVEIEGKRYPAKLTLGEREVELLKPIEDVTIYEKESASFD-AEISEADIPG---------------QWKLKGELLRPS-PTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNA-------ITTAILTV-KEIELDFA--VPLKDVTVPERRQARFECVLTREANVIW--SKGPDIIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAEVEGKKTSARLFVT-----GIRLK-FMSPLEDQTVKEGETATFVCELSHEKM-HVVWFKNDAKLHTSRTVLISSE--GKTHKLEMKEVTLDD----ISQIKAQVKELSSTAQLKVLE-ADPYFTVKLHDKTAVEKDEITLK----CEVSKDVP---VKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVC----DCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHFEIEL-SEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAA----NLKVKELPLIFITPLSDVKVFEKDEAKFECEVSR---EPKTFRWLKGTQ---EITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLKFLTPLKDVTAKEKESAVFTVELSHD-----NIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDD--TSQIRVEAMGM--------SSEAKLT----VLEGDPYFTGKLQDYTGVEKDEVI-LQCEISKADAP-VKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTC----DCGTDKTSGKLDIEDREIKLVRPLHSVE--------------VMET----ETARFETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLR----VKPRVIGLLRPLKDVTVTAGETATFDCELSYEDIP-VEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQL-----TAKDFKTH-ANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSR-ENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCN-----LNVVPPHVEFLRPLTDLQVREKEMARFECEL-SRENAKVKWFKDGAEIKKGKKYDIISKGAVRILV--------INKCLLDDEAEYSCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVC-EVSKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSS--RTDGKVKVHELAAEFIS----KPQNLEILEGEKAEFVCSISKESFP-VQWKRDDKTLES--GDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIEKLRIVVP--------LKDTRVKEQQEVVFNCEVN-TEGAKAKWFR--NEEAIFD-------SSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLK-DIETMEKKSVTFWCKVNRLNVTL----------KWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELL----IIEAPTEFVEHLEDQTVTEFDDAV-FSCQLS-REKANVKWYRNGREIKEGK----KYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGAD---------VVF---LAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAK----LELAAAPKIKT----ADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKTIDTTAEQTSFRILEAKKGDK--GRYKIVLQNKHGKAEGFINLKVIDVPGPVR--NLEVTE 14027          

HSP 24 Score: 90.1225 bits (222), Expect = 1.456e-16
Identity = 145/596 (24.33%), Postives = 230/596 (38.59%), Query Frame = 1
Query: 3304 QLTVYSITEEHAGTFTCTATND-------HAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPG-RVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMI--KIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSV--VFIDNTITLTCIASGNPTPKI--KWLFKKKLIPPNAVGYKM-VGENQETLIVERAASMHGGEYSCLAENEG--------------GKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFK---ISLDGSTLTLFEVKHLDSGI-----YKCLAINIGESLNFTLVVLISPT----ILGKHSSKSVININ--EETDLYITCWSEGNPAPRYLWYKDNSQLISGG---RVEITNGG-KTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRE---TPEFLKGSTTNLWCNVSGFPTPQIRW 4941
            Q T+  + E     F   A N+         A+  + K++    P I KE + D      E  +L+C I  G P P I+WY+ G+ L++    ++   G+ + L V  + +++ G Y C ATNEV       ++ +   P+      +  K Y   G  L L+    G P P   W     +L    N   I N+    + ++    R    G Y    +NV G+     DV I + P      DK    + I+  +  + + S  P       W+        N V  K    E  E  +V  A S+       L EN G                 + +S+V + +P+     P K     P I       SCV+   PPA     K      +   K + K   ++ +    T+F VK+L  G+      KC  +  GES    +   I+P     I   H  + + N+N   +++  + C   G+P P   WY+   ++I+ G   R++   GG   L+I  V   D +VYQ   TN+ G       + V VP  I+     E       L+G   ++    SG P P I W
Sbjct: 31416 QFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIRKE-MKDVTTKLGEAAQLSCQIV-GRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSEN-ITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKP------DKPTGPIVIEALLKNSAVISWKPPADDGGSWIT-------NYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGK-----PTITAVT-KDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLG-GESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITW 31988          

HSP 25 Score: 88.5817 bits (218), Expect = 3.504e-16
Identity = 272/1239 (21.95%), Postives = 465/1239 (37.53%), Query Frame = 1
Query: 5704 VGGTVVLECLVSGIPTPAIT-WLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVA--------DPPAKITWER--HGVPLSSGGSIRISPDGTR--ITVENVKQYDAGEYKCHAQNEV--SKISLVFNVEVFLKP----RFYKNQLYTKIEAVQNTTVQMSCECTG---YPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGT---IEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQS--LTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKV--LTIPSVNKEGGIFKCIAR-NEVGSIMKVYKLEVIMPALVRL-DKIEVRERSGTSFSVLC-TAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCT-GTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRP-FRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQP-VITWERNGITLSKVKNYYTTTD--SGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQ-ITVELLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSE-NEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFT-RPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLNS-----NGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGKVDSIV--WLKNGVIVQNSSRLYIND----FNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLP-GNISANLGEVLILPCAAEGYPIPTISWY-KNKKLIKYDFV--KSLIKNGSLRIIGVQKEHSG 9246
            VG + + ECLVS  P+ AIT W+KDG  I   P +R+   G  ++L II +Q SDAG Y+CV +    +      + +   P      +  E  +  G  L L C  N     ++ + KDG    +    P +       L+     + LT+  A  TD+G Y     NA   + +E S  V+         VE   +W     R       G A        D P  I W +    +P        I  DG    + ++N    D  EY    + +   +K++L       LKP      Y+ +  +    +    +    +  G    P PT        EI A+           G   + +  ++ D A      A N   T     K+ E+   +P K         +  V E  Q  F C +      +  ++W+K   P +I  +D +    +G+   L I + + D+ G YT E   + G+ +   +       KF +      E  TV+ G +  F C         ++WF  D  +  +     +IS+  K   L +  V  +  I +  A+  E+ S  ++  LE      V+L DK  V +      ++ C  ++  P   +KW +DG+ I    +Y  K D    IL+I  A  +D G Y C  GT+K ++ + +V+  +I   K+E P   + V VGE       +E + P     W   G    +S      +   +  LI+   +   +G     A N          L+V   P IF    ++         + +C++     +P    W +    ++    +    D      +  S   EDE      A++     +L  + I ++ L  +     VT  E  S     ++       V W K+ Q L        +   + + I   DL  +DT        R  A   ++   L++    P F  K +    V++      +CE +    P +KW  +G+ I+   N+       +  + L+     + G+Y C      G+ + S  L++  +  +++ +     E ++      + E   D I   W   G  +  +    I +     +L+++  +   TG     A+N    A    HL VK   +  L P  +++   GE     C      IP + WY K KKL   D V  +S  K  +L +  V+ E +G
Sbjct: 12059 VGSSAIFECLVS--PSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLYLSCELNK--ERDVVWRKDGK---IVVEKPGRIVPGVIGLM-----RALTINDADDTDAGTYTVTVENA---NNLECSSCVKV--------VEVIRDWLVKPIRDQHVKPKGTAIFACDIAKDTP-NIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRYPAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWKLKGELLRPSPTC-------EIKAEG----------GKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEIELDFAVPLK---------DVTVPERRQARFECVLTR----EANVIWSK--GPDIIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAE---VEGKKTSARLFVTGIRLKFMSPL----EDQTVKEGETATFVCELSHEKM-HVVWFKNDAKL--HTSRTVLISSEGKTHKLEMKEVTLD-DISQIKAQVKELSSTAQLKVLEADPYFTVKLHDKTAVEK---DEITLKCEVSKDVP---VKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDK-TKANVTVEARLI---KVEKPLYGVEVFVGETAHFE--IELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAA----NLKVKELPLIFITPLSDVKVFEKDEAKFECEVSR---EPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLKFLTPLK---DVTAKEKESAVFTVEL-SHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQI-----RVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDEV-ILQCEISKADAP-VKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTC----DCGTDKTSGKLDIEDR-EIKLVRPLHSVEVMETETARFETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSA----HLRVKPRVIGLLRPLKDVTVTAGETATFDCELSYEDIP-VEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAG 13190          

HSP 26 Score: 85.8853 bits (211), Expect = 2.458e-15
Identity = 218/1014 (21.50%), Postives = 385/1014 (37.97%), Query Frame = 1
Query: 1729 KNASIEPFKDAELECNVFSTSSNVVLKWF-KSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGE--LICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSAT----GVPQPKITWEFNGSPV--TIDGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNL-DIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQD---NSLIIKGLSMEDQSAYICDAQNQHGKVQ---ESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNR------IMAKDNTLVIKTVKAEDEAIYTCIA-KNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITE--EHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEG------------ISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRV------EIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKA----SDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGE-NQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAP---YIDMKT----------------PNKNITYNPIIVGGNI--TFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAIN-IGESL-NFTLVVLISPT 4557
            K   +   ++A +   V  +   V +KWF KS+   E+K + + R+   +K       KL++ + S SD GEY  V     G  E    +   TL       K I   +  + +  C       P+  W  NG E++ ++ +  IV   +  Q+ I N   +DS E   +C      G D+V   L+   +  I+   + K+I  E ++ T+    T    G+      W  NG  +  T    +   +   +L+I  +       +  VA  +  ++        I F   IKD    I     +     C+V  +P   V+W++      +  + + DR  I ++   + L+I    M D   Y   A       +   E   +RI  I          K+V V    + V+   V E    A   W K+G EI +  +      +  + + + I   +  D   YT +A +N+     +   ++    P ++ + +  +  + G          G P+PKI W K  + L+   G +     DG + T+  I    E A  +TC A ND+        +SV+ P  +S +             + D      +     C ++  +   K+ WY   + +   P R       E   Q  I + Y ++E   G+Y   A+N V   S    ++ L AP++       + I++  KE     L+ + +G  +   + S  +  L+L      ++ SP+       T+  SE +G                        P  I+    + + + +  TL+    G P PKI+W F   L+ P+A  YK V + +  +LI+        GEY+C+A N+ GK   ++ + + +    + D +T                P+      PI     +   F   +   P   + WFK    +  S+            T  + + +  DSG+Y C A N +GES     L+VL+  T
Sbjct: 2800 KPKDVTALENATVAFEVSVSHDTVPVKWFHKSV---EIKPSDKHRLVSERKV-----HKLMLQNISPSDAGEYTAVV----GQLECKAKLFVETLHITKT-MKNIEVPETKTASFECEVSHFNVPSM-WLKNGVEIEMSE-KFKIVVQGKLHQLIIMNTSTEDSAEYTFVC------GNDQVSATLT---VTPIMITSMLKDINAE-EKDTITFEVTVNYEGI---SYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKD----IKVLEKKRAMFECEV-SEPDITVQWMKD-----DQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSI---------KKEVQVIEKQRAVVEFEVNEDDVDA--HWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLY---VNAPEPPQVLQELQP-VTVQSGKPARFCAVISGRPQPKISWYKEEQLLST--GFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDL--KVSWYSKDKKIK--PSRFFRMTQFEDTYQLEIAEAYPEDE---GTYTFVASNAVGQVSSTANLS-LEAPESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLSKINETLEL------LSESPV-----YPTKFDSEKEGT----------------------GPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSA-DYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLVLLEDT 3716          

HSP 27 Score: 84.7297 bits (208), Expect = 5.349e-15
Identity = 148/625 (23.68%), Postives = 232/625 (37.12%), Query Frame = 1
Query: 7624 TGTNKISQDSKSVDVVIIS--PPKIESPKKSIMVRVGEQVLLPCIVEGTRPF-RIHWYTPGNNQISSTILGEYQFLSE---QGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIF--RPTETETTGVLNTVLQMQCKILEGIPQPVITW--------ERNGITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGE-------------DRLTFQITVELLPKVSLPIS---VTGDEGSSVTIICKVEGKPKPTVTWKKDGQS----------LQNVLGNRFRFNSENEINIYDLKPEDTGNYICIG---ERSGA------EASTASTYLSIFTRPKFVYKPKLKNVVQETR------WKSFRCEATSHPKPDIKWMFNGRAIESKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGKVDSIV-WLKNGV-IVQNSSRLYINDF-----NLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLP-----GNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNGSLRII----GVQKEHSGVYFCVASSNQG 9279
            TG ++  + + S+   + S   P I    K +  ++GE   L C + G RP   I WY  G   I S    +Y+  S+     L +    ++  GVY C+A N+ G  E    L +   P+     P + +  G + + L++    + G P P +TW            IT+   ++Y     + L + N  +    G       NV G              D+ T  I +E L K S  IS      D GS +T     + + K    W+    +          L    G  FR +++N   I D  P +  + + I    E+ GA       A T  + +  +  P      K++N   E R      W S   E        +K +  G   E ++     G  +  S  SE       I       ++     E +    VR YQS+          L+CKV G    IV W + G  I+ +  +  I +F      LII      D  +YQ  A+N  G   G   L V+ P    L       G + A  GEV+ +     G P P I+W K + LI  +    +I   S   +    GV+++ +G Y   A +  G
Sbjct: 31438 TGLSRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVG-RPLPDIKWYRFGKELIQSR---KYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYI-GRPVPAMTWFHGQKLLQNSENITIENTEHY-----THLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISD--PLEVSSVVIIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEP------ITPKSDVPIQAPHFKEELRNLNVR-YQSN--------ATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFG 32035          

HSP 28 Score: 81.2629 bits (199), Expect = 5.943e-14
Identity = 192/985 (19.49%), Postives = 355/985 (36.04%), Query Frame = 1
Query: 2107 SWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDE------VRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIINETI--GTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIA-FTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRIM---AKDNT--LVIKTVKAEDEAIYTCIAKNQVGTAKFDIEL----------------------------------------DVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDS----KMIKIYT-----KEGEKLTLNCKIDGFPTPTKKWSWKS-SILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIIL----ESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNI---TYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAINIGESLNFTLVVLISPTILGK----HSSKSVININEETDLYITCWSEGNPAPRYLW----YKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNV 4824
            S F    E++ +     + + + E++  +S+ +   S E+   A     ++E      ++  L+   L K  S+ +      EG+     C   G P P +TW   G  ++      +  T    T +I+ ++ + +G +  V  NS G     F L I      +  VT+                   PPRVK           P A+     +        K +S  +      + + QH  V           A PKI  F +++     + L  V+   V+ +K    ++W K+GK+++ +       + D T  L I  +   D+  Y C    + GT+K +++                                          + +KP+I+   +    + D  V     +  G+P+P   W K G+ +T     ++     G  L ++      +G +TCT  N   +V    K+++KA        I D E       + + I        + E  +      EI  ++  A  +  L +  +      S E K +   S +       I    +AS+       IK ++      EG++L L   I G      KW      + + +   +G++ S      L I Q     +GI TC      G  K  YD+ +     ++P  I       +     +  TC  SG P+P+I+W      I  ++        N  +L +  A+    G+Y+  A+N  G+    + + V  P ++   P++ +   T     + G+ +   V  S    E  +         S+ + +F      S  ++ E   ++      + I+    L  +   ++   I G      +  S I+I+E   L + C   G P P   W     K +SQ      +E T+   TL+I  V++ D  +Y   + NE G D    ++++
Sbjct: 33424 SSFKKTSEMEASSSVREVKSQMTETRESLSSYEHSASAEMKSAALEEKSLEEKSTTRKIKTTLAARILTKPRSMTV-----YEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTS-------------------PPRVK---SPEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTE-KVQHLPVS----------APPKITQFLKAEASKEIAKLTCVVESSVLRAKE---VTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDS-VAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKA--------IKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEI--KMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAG--ATDVKWVLNGVELTNSEEYRYGVSGS---DQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVL-PLVE--EPSREVVLRTSGDTSLQGSFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQE-SFVEMSSSSFMGISNMTQLESSTSKMLKAGIRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 34347          

HSP 29 Score: 78.5666 bits (192), Expect = 3.740e-13
Identity = 101/452 (22.35%), Postives = 191/452 (42.26%), Query Frame = 1
Query: 7963 PKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKN---YYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDR----LTFQITVELLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEIN---IYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFV-YKPKLKNV-VQETRWKSFRCEATSHPKPDIKWMFNGRAIESK-----LNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPR-VRVYQSDDPSESIKRTILMCKVEGKVDSI--VWLKNGVIVQNSSRLYI----NDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIK-YDFVKSLIKNGSLRIIGVQKEHS 9243
            PKIF   +++T G   +    + +++ G P P   W +NG+ + +      Y+   +    +   +  ED  S+   A N+AGE      L  Q    +     L   V  ++ +  T  C+   +P   V W KDG  +    G+++R +S+ +++   I  +   D  +Y C+      E     T   +      V +  +L+++ V E+      C   S    + KW  N   ++S       +  GR ++T++ V  E+ GEY  +   +  + +         KPR + + Q     +  +  I+  +V+  ++S+  VW+K+G  VQ S R++I        L+I     +D G Y            G+V   V S  V T L  +++   G   +L C      + ++ WY N + IK  D V++++K    R++ + + H+
Sbjct: 2078 PKIFERIQSQTVG-QGSDAHFRVRVV-GKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECET-SEPFVKVKWYKDGMEVHE--GDKYRMHSDRKVHFLSILTIDTSDAEDYSCVL----VEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELEC-IVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKM------KPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVS--VYSVDVITPL-KDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLV-INRTHA 2509          

HSP 30 Score: 78.5666 bits (192), Expect = 3.867e-13
Identity = 104/381 (27.30%), Postives = 162/381 (42.52%), Query Frame = 1
Query: 7609 GRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQ---VLLPCIVEG-TRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVR---KDHSGVYRCVANNDAG----YQEIRI--TLEVL------VQPKIFRPTETE---------TTGVLNTVLQMQCKILEGI-----PQPVITWERNGITL---SKVKNYYTTTDSGLF--IFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVS----------LPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSEN----EINIYDLKPEDTGNYICIGERSGAEASTASTYLSI----FTRPKFVYKPKLKNVVQETRWKSFR 8583
             R +C G  + SQ   SV  V ++  +I      IM  VGE+   V   C +E   +  ++ WY  G  Q+ ++   +Y+   E G+ I  V+   K   G YRC   ND G    Y E+ +    EV          KI R T+T          T  + N    +   +  G+     P+P +TW ++G  +      K Y   +D GL+    NS+  +D+   T +A+N  GED    ++TV L P  +          L  +    EG SV    +V G P PT+ W+KDGQ L   LG       E      ++I D  PEDTG Y      + A +++   +L +    + + +F  K + +  VQ+   K+ R
Sbjct: 32468 ARISCGGAIR-SQKGVSVAKVKVASIEIGPVSGQIMHAVGEEGGHVKYVCKIENYDQSTQVTWYF-GVRQLENS--EKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLS--LGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNT-AGSTSCQAHLQVERLRYKKQEFKSKEEHERHVQKQIDKTLR 32841          

HSP 31 Score: 78.1814 bits (191), Expect = 5.776e-13
Identity = 53/182 (29.12%), Postives = 82/182 (45.05%), Query Frame = 1
Query: 5707 GGTVVLECLVSGIPTPAITWLKDG--IPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQ----MEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDG----NSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKR--TDSGLYQCNASNAIG 6216
            G T   E  +SG P P ++W +DG  I  + LP  +        +L I A+  +++GRYS  A N  GQ     E+ +      P  + R   L    ++ G ++RL     G P P + F++DG    +SLD                 +SQE  + +L  A+    DSG Y  NA+N++G
Sbjct:   20 GSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQR---LQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLD---------------FQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVG 183          

HSP 32 Score: 76.6406 bits (187), Expect = 1.378e-12
Identity = 139/605 (22.98%), Postives = 234/605 (38.68%), Query Frame = 1
Query: 3715 KMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKI---IQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAAS--MHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNK-NITYNPIIVGGNITFSCVMNSTPPAEI--KWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHL----DSGIYKCLA----INIGESLNFTLVVLI-----SPTILGKHSSKSVININEETDLYITCW----SEGNPAPR--YLWYKDNSQ--LISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKG------STTNLWCNVSGFPTPQIRWTYM--ETIXXXXXXXXX------XQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKI---VSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNN--LRVNITNRGTQLHLLNAQE-SDIGIYKCLVSNKLGLDKQAWTVDIMIPP 5382
            +M  + TK GE   L+C+I G P P  KW      L +Q   + ++ S    + L +     E +G+YTC  TN  G  + S  +++  +P+        +K    + +T+ L  +  G P P + W   +KL+  N+    +      T +V +      H G+Y         K Q +++       +D++  +K +    PI++   +  S V++  PPA+    W  N + + K   K+  +  L  S +++   + +    ++G Y  ++      I + L  + VV+I      P   GK +  +V       D  +  W    S+G    R  YL  ++  Q   IS    EI        +K +    +  ++    N  GE + +       P S   I      E L+       S   L C V+G P P ++W     E I   L            QL   +V     T Y   ATN+ GS        +  P KI    +L+       L+   + +       P   I W K  +LI NN   +V +T   T L   N  E  D G Y     N+ G+D++   +D+   P
Sbjct: 31465 EMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKEL-IQSRKYKMS-SDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLL-QNSENITIENTEHYTHLVMKNVQRKTHAGKY---------KVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYV-VEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAVTK-----DSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRE--TVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVP 32049          

HSP 33 Score: 75.485 bits (184), Expect = 3.919e-12
Identity = 176/919 (19.15%), Postives = 325/919 (35.36%), Query Frame = 1
Query: 5161 RLSCNSDAAPVATIEWFKDGELIRNNLR--VNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLV--SGIPTPAITWLKDGIPINRLPSYRYRIIGN-SKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDR-----------NRILNEYIIKVGDELRLPCP---------------------------ANGSPNPNIAFFKDGNSLDM---FDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEP-KVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGS---IRISPDGTRITV-ENVKQYDAGEY-KCHAQNEVSKISLVFN-VEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVII----PPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSP----------------TPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNK-EGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF-----RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIIS 7680
            R SC++D  PV T+ W + G+++  + R  V  T   +   + + Q SD G Y  +V N  G  +  +T+ I          KA   + A+     +       P+P++   K    +   + + S +  H    S  ET     +                +V + P   P     +           L C+V  S +    +TW KDG  +     +++    + + +L+I  +  SD G Y C      G  +  +     A  SI             ++   E  +    E + P P                           A G P P   + KDG ++     + LS +K   +            L ++    +DSGLY C   N+ G       + ++   + +   V   K +  T Q +++      V +  ++       + +S   S   + +  + +++ + E VK+  A    K     E++K S     V    + + +  Q+   I   Q   ++ +          + W     E L + E Y ++ +   +  + I      D     C +    G ++ ++++++       P  + +   P +  + E   + F C +       P I W K N PI I          N  SL I N    +SG+YT +AKN  GQ S T  L V    + P+   + R +    L  S + Q     +                    + +             +FV  +++  + I ++ + E    K +     G   K+  L    P+ + +D+       G   +V C   G P P + W+  G+ I      R+  +       L I D +++D G YT +  N+   DS +V++ I S
Sbjct: 33506 RFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQ---------KARVTEKAVTSPPRV-----KSPEPRV---KSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTE----------------KVQHLPVSAPPKITQFLKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFF------------LEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITPQKKAV------VQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQM--SINEGQRLVLKANIAGAT----DVKWVLNGVE-LTNSEEY-RYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQ---PRSQNINEGQNVLFTCEISG--EPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSLQGSFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMTQLESSTSKMLKAGIRGIPPKIEAL----PSDISIDE-------GKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHIRS 34349          

HSP 34 Score: 73.9442 bits (180), Expect = 1.087e-11
Identity = 116/522 (22.22%), Postives = 218/522 (41.76%), Query Frame = 1
Query: 7873 RKDHSGVYRCVANNDAG-YQEIRITLEVLVQPKIFRPTETETTGVLN------TVLQMQCKILE-GIPQPVITWERNGITLSKVKNYYTTTDSGL--FIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISVTGDEGSSVT--IICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNS-ENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNV-VQETRWKSFRCEATSHPKPDIKWMFNGRAIES----KLNSNGR-GSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKV-EGKVDSIVWLKNGV----IVQNSSRLYIND--FNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSP--PVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNG---SLRIIGVQKEHSGVYFCVASSNQGEVHSQPIYLTVQIPGGWSAWQE 9345
            RK H  + + ++ +DAG Y  +   LE   + K+F  T   T  + N           +C++    +P     W +NG+ +   + +       L   I  +   ED    T     V G D+++  +TV  +   S+   +  +E  ++T  +    EG    +  W K+G  +++    + R     + +NI ++   D  +Y  +   +G   STA+ Y+         ++  +K++ V E +   F CE  S P   ++WM + + ++     K+        + + S R  +AG+Y  +A    G+V  + +       R+R  + +      +R ++  +V E  VD+  W K+G+     VQ   +  +      + I++ +  D G Y  +A    G  +  V L V +P  P        ++   G+         G P P ISWYK ++L+   F    + +G   +L +I    E + VY C A ++ G V +    L+V++P   S  QE
Sbjct: 2846 RKVHKLMLQNISPSDAGEYTAVVGQLEC--KAKLFVETLHITKTMKNIEVPETKTASFECEVSHFNVPS---MWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTF----VCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGI---SYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFV---AGKATSTATLYVEAR---HIEFRKHIKDIKVLEKKRAMFECEV-SEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAG---GNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAH-WYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVA----GRNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYG-VATTSASLSVEVPEVVSPDQE 3339          

HSP 35 Score: 72.7886 bits (177), Expect = 2.268e-11
Identity = 147/730 (20.14%), Postives = 263/730 (36.03%), Query Frame = 1
Query: 2947 PPAVISWLKNGKEIEYSNRIMAKDNT----LVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKP-------IIIGDFKT----FIDAKD----------------------------------GDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPD---GSQLTVYSIT-EEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVEL--NCIITSGNPSPKIEWYKNG-------------QPLVEIPGRVEIAGQKNILKVYGKNED-ETGSYECKATNEVSSDSRFFQITIL-------------------VAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPT--PKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGS-TLTLFEVKHLDSGIYKCLAINIGESLNFTLVVLISPTILGKHSSKSV-------ININEETDLYITCWSEGNPAPRYLWYKDNSQLISGG----RVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFV 4830
            P   ++W +   +IE S        +    L+I+   AED   +TC A N+ GT      L VQ           +   F T    F++++D                                  G  +V  CQ  G+PKP + W+K G PLT   G R  +S +   G    V S+T  + AG +T    N H            A   + +E  +DYE+  K   E+     +T+    PK+     G             Q L+    R ++A    +++ Y ++++    S+E +   E+  + R  + T+                          DS++      EG  +T +CK+ G+P P   W +K          + +      +  L I  +  E +GIYT   +N+ G+A  S                   ++++    L     G PT  P ++ + + + + P +V    +  +   +   R +                +  ++ +  ++ P   +K     +++   + G    F   +   P  E  WF +   I       +  I  DG+ +L +      DSG +  +A N     + ++++ +      +H  K +       +NI E + L +   + GNP P  +W K++  ++       R+E T G   L I      D + Y     N+AG D     VNV V
Sbjct:  970 PSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTT--GYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHG--------ETSASASLLEE--ADYELLMKSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALI----RKKMAKDTVVVRTYVEDQEFHISSFEERLIKEI--EYRIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAW-YKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICS-----------------GKLYVEPAAPL-----GAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKP----VSFK-CLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDY-THKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAV---EHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEV 1649          

HSP 36 Score: 72.7886 bits (177), Expect = 2.507e-11
Identity = 56/173 (32.37%), Postives = 73/173 (42.20%), Query Frame = 1
Query: 5425 LGGNLYLFCVSEGRPKPKIEWRKDGSRI-----DFRRVLLSDDG-YHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGP-----TLDPGGKRYYK-VERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIG-NSKQLEIIAMQASDAGRYSCVAKNTFG 5904
            +G N+         P+P + W K G +I     D +    SD G Y LT+NS    D   Y  +A N +G+      + VT  P     TL P  KR     E   G +V  E  VSGIP P + W KDG P++  P+      G +   L I      D G Y   A NT G
Sbjct: 32630 VGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAG 32802          

HSP 37 Score: 72.4034 bits (176), Expect = 2.964e-11
Identity = 142/666 (21.32%), Postives = 237/666 (35.59%), Query Frame = 1
Query: 4375 WFKNEIDIYKSLPKDRFKISLDGSTLTLF--EVKHLDSGIYKCLAINIGESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGK--TLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEF-------------LKGSTTNLWCNVSGF--------------PTPQIRWTYMETIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRI----DFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTY----------------------GPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGN---SKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFK---DGNSLDMFDLSPN-----KDASYKKRLLVSQERQMLTLYSAK 6168
            W+K+ I+I   + ++R K  ++     +F  E +  D+G Y  +A     S+   +     P +L +      + +             G P P+  WYK+   L +G + +  + G+  TLL+ +    D +VY C   N+ G    +  ++V VP  ++    +E P +              +G      C VSG               P+   R T  E         +  QL            YT +A+N  G      +  L  P  I+         I ++ E+ +   S +   A  E     EL        ++     L LL    S+  +Y      K   +K+        P  IK  S A    +++G    L     G PKPKI+W  +G  +    D++ V   DD + L +  T   D G Y C+A N +G+T  S  +++                        GP      K    +    G   + E  V G P P +TW K+   +    S  Y II N   S    +   Q  D+G Y C A+N  G+     ++ +               +++  D    PC A  +P     F +    G +++  D         KD   K  L+  + +Q+   + AK
Sbjct: 3179 WYKDGIEINFQV-QERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQP---VTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVS--PDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFE---------DTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILH------ERIEQEIEMEMKEFSSSFLSAEEEGLHSAEL-------QLSKINETLELL----SESPVY----PTKFDSEKEG-----TGPIFIKEVSNA---DISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDD-HSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQL--CTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLV---------------LLEDTDMTDTPCKAKSTPEAPEDFPQTPLKGPAVEALDSEQEIATFVKDTILKAALITEENQQLSYEHIAK 3782          

HSP 38 Score: 69.707 bits (169), Expect = 1.715e-10
Identity = 101/478 (21.13%), Postives = 169/478 (35.36%), Query Frame = 1
Query: 5707 GGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRII---GNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGA------PPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKK-RLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVR---TPPEFDTSNVEPKVNWFTNQTRS-----------------------------------------------LECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGTRITVENVKQY--DAGEYKCHAQNEV----SKISLVFNVEVFL---------------------------------------KPRFYKNQLYTK-IEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISV 6822
            G T   +  V G P P   W  DG  I  +  Y ++++     ++ L I+    SD+G ++ VA+N  G+  I + +T+ A      P  +++ + +N   IK G  L +   A G+PNP+I + K+ +      + P+K   Y K R+  ++    L + S    DS  Y   A N  G D     V V      PE +   + P+  +   +  +                                                EC L  + DP   + W   G PL +   +R+  +    +++    Y  D+G   C A N+     +  +L+   E  L                                       KP      LY + +  ++  T +  C  TGYP P + WY   Q I   K    ++D   G   + I + +  D      TA N  G IE K ++ +
Sbjct: 1471 GQTARFDLKVVGRPMPETFWFHDGQQI--VNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVN---IKEGSRLEMKVRATGNPNPDIVWLKNSDI-----IVPHK---YPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIV---LYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYD---GIHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEI 1929          

HSP 39 Score: 68.9366 bits (167), Expect = 3.054e-10
Identity = 169/841 (20.10%), Postives = 281/841 (33.41%), Query Frame = 1
Query: 1447 GHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNV-TLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKNASIEPFKDAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLI-------------ILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASV--DEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEV---------------------------------------RIKLSYISLPKILSLDLAKEIPLEGDQQ------------------------TVRCSATGVPQPKITWEFNGSPVTIDGNIIINETI-GT--LDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNI------DGSYGENITIR----------------------------------CQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNS---LIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIA---APKIAFT-------QSKQVVVESTLKKVIVCLVV---ESKPPAVISWLKNGKEIEYSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVK-----APPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQP 3540
            G   +    VQS+    + WY N  ++   ++  + +  TS V TLEI   +    G Y A            KG   D   + V       +  +       +D E+  +VF                 EL  T+ + +  +KK+    +S  +             + S   S + E    A  E  + E     K  T  AA +    + ++  + +S   SC     P PT +W   G+ L  T  R  +     +S  +IS+V+  D G      +NS G  E                                        R+K    S PK +S    K  P E  Q                         T    ++ +   ++TW  +G  +  +G+   + +  GT  L IN + ++ +G++VC  +   G+S+ +          I + V+ I      D    E+   R                                   +  G+P P   W +         I  G +Y +++D     L I      D   Y C  +N  G V  S ++ I  I    A K++         Q K VV E   +K +    +   E+K    ++  +   ++  S  +     T + K++   +E   T  A  +V T               I  F T +   +G  +VL+    G     ++W   G  LT     R  +S     LT+   +    G  TC +      V  ++ +++      AP  IS+       I   +NV   C I SG PSP+IEW+KN  P
Sbjct: 33315 GQNTRFILNVQSKPTAEVKWYHNGVEL--QESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCT-------NYKGEASDYATLDVTGGDYTTYASQR------RDEEVPRSVFP----------------ELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHSASAEMKSAALEEKSLEEKSTTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLS-TSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPKITQFLKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKA-----ITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSI-VHEEITKTSQASEEVRTHAE------------IKAFSTQMSINEGQRLVLKANIAG--ATDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQP--RSQNINEGQNVLFTCEI-SGEPSPEIEWFKNNLP 34100          

HSP 40 Score: 68.9366 bits (167), Expect = 3.671e-10
Identity = 152/684 (22.22%), Postives = 257/684 (37.57%), Query Frame = 1
Query: 2995 SNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAK-FDIELDVQTK------PIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHA--GTFTCTATNDHAAVVKEFKVSVKAPPQISK-EGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKN---EDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKK-WSWKSSILDLQRNPFGITNSPIDK---NDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQ-FNDKSVVFIDN-----------TITL----TCIASGNPT-----PKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYS--CLAENEGGKDQKNSI---------VTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDG-STLTLFEVKHLDSGIYKCLAINIGESLNFT--LVVLISPTILGKHSSKSVININEETDLY-----ITCWSEGNPAPRYLWYKDNSQLISGG--RVEITNGGKTLLIKK-VRRSDDSVYQCHVTNEAGEDKKNFDVNVF-VPPSINGISMRE 4863
            SN+   KD    I  +    E  +   A+N+ G ++     + ++TK      P I  + K  +  K G+   L CQ  G P P I+W + G+ L      +  +S DG   T+  +TEE    G +TC ATN+   V    K+ ++A PQ      + +   G+  +     ++  G P P + W+ +GQ L++    + I   ++   +  KN   +   G Y+ + +N   +      + I   P      ++       E L  N  +  +  P     SW             ITN  ++K    +    Q+ S    + TC   N+  +A   + V    +  I       SVV I +           TIT     +C+ +  P       KI+  + +K          +  E     +      + G EY      EN GG+ + + I         V + AP+   +  N N+ Y       N T  C +   P   +KW++   +I     K R +    G   L +  V   D+ +Y+  A N G S++ T  L V +   I   H  K++  +     L      I     G P P   W K    + + G  +V +T    +L+    V R D   Y     N  G D+K  +++V  VP    G+ + +
Sbjct: 31407 SNKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIRKEMKD-VTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQ--SRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWF-HGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVI------EALLKNSAVISWKPPADDGGSW-------------ITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQ-----SNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKI---HLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSD 32059          

HSP 41 Score: 68.5514 bits (166), Expect = 4.267e-10
Identity = 56/231 (24.24%), Postives = 95/231 (41.13%), Query Frame = 1
Query: 5545 HLTVNSTMETDAGRYQCIAENTHG-----QTDISFDVQVTYGPTLDPGGKRYYK-VERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNE-YIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIG 6216
              T+   +E     ++  AEN  G     +T +S   ++T G    PG ++  K V   +G    L C + G P P I W + G  + +   Y+    G +  L ++  +  D G Y+C+A N  G++E    + + A P       L E Y   VG  LRL     G P P + +F     L   +    ++  +   L++   +        ++T +G Y+   SN  G
Sbjct: 31416 QFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEA--PGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQ--------RKTHAGKYKVQLSNVFG 31636          

HSP 42 Score: 67.781 bits (164), Expect = 6.815e-10
Identity = 104/481 (21.62%), Postives = 184/481 (38.25%), Query Frame = 1
Query: 1903 LIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEK------EISFIDNDSITAS-------CRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQES-QIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLK-------------KVIVC---------LVVESKPPAVISWLKNGKEIEYSNRIMAKDN-----TLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPK 3222
            L+++ A   D   Y C A+++ GV+     +        S D++       I     D++T+        CR   T     SW+   +++ P+  R   +   +++ Q++I+   P+D G     A N+ G       LS  +   IL   + +EI +E                    EF+ S ++ +   + +     L +++I + ++     + + S     K  +   G GP     V+N D S G+  T+   V G P P+++W     G    P A     F   D+SLII    +ED+  Y C A N +GK   S  ++I+         T+++  V +S  K             K I C           V  +P   ++W K  K++  S       N     T ++   + ED  +Y C A+N +G +    EL               +  +D D+    C+ K  P+
Sbjct: 3296 LLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDL-KVSWYSKDKKIKPS--RFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMK------------------EFSSSFLSAEEEGLHS---AELQLSKINETLE-----LLSESPVYPTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWF--FNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGH-KDTETESAVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAEL--------------LVLLEDTDMTDTPCKAKSTPE 3730          

HSP 43 Score: 66.6254 bits (161), Expect = 1.812e-9
Identity = 57/200 (28.50%), Postives = 91/200 (45.50%), Query Frame = 1
Query: 2566 GPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQ----DNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVI-VCLVVESKPPAVISWLKNGKEIE---YSNRIMAKDNTLVI--KTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKP 3135
             P  K+ + N++  Y  N T+ C+V G P P VKW R    G  I IA G +Y I +     + LII  ++ +D + Y   A NQ G V  +  + +   A   +  T      V +   +V+ + +    KP  VI+W K    I+   +   I+ +  T ++    V+ +D   Y   AKN+ G  +  +ELDV   P
Sbjct: 31854 APHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYR---QGKEI-IADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVP 32049          

HSP 44 Score: 65.4698 bits (158), Expect = 3.173e-9
Identity = 279/1501 (18.59%), Postives = 533/1501 (35.51%), Query Frame = 1
Query: 4990 QLHFMNVDKSHITRYTCI---ATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNN---LRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRI-----DFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLE-------CLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQM-----EIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPN------PNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNAS-NAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGT--RITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTA----TNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVI--LWTKENSPILIGDTDYYLTFNNGQSLTILN----PKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKEGG---IFKCIARNEVGS-IMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPC-IVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNT-VLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGL--FIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEIN---IYDLKPEDTGNYICIGERSGAEASTASTYLSIFTR--PKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAI----ESKLNSNGR-GSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQ--SDDPSESIKRTILMCKVEGKVDSIVWLKNGVIVQNSSRLYINDFN----LIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNGSLRIIGVQKEH---SGVYFCVASSNQ 9276
            +LH ++V  S    YTC+      E  S  KL   V   P + V    +++  ++K   L LSC  +      + W KDG+++      +   +      L + +A ++D G Y   V N   L+  +    + +            H    G    +F     +  P I+W K    I     D   +L   +  +L + + M  D   Y    E       ++              G+R  ++ + +    + E         +S    P   W   G  +   P+   +  G  + L +  ++   AG     A N          EI +D  +           L +  +    + R  C      N      P+I       S D FD+     A  KK +LV  + Q          D G+Y            +    +R++     +   V+        +T +  C L   +     + W ++   L +  ++ IS +G   ++ ++ V   D  + K     +V ++S    ++V     ++  +L+ K  AV+   + + CE +   P  + W++  +EI+   +   K D LR   +++I      D   Y C      T    T+E +  I V  P   ++  +G   H              +   +++P +   W  +  P L    D  +  +  + + IL+      + E       AK+ A        L   +P    +D  +F +           F+C     P  +  W      I+  D    +       + I S   E     +F+   ++  G  I++  +L+ + P    L  +  +E+    F+V  + +      +KW ++ + +        + + +T  +   D   +DT +        +   S++   V+   P      +       ++V+L C I +   P  + W+  G     S          ++ LI+ +  K   G Y C    D    ++ I    +   K+ RP  +    V+ T   + + +I E        W+  G  L +  +     +  +   + ++ +++  G +   A NV     L  +  V  L +    ++VT   G + T  C++  +  P V W   G+ L+    ++    SE +++   + D+K ED G            A    T+ ++F +  P    KP     V+E       CE  S     +KW  NG  I    + ++ ++GR   + +     E+   Y C AK+     + S  L V+  P V   +  +D      +     C++  +   + W K+G  ++   +  I        L+IN+    D   Y C    +     G + +L +   VFT    NI  +  + + L C     P   + WYK  + I       ++  G  RI+ +Q  H   +G Y C   S++
Sbjct: 12101 KLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLV--VEELPVRFVKT-LEEEVTVVKGQPLYLSCELNKE--RDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIRDQHVKPKG--TAIFACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRYPAKLTL-------------GEREVELLKPIEDVTIYEKESASFDAEISEADIPG-QWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEIELDFAVP----------LKDVTVPERRQARFECVLTREANVIWSKGPDII-----KSSDKFDII----ADGKKHILVINDSQF--------DDEGVYTAEVEGKKTSARLFVTGIRLKFMSPLEDQTVK------EGETATFVCEL---SHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKA----QVKELSSTAQLKVLEADPYFTVKLHDKT-AVEKDEITLKCEVSKDVP--VKWFKDGEEIVPSPKYSIKADGLR--RILKIKKADLKDKGEYVCDCGTDKTKANVTVEARL-IKVEKPLYGVEVFVGETAH--------------FEIELSEPDVHGQWKLKGQP-LTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKELPLIFITPL---SDVKVFEKD-------EAKFECEVSREPK-TFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLKFLTP----LKDVTAKEKESAVFTVELSHDNI---RVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEA---MGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDEVILQCEISKADAP--VKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREI---KLVRPLHS--VEVMETETARFETEISEDDIH--ANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTA--GETATFDCELSYEDIP-VEWYLKGKKLEP--SDKVVPRSEGKVHTLTLRDVKLEDAGEVQLT-------AKDFKTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEV-SRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKD----FKTSCNLNVVP-PHVEFLRPLTDLQVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTA--RTSGMLTVL-EEEAVFTKNLANIEVSETDTIKLVCEV-SKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSR 13467          

HSP 45 Score: 62.7734 bits (151), Expect = 2.100e-8
Identity = 55/209 (26.32%), Postives = 92/209 (44.02%), Query Frame = 1
Query: 7144 FSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDM--MNFVISNNAKVLTIPSVNK-EGGIFKCIARNEVGSIMKVYKL----EVIMPALV-RLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGI-----FRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGE 7731
            F+   +++ V  G++  F+    G P P + WF     IS   +  +    S+    LTIP+V K   G +   A N  G      +L    E   P  V RL  + VR+ S     V  T  G P PV+K+ RDG  I     F+   + D  +  L I +A  ED+G Y+   TN + + + + ++++    ++ + K   +V   +
Sbjct:    8 FTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVT--GIPTPVVKFYRDGAEIQSSLDFQISQEGDLYS--LLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKTIVSTAQ 212          

HSP 46 Score: 62.003 bits (149), Expect = 4.531e-8
Identity = 50/171 (29.24%), Postives = 74/171 (43.27%), Query Frame = 1
Query: 7894 YRCVANNDAGYQEIRITLEVLVQPKI-------FRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSL--KIEDEGSLTCIAKNVAGE----DRLTFQITVELLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQN 8367
            +R  A N+ G    R T  + ++ K+        R    + T  L    Q+ C+I+ G P P I W R G  L + + Y  ++D        +  + EDEG  TCIA N  GE     +L  Q T +  P   L     G  GS++ +     G+P P +TW    + LQN
Sbjct: 31430 FRVFAENETGLSRPRRTA-MSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIV-GRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQN 31598          

HSP 47 Score: 61.6178 bits (148), Expect = 5.920e-8
Identity = 88/370 (23.78%), Postives = 155/370 (41.89%), Query Frame = 1
Query: 8248 VSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENE-----INIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGR--------AIESKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSD-DPSESIKRTILMCKVEGKVD------SIVWLKNGVIVQNSSRLYINDFNLI-INQAKSKDTGIYQCIASNSAGEAQG------QVHLLVKSPPV-FTLLPG-NISANLGEVLILPCAAEGYPIPTISWYKNKKLIK-YDFVK-SLIKNG-SLRIIGVQKEHSGVYFCV 9261
            V+L  SV    G  V ++   +G+P PTVTW+KD ++    LG+  R++ EN      + I  +   DTG YI   E    E  +++  + +   P    K ++K+V + T    +         P I ++   R         +  K +S    S  L  +  +    ++ +A+N +G  E     E +    V     D    +S K ++++   +   D        V  + G   Q  S   I+    I ++Q K +    ++  A N  G +         V  L+ +P V  + +PG  ++  +G  + L    +G P P+ISW K+   +K  +FV+ S  +N  +L I   +KEH G Y  +
Sbjct: 28202 VALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKN----LGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSST---SFKLIDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIGPITVKELIITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVI 28564          

HSP 48 Score: 61.2326 bits (147), Expect = 7.297e-8
Identity = 56/202 (27.72%), Postives = 85/202 (42.08%), Query Frame = 1
Query: 7669 VIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQG----LIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKI---LEGIPQPVITWERNGITLSKVKNY---YTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLP 8244
            V I  P  +   +++ VR      L C V G     + WY  G   I+  +  +Y+    +G    LII  V  D + VY+  A N  G      +LEV V  KI  P   E  G ++ +      I     G P PVITW++    +    +Y    T + + L   N ++ +D G     AKN  G D+ T ++ V  +P
Sbjct: 31850 VPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGL--KYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVP 32049          

HSP 49 Score: 60.8474 bits (146), Expect = 8.341e-8
Identity = 46/169 (27.22%), Postives = 73/169 (43.20%), Query Frame = 1
Query: 5419 VALGGNLYLFCVS-EGRPKPKIEWRKDGSRIDFR-----RVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQ 5907
            V L G+   F     G P P++ W +DG  I        ++  SD    LT+ +  + ++GRY   A N  GQ   + ++ V          +R   +    G  V L+  V+GIPTP + + +DG  I     ++    G+   L I      D+G YS  A N+ G+
Sbjct:   16 VVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGR 184          

HSP 50 Score: 60.8474 bits (146), Expect = 8.411e-8
Identity = 82/303 (27.06%), Postives = 127/303 (41.91%), Query Frame = 1
Query: 5194 ATIEWFKDGELIRNNLRVNITNRGT--QLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIP--PSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFR--RVLLSDDGYH--LTVNSTMETDAGRYQCIAENTHGQ--TDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRII--GNSKQLEIIAMQASDAGRYSCV-------AKNTFGQMEIFM-----DVTIGAPPSIDRNRILNEYII----KVGDELRLPCP 6018
            A   W KDG  IR + +      G   +LH+++ Q SD G Y C++  +LG  ++  T  +++   P     +      V  G  LYL C  E   +  + WRKDG  +  +  R++    G    LT+N   +TDAG Y    EN +    +     V+V     + P   ++ K +    GT +  C ++   TP I W K    I   P+ +  I+  GN   L+I      D   Y+         AK T G+ E+ +     DVTI    S   +  ++E  I    K+  EL  P P
Sbjct: 12074 AITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVL--RLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLYLSC--ELNKERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIRDQHVKPK----GTAIFACDIAK-DTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRYPAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWKLKGELLRPSP 12367          

HSP 51 Score: 58.9214 bits (141), Expect = 3.725e-7
Identity = 53/230 (23.04%), Postives = 98/230 (42.61%), Query Frame = 1
Query: 2497 QWVCVATNSAGSSRK-------SFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQD---NSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAA--PKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRIMAKDNT----LVIKTVKAEDEA-IYTCIAKNQVGTAKFDIELDVQTKP 3135
            ++   A N  G SR           L  G  P I+  + ++    GE   + CQ+ G+P P +KW R     +   +    +Y ++ D   ++L +     ED+  Y C A N+ G+V+ S ++ +       P     +     V STL+  ++ +    +P   ++W    K ++ S  I  ++      LV+K V+ +  A  Y     N  GT    +++++Q KP
Sbjct: 31429 EFRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYR-----FGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYI---GRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKP 31650          

HSP 52 Score: 58.5362 bits (140), Expect = 4.868e-7
Identity = 119/568 (20.95%), Postives = 211/568 (37.15%), Query Frame = 1
Query: 6931 KPVILWTKENSPILIGDTDYYLTFNNGQS-LTILNPKSDESGRYTCEAKNLAGQDSHTFVLTV-----TSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKEGG--IFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGI-----FRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKIS----QDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPT---------ETETTGVLNT-VLQMQCKILEGIPQPVITWERNGITLSKV------------KNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKV-SLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEIN---IYDLKPEDTGNY-ICIGERSGAEASTASTYL 8502
            +P  +WTK+   I  G   Y L+ + G   L I    + +SG YTC  KN AG  S +  LT+     T   K  T  +     IT Q    V  +   +   +  I      M  +       +    +KVL    V K     + K I   E+    +  + EV   A ++    ++    G    +     G     +KW  +G  +     +RYG     +T  L I  A   D G  TC    K      Q   ++   +   P   S  +S  +  G+ VL  C + G     I W+        S+ +   +  +   L I       SG Y   A N  G  +   T  ++V P +  P+         +T   G  ++  +QM     E       +   + +T  K             +++   + S     +++   +  +   +   + G           + PK+ +LP  ++ DEG  +T+ C   G+P P VTW   G+ + +    RF   + +++    I D++ +D G Y + +G   G++++T + ++
Sbjct: 33807 RPTAIWTKDGKAITQGG-KYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKT---SEITPQKKAVVQEEISQKALRSEEI-----KMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASE-EVRTHAEIKAFSTQMSINEGQRLVLKANIAGATD--VKWVLNGVELTNSEEYRYGVSGSDQT--LTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRG--QCSATASLMVLPLVEEPSREVVLRTSGDTSLQGSFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMTQLESSTSKMLKAGIRG-----------IPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 34347          

HSP 53 Score: 58.151 bits (139), Expect = 5.949e-7
Identity = 61/228 (26.75%), Postives = 98/228 (42.98%), Query Frame = 1
Query: 7345 FKCIARNEVG------SIMKV-YKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESP---KKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNN--QISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPT 7983
            F+  A NE G      + M +  KL       +R +  +V  + G +  + C   G P P IKW R GK +    +Y   +D RT  L +   ++ED G YTC  TN++ +   S  +++ + P+       K+     VG  + L  +  G RP     +  G    Q S  I  E        ++ +  RK H+G Y+   +N  G   +   L+V +Q K  +PT
Sbjct: 31430 FRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIG-RPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGT--VDAILDVEIQDKPDKPT 31654          

HSP 54 Score: 58.151 bits (139), Expect = 5.949e-7
Identity = 75/350 (21.43%), Postives = 137/350 (39.14%), Query Frame = 1
Query: 2557 IGFGPRIKDFVTNIDGSYGENITIRCQVEG-QPPPRVKWLRGIAGGYNIPIALGDRYFINQDNS---LIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGI----------AAPKIAFTQSKQVVVES----TL----------KKVIVCLVVESKPPAVISWLKNGKEIE-------YSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKP-----IIIGDFKTFI---DAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISP-DGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVE 3474
            I  GP +   + +  G  G ++   C++E      +V W  G+    N      ++Y I  ++    L +K ++  D   Y C   N +G+     ++ + G+             KI        ++E     TL          + V   + +   P   ++W K+G++I+       Y+         L I +V  +D+A YT +A+N+ G      +L V   P      +   FK  +   + ++G  +  + +  G P P ++W K G+PL++ P + I+    D   L +     E  G +  TATN   +       S +A  Q+ +      E  SKE  E
Sbjct: 32492 IEIGP-VSGQIMHAVGEEGGHVKYVCKIENYDQSTQVTWYFGVRQLEN-----SEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGS------TSCQAHLQVERLRYKKQEFKSKEEHE 32829          

HSP 55 Score: 58.151 bits (139), Expect = 6.152e-7
Identity = 48/176 (27.27%), Postives = 72/176 (40.91%), Query Frame = 1
Query: 3463 ENVELNCIITSGNPSPKIEWYKNGQPLVEIPG----RVEIAGQKNI--LKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTK--------EGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGS 3948
            ENV     IT  +P P + WYK+GQ +   PG    +      K +  L +     D+   Y   A N+   DS   ++T+ + P  +DS +  ++ +        EG+ +    ++ G P PT KW      L L  N   I +  +D   L I     E  G Y    TN  GS
Sbjct: 32632 ENVRFGVTITV-HPEPHVTWYKSGQKIK--PGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPN-IEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGS 32803          

HSP 56 Score: 57.7658 bits (138), Expect = 8.667e-7
Identity = 45/169 (26.63%), Postives = 76/169 (44.97%), Query Frame = 1
Query: 2092 PPPTFSWFLNGRELDP--TDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYI--------SLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNI-IINETIG--TLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDI 2559
            P P  +W+ +G+++ P   D + +  +D    Q+ I++V   D  E    A+N  G D  + KL+          +L  +    LA     EG         +G+P P + WE +G P+++  NI II+E +    L I        G +   ATN+AGS+    +L +
Sbjct: 32644 PEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 32812          

HSP 57 Score: 56.9954 bits (136), Expect = 1.350e-6
Identity = 43/175 (24.57%), Postives = 76/175 (43.43%), Query Frame = 1
Query: 8257 PISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNR--FRFNSENEINIYDLKPEDTGNYICIGERSGAEASTAS--TYLSIFTRPKFVYKPKLKNV-VQETRWKSFRCEATSHPKPDIKWMFNGRAIESKL-------NSNGRGSITLQSVRSENAGEYKCIAKNRVG 8745
            P+S    EG +     KV G+P P   W  DGQ + N   ++   + +    + I    P D+G +  + +     +S +   T  ++  + K ++  KLKNV ++E      +  AT +P PDI W+ N   I            + G  ++ + S  S+++  Y   A N+ G
Sbjct: 1463 PVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAG 1637          

HSP 58 Score: 56.6102 bits (135), Expect = 1.706e-6
Identity = 49/190 (25.79%), Postives = 85/190 (44.74%), Query Frame = 1
Query: 8518 PKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKL-------NSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKR---TILMCKVEGKVDSIV-WLKNGVIVQNSSRLYIND----FNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVK 9042
            P F  +P    VV E    +F    +  P P++ W  +G+ I +          S+GR  +T+ +V   N+G Y   A N  G    +  L V A+     +     S ++++     L  +V G    +V + ++G  +Q+S    I+     ++L+I +A  +D+G Y   A+NS G A     LLV+
Sbjct:    6 PTFT-QPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194          

HSP 59 Score: 56.6102 bits (135), Expect = 1.839e-6
Identity = 38/117 (32.48%), Postives = 54/117 (46.15%), Query Frame = 1
Query: 5362 VDIMIPPSIKFNSK-AGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRRVLLSDDGYH-LTVNSTMETDAGRYQCIAENTHGQTDISFDVQV--TYGPTLDPGGKRYYKVER 5700
            VD +  P +  ++     H V  G ++ LF   +GRP P   W K  S +  R  + + D +  LTV +    DAG+Y    EN  G   I+F V+V  T GP   PG   +  V R
Sbjct: 29276 VDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGP---PGPITFKDVTR 29389          

HSP 60 Score: 56.225 bits (134), Expect = 2.085e-6
Identity = 95/487 (19.51%), Postives = 185/487 (37.99%), Query Frame = 1
Query: 1435 QVKRGHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNVTLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKNASIEPFKDAE--------LECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGN---IIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAP 2862
            +VK    +  NC V +E      W++N+  I ++ +  +  ++    TL I  A+   Q  Y   +            N R + + +      +    +   +EP KD E          C V     NV LKW K+       N   +R++ YK         L I      D GEY+  A  +  V+E +  I+  T     ++++ ++  D+     SC+ LS       W+ NGRE+     +     D    ++ I + +  D  E  C  ++       R +L    +P +  +   ++I        V  +     + ++ W  N   V + G+   ++    I  L I  I+   +G++  +A +    ++    L++   P+IK    ++    G+ +T+    +  P    +W +      N P++        +  S  I      D+  Y    QN+HGK +  + +++  +  P
Sbjct: 13577 RVKEQQEVVFNCEVNTE-GAKAKWFRNEEAIFDS-SKYIILQKDLVYTLRIRDAHLDDQANYNVSLT-----------NHRGENVKSAANLIVEEEDLR--IVEPLKDIETMEKKSVTFWCKV--NRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHM-------LTIKDCGFPDEGEYIVTAGQDKSVAELL-IIEAPTEFVEHLEDQTVTEFDDAVF--SCQ-LSREKANVKWYRNGREIK-EGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKS----RARLFVEEIP-VEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNM-VVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAK----LELAAAPKIKTADQDLVVDVGKPLTMVVPYDAYPKAEAEWFK-----ENEPLSTKTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGP 14019          

HSP 61 Score: 56.225 bits (134), Expect = 2.138e-6
Identity = 43/169 (25.44%), Postives = 74/169 (43.79%), Query Frame = 1
Query: 4876 LKGSTTNLWCNVSGFPTPQIRWTYMETIXXXXXXXXXXQLHFMN---------VDKSHITRYTCIATNEAGSA---RKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQE--SDIGIYKCLVSNKLG 5340
            L+GST     ++SGFP P++ W + +            Q+ F +         V K++  RY+  ATN +G A    +L     T PP  V     +   + +  ++RL       P   +++++DG  I+++L   I+  G    LL A+    D G Y    +N +G
Sbjct:   18 LEGSTATFEAHISGFPVPEVSW-FRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQR--LQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVG 183          

HSP 62 Score: 54.6842 bits (130), Expect = 5.686e-6
Identity = 78/332 (23.49%), Postives = 122/332 (36.75%), Query Frame = 1
Query: 6787 GGTIEKKFEISVIIPPKIMKRSLGPENHRV-----KENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQS-LTILNPKSDESGRYTCEAKNLAGQDS---HTFVLTVTSPPKF---------------------PTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYD---MMNFVISNNAKVLTIPSVNKEGGI-FKCIARNEVGSIMKVYKLEVIM----------PALVR-LDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRYGTKTDSRTGI----LEITDAKEEDTGRYTCTGTN 7635
            GG I  +  +SV    K+    +GP + ++     +E   + + C + NY+ +  V  +       L     Y +T+ +G + L + +    + G Y C+  N  G+DS     FV  V     +                     P +F++     T  +G +V F       P P + W+     I P D      F        LTI SV  +    +  +ARN+ G      KL V +          P   R L   E +E     F +  +  G P P +KW +DG+ +           G+    L I D   EDTG Y  T TN
Sbjct: 32473 GGAIRSQKGVSVA-KVKVASIEIGPVSGQIMHAVGEEGGHVKYVCKIENYDQSTQVTWYFGVRQ--LENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVS--GIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATN 32799          
BLAST of Hemicentin-1 vs. Ensembl Human
Match: TTN (titin [Source:HGNC Symbol;Acc:HGNC:12403])

HSP 1 Score: 573.163 bits (1476), Expect = 1.840e-162
Identity = 632/2575 (24.54%), Postives = 1050/2575 (40.78%), Query Frame = 1
Query: 1807 KWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSE---AVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDP-RISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGN--IIINETI-GTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSY----GENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRY-FINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVE--SKPPAVISWLKNGKEIEYSNR--IMAKDNTLVIKTVK--AEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGIS-DYEIGSKENVELNCIITSGNPSPKIEWYKNGQPL-VEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITIL--VAPKASDSKMIKIYTKEGEKLTLNCKIDG-FPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIV---GGNITFSCVMNSTPPAEIKWF--KNEIDIYKSLPKDRFKIS-LDG-STLTLFEVKHLDSGIYKCLAINIG--ESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKT--LLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXX------XXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELI--RNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLG---LDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFR---RVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPT--LDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDG--TRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNK-EGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISST----ILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNY--YTTTDSGLFIFNSLKIEDEGSLTCIAKNVAG--EDRLTFQITVELLPKVSLPISVTGDE---GSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRF-NSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTR--PKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLNSN-----GRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPR-VRVYQSDDPSESIKRTILMCKVEGKVD-SIVWLKNGVIVQNSSRL---YINDFNLI-INQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYD---FVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQG 9279
            KW+K      L  +K++RI  +K +     ++L   SA   D+G+Y     +E G S        +     P  +   + +  + N +    C+   + P   SWF +G+E+  +D  RI+ V     + ++I  V   D+G   C+A NS G  +    L     P  ++   +K++ L G    ++ +  G     I W F G+   + G    I  E +  +L++  ++ +  G + C  +N AG    S NL   F      FV  ++ S     G+   + C+V G PP ++ W    A    I  +   R  F+     L +  + +ED   Y+C+AQN+ G          S I   K +   +K+      LK+  V L+ E    PP  I+W K+   +    +     +D+ + ++ +K  A D   Y C   N+VG++     + ++  P  I   ++    + G     Q   KG     + W K    +T +  +R+    + + L +  I  +H G + C A ND         +SVK P  I++E +S D   G    +++     SG      +W+K+GQ L +    ++ +    +ILK+    + ++G Y  +  N+V   S   +I +L  + P +   K+ K+ + +G  + L C + G  P   + +     I   ++  F   +   +   L I+Q+     G YTC  TN  G  + S  + + E P  ++      V  +  + L  +  G     IKW    K +   A       +   +L +  A +   G Y C   N+ G     + + V  P   +K P+      P++V   G + TF C +  TP   + W+   NEI   +     +  IS +DG +T  +   +  +SG Y C A N     S +  L V   PT + +     V+     +D+ + C   G P     W K+N ++ S  +  +T+      L I K   SD   YQC V+NE G    +  V +  PPS     +  T   LK S T     V+G P   I W   + I           + + + L   +VD  H  RYTC A NE+G  R     ++  P +IV  +  K   + +   + L C     P   ++W KDG+ I       ++  N      + +  + D G Y   V N  G    D     +D  IPPS  F  K       LG ++++ C   G      +W KDG  I      R++  +    L VN+    D   Y C   N  G    S  + V   P+  + PG     + +     TV  + ++ G P   I W KD + +   P     + G++  L + ++ AS  G+Y+C   N  G       + +  PP   + ++    I+K GD  RL C   GSP   + +F++ + L          AS K R+       ++ + +    DSG + C A N  G       V V+ PP F  S+  P V    N   SLEC L G   PP ++ W +    L S    +I+     T I + NV   D GEY C AQNEV   + V  V++   PRF        + A +   +Q S E  G  P  + W ++++E++ + E   +   +   + +Q    +P +A  Y C   N GG  E    + V+ P  I++++ GP    V E    T  C V      +  + W K+   +       +  +N   SL IL+ +  ++G YT + +N  G+ S T V+ V S    P  F+   +     LG S   +C   GS   S+ WF++   I          S+N   L + S++  + G + C+A N  GS      L V  P     +   +    G + +      G P   + W R  + +    R     +     LE+ +     +G YTC  +N   Q S +  + +  P           V  G+ ++L     GT P  + W   G N  +S     +  E   + E   I++  ++D +G Y C   N+AG       +  L  P      E     V ++V  +QC++  G P+  ++W +    L     Y  Y T +    +FN + I D G  TC A+N  G    +  F+I    LP  S    +   E   G  VT+ C++ G     V W +DG  L++    +  F ++   + I       +G Y C        AS+++   +   +  P F  KP   +V+       F C  T      I W  + + I    N           + +  V   ++G+Y C A N VG    S  L V   P+ V+  ++   ++  +   L CK+ G  +  + W +N   +  S +    +IN   L+ IN+A ++D+G Y C A N  G+A     L VK+PPVFT  P  + A  G  +IL C   G P   + W K++K ++      + S   + SL I+ ++    G Y C A++  G
Sbjct: 4976 KWYKD--GRPLVASKKYRI-SFKNN----VAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGT--ASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPSFVTKPGSKDV-LPGSAVCLKSTFQGSTPLTIRW-FKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANL---FVKEPATFVEKLEPSQLLKKGDATQLACKVTGTPPIKITWF---ANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDH------CSSIVIVKESPYFTKEFKPIEVLKEYDVMLLAEVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPPSFIKKIESTSSLRGG-TAAFQATLKGSLPITVTWLKDSDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATITEEAVSIDVTQGDPATLQVKF---SGTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASEKYKFSFHD---NTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEKPQSQDVNPNTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKEPPQFIKKPS------PVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQ-----KHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVEVVKY---SDVELECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFIK-KIENTTTVLKSSAT-FQSTVAGSPPISITWLKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQIV--EKAKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPS--FTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPSFLVKPG-----RQQAIPDSTVEFKAILKGTPPFKIKWFKDDVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPKFVK-KLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELP---------ASDKYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVF--SSFPPIVETLKNAEVSLECELSGT--PPFEVVWYKDKRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFVSKLNSLTVVAGEPAELQASIE--GAQPIFVQWLKEKEEVIRESENI-RITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIVEKA-GPMTVTVGETC--TLECKVAG--TPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDV-SDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPSFVKEPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPAAFLKRLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILE---ILNSTKRD-AGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSV-SLQCQVA-GTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQLPP-SFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVSIDVIA-GESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVG 7464          

HSP 2 Score: 572.778 bits (1475), Expect = 2.683e-162
Identity = 652/2712 (24.04%), Postives = 1108/2712 (40.86%), Query Frame = 1
Query: 1429 KIQVKRGHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNVT-LEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKNASIEPFKDAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGG--VSEAVGFIKTHTLPAASVDEKEISFI--DNDSITASCRALSTPPPTFSWFLNGRELDPTDPR-ISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIINETIGT--LDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRG---IAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRI-MAKDNTLV---IKTVKAEDEAIYTCIAKNQVGTAKFDIELDV--QTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQI-----SKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPG-RVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSIL---DLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLI-VERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNK---NITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAINI-GESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEIT--NGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNV---FVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXXXXXXXXX------QLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGT--QLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRR---VLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYY-----KVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQME---IFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTP---PEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGT--RITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPV-ILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKEG---GIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGI---FRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVI---ISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIE--DEGSLTCIAKNVAGEDRLTFQITV-ELLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEI-NIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYK-PKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIES----KLN-SNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAK--PRVRVYQSDDPSESIKRTILM-CKVEGKVD-SIVWLKNGVIVQNSSRLYI----NDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKS---PPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIK--YDFVKSLIKN-GSLRIIGVQKEHSGVYFCVASSNQGE 9282
            K+   +G  I + C+V    P  I W+K+D +I  + ++  +F    N   LEI +      G Y               G+ +    +TV  PP  V  P++  + P    +L+  V  T+  + +KWFK     EL +     +       +  S+ L + +A  +D+G Y+C   ++ G   S+A  F+K    P   + +     +  +  S T  C+   TP    SW+L+G E+       IS ++ +  +  +IS  + ++SG  +C+A+N AG     I+L     P  +      E+    D + + C  TG P  ++TW  N   +       + + +    L I + + +  G++ C+ +N  GS   S  + +   P     + N       + T +  V G PP  + WL+    +    N+ I+     F++   +L I+ +       Y C A+N+ G V+      +  +  P     ++K V V       + C VV   P   + WLK+GK+I  S    M+ +N +    I++V  +D   YT   +N  G++  D  L V  Q  P       T +D   G  I ++C+  G      +W K G+ ++     R+V       L V ++  E    +TC  +N          ++VK PP        ++ I D        VE   I+  G P  KI+W+K+   LV  P   + + G  + L +Y  +  +TG Y C  TN+V SDS    + +   PK           K G+   L CKI G P     W      L   D  R  F  + + I  N+L      +E  G + C+  N  GS   S  VI+ E P    F        +  ++L C  SG P  ++ W +K K    ++  YK+  +N  T I +    +   GEY C A+NE G D    + TV      +K P +    +    ++ G        +    P  ++W K + ++ +     R     + +TL   + +  ++G Y C   N  G   N   ++++ P ++ + +    + + E   L   C   G P     WYKD   L S  + + +  N   +L I  V R D   Y   V N  G+      V+V    VPPS     ++ T   L G++  L C V+G     + W + +T          +       L   ++D S +  YTC+A N AGS        +  PP  V  +P+    +L    +  +      P   + WF+    +    R NI    T  +L L N   S  G Y C+VSN  G  + + T  + +     F  +   H V  G ++ L     G     + W+KDG  I       ++ ++    L + ++ + DAG+Y C  EN  G+     DV      TL+P    Y+      +E  VG +V L+C V+G P   ++W K    +   P YR     N   L    +  +D+G Y+C A+N+ G      +F       PPS  R   L +    VG  + L C  NGS    + +++DG    +     N   S+   +        L +     + SG Y C+ASN +G       +  R P   P FD   V   ++    ++   EC + G    P +ITW +    +  GG+  I+  G    + +  V + D+G+Y C A N+V K      + V   P+F K    +K+ A Q  ++Q+ C+ +G P   + W+R + E L +  +Y     +   +++ I     +D+  Y C A NG G       ++V  PP   ++   P      +   +   C +   + T P  ++W K+   +         + +   SL ILN ++ + G Y C+A N  G D+ +  +    PP+F    S   +T T+ +G +V  +   EG    S++W  KD      +  N  IS    + T+   + E    G + C  +N+ G       L V+ PA +      +   +G  F++ C   G P+   KW +DG+ +    ++     ++   L+I  A+  D G Y+    N + + + +V V +   I PP      K +   +G  V+L C V G+ P  + W+  GN  +S          +   L +  +    +G+Y CVA N AG  E    L V  +P  F  T  ++  VL  +      ++ G P   + W +    L   ++   + +  +      +++  + G  +C+  N AG    T  + V E    V      + + GS + +     G P  +V+W KD   +            ++ I  I +   ED   Y C+ E    +       +S+   P F+     ++ V+ E    + +C+    P+  I W      + S    K+   N   S+ +  V   + GEY C A N VG+V  S +L + A+  P     +  D  E++   +   C++ G     + W K+GV++++ + L      N   L I Q      G Y C ASN  G A     L++     PP F L P ++   LGE     C   G     I+W K+ + I+   ++  +L++N  +L ++ V K  +G Y C AS+  G+
Sbjct: 5610 KMDSIKGSFIDLECIVAGSHPISIQWFKDDQEI--SASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSAT-------NKAGHNQCSGHLTVKEPPYFVEKPQSQDVNPNTRVQLKALVGGTAP-MTIKWFKD--NKELHSGAARSVWK-----DDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKE---PPQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGL--ATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVEVVKYSDVE-LECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFIKKIENTTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDNVYIS-----FVDSVATLQIRSVDNGHSGRYTCQAKNESG-VERCYAFLL--VQEPAQIVEKAKSVDVTEKDPMTLEC-VVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPSFLVKPGRQQAIPD------STVEFKAIL-KGTPPFKIKWFKDDVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRMTFIDSVAVIQMNNL-----STEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIVETLKNAEVSLECELSGTPPFEVVW-YKDKRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSD--TCVCTV-----KLKEPPRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIVEKAGPMTVTVGETCTL--ECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTR-RLKNTGGVL-GASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPSFVK-EPEPLE-VLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAG--QASCTTRLFVKEPAAFLKRLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGR-----DVCGALVSTLEPP---YFVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQ--LKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGV---LLRDDENLQTSFVDNVAT------LKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPV--SIDVIAGESADFECHVTGAQ--PMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKV-AKQGESIQLECKISGSPEIKVSWFRNDSE-LHESWKY-NMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQK---PSPVGALKGSDVILQCEI---SGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLS---DTSTL-IGDAVELRAIVEGFQPISVVWL-KDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLEPARIIEKPEPMTVTTGNPFALECVVTGTPELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQ-EPPSFEQT-PDSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQ-DICEALVSVLEPPYFIEPLEHVEAVIGEP--ATLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKARKLPPFFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSVDLALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGK 8219          

HSP 3 Score: 555.829 bits (1431), Expect = 3.200e-157
Identity = 634/2617 (24.23%), Postives = 1054/2617 (40.28%), Query Frame = 1
Query: 1741 IEPFKDAE--LECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGREL--DPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTID--GNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDI---GFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRY---FINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNR--IMAKDNT--LVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPG-RVEIAGQKNILKVYGKNEDETGSYECKATNEV--SSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDK-NDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFID----NTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGST--LTLFEVKHLDSGIYKCLAIN-IGESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNG--GKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPS-INGISMRETPEFLKGSTTNLWCNVSGFPTPQIRW--TYMETIXXXXXXXXX-----XQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNIT--NRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTV---DIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFR---RVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEP--KVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGS--IRISPDGTRITVENVKQYDAGEYKCHAQNEVSKI--SLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVI---IPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPV-ILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKE-GGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQI--SSTILGEYQFLSEQ--GLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTET--ETTGVLNTVLQMQCKILEGIPQPVITWERNGITLS---KVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVE---LLPKVSLPISVT-GDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENE---INIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLNSNGRGSITLQS---------VRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGKVD-SIVWLKNGVIVQNSSRLYINDFN----LIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYK-NKKLIKYDFVKSLIKN--GSLRIIGVQKEHSGVYFCVASSNQGEVHSQPIYLTVQ 9315
            +E  K+AE  LEC +  T    V+ W+K   + +L+++K+++I     +   F + + IL+   SD GEY C A++E G    V  +K    P        ++ +  +            P    W     E+  +  + RI+ V +V  + ++ +  +P ++G+ IC+ KN  G+ E    L  +  P ++           G+  T+ C   G P+  + W  +G  +T            I +L I  +E+   G +     N+ G S  +  +D+      P     + N  G  G +  + C+V G  P  V W           I  G +Y   F +   +L +  L   D   Y C A N  G    S + R         +F +  + +     K V    V+   PP  ++W +  +E+   +R  I  +D    L +  +       YTC+  N  G A     L V+     +         + G  I+L+    G     + W+K G  +T      IV +     L + + T+  AG ++C   N+    V    VS   PP    E +   E    ++V L C + +G P   + WYK    L   P  R         L     N +++G Y CKA N +  +S    F+I     P +   ++  I    G  +TL C+++G   P +   ++  +L   R+   +  S +D    L I Q      G Y+C  +N  G+A  S  +   E PK   F D   V ID     +    C  +G    +I W    K I P          N   L + +      G+Y+C A N+ GKD  ++ ++V  P   +K    +        G +I   C ++ +P  ++ WF+N+ ++++S    ++ +S   S   LT+ E    DSG Y C A N +G++   T + + +P +  +  S   +   + +D+ + C   G P    +W KD  Q+ +  + +IT+     +L I  +  SD   Y C  TNE G D  +  V    PP  +  +S   T   L G    L   V GF    + W     E I        +     + L   + + S+  +Y C   N+AG   +    VLT       ++  +   +       L C     P  + +WFKDG  +  + + +IT  N+   L +  A+ SD G+Y   V N +G      +V   D ++PPS  F  K       LG ++ L C   G     + W +DG+ I      +   S++   L ++    +D G Y C+A N  G  + S  + V   P+ +   +    VE   G ++    ++ G P   + W K    +    S    +     +LE+  +Q  ++G YSC+  N  G       + +  P +  +   L ++ ++ G  + L     G+P  ++++ KD   +           S +  + ++++  +L +  +   D   Y C   N  G D+ E  V V  PP F    +EP   V     +  +L+C + G   P  +I+W +    L S  +  ++   +   + +  V   D GEY C A N V  +  S V  ++    P F+  +L   +       V   C   G  P  + WY+    +  D      F  +   + +QI          Y C+A+N  GT     ++ +    +PP      L P +  +      TF C V     T P+ I W K+N  I  G         N  +LT+L     ++G+YTC A N+AG+DS +  L V  PP+F       R    V+      ++C   GSP   ++W+  +  I           ++  VL + +++ E  G + C A N  GS      L+V  P + R     +    G    + C  +G P   + W +D + +    +Y   +++    + I +    D G Y C  TN +  D+    + + +PP+       I   VG++V L   +EG  P  + W+      +  S  I   Y   SE    L   RV   ++G Y C   NDAG QE   TL VL    I    E+   TTG   T   ++C +  G P+    W ++G  L+   K K  +    SGL I N +   D G  +   +N  G+D  T  + V    + P  +  +  T G  GSSV + CKV G P  +V+W  +G  + +  G +++    +    + +  L+  D+G+Y CI   + A +   S  L++   P FV KP   +V+  T   +F       P   + W F G    S+L    R +++L+          V +  +GEY CI  N  G    +  L + A  +     +D   E  K  IL     G    S+ W KNG+ V  S R  I        L I  +  +D G Y C   N++G+      +L+  PP F      +  ++G+   L C   G P   +SWYK + KL      K   +N   +L    V    SG Y C A ++ GEV S   +LTVQ
Sbjct: 6453 VETLKNAEVSLECELSGTPPFEVV-WYKD--KRQLRSSKKYKI-----ASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENV--ATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLE-PAVIVEKAGPMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFH-----EKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAG----SDECRAVLTVQEPPSFVKEPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPAAFLKRLSDH-SVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTE-LEPLEAAVGDSVSLQCQV-AGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNG-SAPIQVCWYRDGVL--LRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTARE-PKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKVAKQ---GESIQLECKISGSPEIKVSWFRNDSELHESW---KYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSP--VGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLSDTST---LIGDAVELRAIVEGFQPISVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAG--MRECSAVLTVLEPARIIEKPEPMTVTTGNPFALECVVTGTPELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPS--FIRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPSFE---QTPDSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKR--LADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQ---------SERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPPYF----IEPLEHVEAVIGEPATLQCKVDGT--PEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKARKLPPFFARKL-KDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANLQTSF--VHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFF---DLKPVSVDLALGESGTFKCHVTG---TAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGVQEPPRFIKKLEPSR---IVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKGADVHLECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISY---SENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIVEKPESIKVTTGDTCT---LECTVA-GTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIIN-VAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISS--GRKYQTTLTDNTCALTVNMLEESDSGDYTCIA-TNMAGSDECSAPLTVREPPSFVQKPDPMDVLTGTNV-TFTSIVKGTPPFSVSW-FKG---SSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEV-SASTFLTVQ 8978          

HSP 4 Score: 551.206 bits (1419), Expect = 7.423e-156
Identity = 673/2759 (24.39%), Postives = 1111/2759 (40.27%), Query Frame = 1
Query: 1381 AIFSRDPLPVSVSCPAKIQVKRGHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNVTLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXK---NASIEPFKDAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPT-DPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVR--IKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIIN--ETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFV----TNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFI----NQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEI----EYSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNI--LKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILES---PKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDG--STLTLFEVKHLDSGIYKCLAINIGESLNFTLVVLI-SPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKTLLIKKVRRS--DDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXXXXXXXXXQ-------LHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGE------LRLSCNSDAAPVATIEWFKDGELIRN--NLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTV---DIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRI---DFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGP----TLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGTRITVE--NVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTT---VQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATN--GGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPV-ILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVN-KEGGIFKCIARNEVGSIMKVYKLEVIMPA--LVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQG-LIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPT-ETETTGVLNTV---LQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIEDE--GSLTCIAKNVAGEDRLTFQITV---ELLPKVSLPIS-VTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNS-ENEINIYDLKPE--DTGNYICIG-ERSGAEASTASTYLSIFTR---PKFVYKPKLKNVVQETRWKSFRCE---ATSHPKPDIKWMFNGRAIESKLN-----SNGRGSITLQSVRSENAGEYKCIAKNRVGSV--EYSFMLEVIAKPRVRVYQSDDPSESIKRTI-LMCKVEGKVD-SIVWLKNGVIVQNSSRLYINDFN----LIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPV---------------FTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNK--KLIKYD--FVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQGEVHS 9291
            A+ +    P  V  P  ++V  G  +    +++   P+ +NW++   +++     N+ F+ T    LE++  +    G Y             V  N       T L         K   + S+EP K   LE + ++ +  + + W K    + +  +++  I   +K+       L IL++++ D G+Y C  E+E G       + T   P    + + +     DS++  C+   TP  T SW+    +L PT + R    N+V  + +  + V   DSGE  CKA+NS G    +   ++    LP   +  L       G   T+ C   G    ++ W  +G  +  D N+  +  + + TL I + + +  GQ+ C A+N  G++  S  L     P+   F      +ID   GE+    C V G  P R+ W +      N  I  G  Y I    N  +  I+K +   D   Y C A N  GK   S Q+ +     PK         V +      + C +  S P   +SW +N  E+    +Y+   +     L I    AED   Y C A N VG A     L V+  P+      + + A  G  ++LQC+  G P  ++ W K  + +      +I      + L + ++     G + C ATN+  +      V  K PP+  K+ +SD      + VEL  I+    P   + W K+   ++       I+   NI  L++       +G Y C+  N+         +T+L  P     K   +    G    L C + G P  + KW      L           + +    +   +M    +G+Y+ +  N  G +  +  V + +    P  I+        +  ++ L C  SG+    + W      I           EN  TL +        G Y+C+A N  G D+ ++++TV  P    +TP+       ++ G ++TF+ V+  TPP ++KWFK   ++   +P +   ISL+   + L LFEV+ L+SG Y CL  N   S + T  + +  P    K  +    ++   + + +     G P     W KD   +    R  IT   K+ +++ +  +  D + Y C + NEAG+D     V+V  PP    I   E  E + G    L C V G P  +I W Y E        +   Q       L    VD S +  Y+C A N  G+       V+    K   L P   R  LKD        +   C  + +    + W+KDG L+++  NL+ +  +    L +L   +S IG Y C  SN LG    +  +   +  +PP   F+ K  +  +ALG +    C   G    KI W KD   I      ++ L ++   LTV    + DAG+Y C A N  G+   S  + V   P     L+P   R  K +         EC + G P   + W KD   I     +R   + +   LE+  +   D+G Y+C A N  G       + +  PP I R +      +K G ++ L C   G+P  +++++KD   L          +  K +++       + + +    D G YQC A+N +G D    S+ ++ PP F     +  ++    +   L+ T+ G A+P + + ++  G  +    +I IS      T++   V+  +AG+Y C  +N+   +   F     L+P      +  K E+++ TT     + C   G P  +  W++  +E+ +D  +Y K       S ++I N+ P D+  Y+    N  G  +     ++S    P    R L   N        +   C VY    + P+ + W  E + I  G        +N  +LT+   +  +SG YTC A N+AG D  +  LTV  PP F        + + V  GT+V F    +G+P  S+ WF     + P D  N  + ++   L +  V+  + G + CI  NE G       L +  PA  + RL+   + +  G    +  T  G P   + W ++G  +    R    T  ++ ILEI  +  ED G+Y C   N   +DS S  ++I+ PP      + + V VG+   L C + GT    + WY  G+ ++  T   +  F +    L+ ++V  + SG Y C A N  G  E+  +  + VQ +   P+   +   V  TV   +   C I    P  V +W ++G  L    N  T+        N  K +    G  +C A N  G    + ++ +   +  P   + ++ V    G S    C V G     V+W KD + +++  G +++ +  EN  ++  LK +  D+G Y C      G ++ TA   L+I  R   P F  +  L   V+ET   SF+ E   A S P   + W  N   I+   N      N    + ++     +AG Y C   N  GS     S +++   KP V        + S    + L C V+G     I WLK G  ++ S R   +  +    L +      D+G Y C ASN AG    +  + +K  P                F   P +I               G PIP + W K K  +L +    F+        L I    K  SG+Y CVA +  GE+ S
Sbjct: 6812 AVLTVQEPPSFVKEPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTV-AELELFNIDISQSGEYTC----------VVSNNAGQASCTTRLFVKEPAAFLKRLSDHSVEPGKSIILE-STYTGTLPISVTWKKD--GFNITTSEKCNIVTTEKT-----CILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNV--ATLVFNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARL-TAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKD-----NKEIRPGGNYTITCVGNTPHLRILK-VGKGDSGQYTCQATNDVGKDMCSAQLSVK--EPPKFVKKLEASKVAKQGESIQLECKISGS-PEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQK-PSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKK-LSDTSTLIGDAVELRAIVEGFQPI-SVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVL-EPARIIEKPEPMTVTTGNPFALECVVTGTPELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSD--KGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPSFEQTPDSV----EVLPGMSLTFTSVIRGTPPFKVKWFKGSREL---VPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLAD--FSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPPYF--IEPLEHVEAVIGEPATLQCKVDGTPEIRISW-YKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVI----KARKLPPFFAR-KLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPF--FDLKPVSVDLALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGVQEPPRFIKKLEPS--RIVKQDEFTR----YECKIGGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPP-IFRKKPHPIETLK-GADVHLECELQGTPPFHVSWYKDKRELR---------SGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLSD--ISTVVGKEVQLQTTIEG-AEPISVVWFKDKGEIVRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAG-MQECFATLSVLEP----ATIVEKPESIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDN-KY-KISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGL--SGSSVVMECKVYG---SPPISVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQK----PDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEK--GKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYK-GDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVG--EVSASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAISGSEPISV-SWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSARLILTEGKNPPFFDIRLAPVDAVVGESADFECHVTGTQPIKVSWAKDSREIRS--GGKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQ--LNIKERLIPPSFTKR--LSETVEETEGNSFKLEGRVAGSQPI-TVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVIKEPKKPPVFDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKDKPAVAPATKKAAVDGRLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIES 9465          

HSP 5 Score: 533.102 bits (1372), Expect = 2.536e-150
Identity = 632/2677 (23.61%), Postives = 1094/2677 (40.87%), Query Frame = 1
Query: 1423 PAKIQVKRGHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNVTLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKNASIEPFKDAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSA---SESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGN---IIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRY-FINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEI----EYSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKN-ILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTI----TLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVF----APYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGST--LTLFEVKHLDSGIYKCLAIN-IGESL-NFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEIT--NGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETP-EFLKGSTTNLWCNVSGFPTPQIRWTYMETIX------XXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKD-GELIRN--NLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRRVLLSDDGYHLT-VNSTME--------TDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYK-VERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRS---LECTLMGVADPPAKITW--ERHGVPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSV--MQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQ------ITFHCSVYNYNMTKPV-ILWTKENSPILIGDTDYYLTF-NNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNK-EGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIE----VRERSGTSFSVLCTAEGYPKPVIKWTRDGKGI-----FRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLI---IDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIE--DEGSLTCIAKNVAGEDRLTFQITV-ELLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFR---FNSENEINIYDLKPEDTGNY-ICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKS-----FRCEATSHPKPDIKWMFNGRAIESKLN-----SNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRT--ILMCKVEGKVD-SIVWLKNG--VIVQNSSRLYIND--FNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKN 9159
            P + Q      ++   +++   P+ I W+K+D ++++     +  + +++  L +Y  +    G Y   +         V  ++   +++   PP     +  +  ++    + LEC + + S  + + WF++   +EL  + ++R+         F   + ++     S  D+G+++C A++  G +     +     P  S     +  + N  ++  C    TPP    W+ + R+L  +  +  I +    + I I NV   D GE  CKA+N  G D     +     P+ +S  L     + G+   ++ S  G     + W      V  +     I   E + TL   + E    G+++C   N  G       L +     I +    +  + GE  T+ C+V G P   V+W +    G  +  +   ++ F N+ +SL I  +  +D   Y    QN  GK   +  + +S  A P  +FT+  +          I+   V    P  ++W     +I    +Y         TL + ++ + D   YTC+A N  G+ +    L VQ  P  + + +  ++   G  +      +G P  K+ W +G R L       I      ++L +++I    +G +TC  +N+        ++ VK P    K  +SD+ +   +++ L    T   P   + W K+G  +        +  +K  IL++    + + G Y C+  NE   D     ++ L  P    +++  +    G+ ++L C++ G  TP    SW      L+  P   T    +   L+  ++     G YTC   N  G+A  S  V  ++  ++     + +  I+ T+    TLTC  +G+   ++ W     L+  +        +N  TL + +    H G+YSC A N  G    ++ +T      +P+ D+K  + ++     I G +  F C +    P  I W K+  +I    P   + I+  G+T  L + +V   DSG Y C A N +G+ + +  L V   P  + K  +  V    E   L   C   G+P  +  W++++S+L    +  ++  N    L I +    D   Y C   N  G+   +  + V  PP     + + +P   LKGS   L C +SG P  ++ W                    ++ LH +N++ S +  Y C ATNE GS           PP+ V    D    I    ELR +      P++ + W KD GE+IR   N R++  +    L L + + S+ G Y C + N  G+ + +  + ++ P  I    K     V  G    L CV  G P+   +W KDG      R L +D  +H+T +N            +D G Y    +N+ G+++ +  V V+    + P   R  K V   +G +VVLEC VSG    ++ W +DG  I   P  +     N   L +  ++ SD G Y+CVA N  G  E    +T+  PPS ++     E +   G  L       G+P   + +FK        +L P +  +      V++    L L+  +  +SG Y C  +N  G       + V+ P  F       ++  F+ +T S   LE T  G   PP  ++W  + + +  S   SI ++   T + +      D  +Y C  +NE  +      V V   P F   +    +EAV      + C+  G P   + WY++  ++ +     P + +   N+V  + I  +   D   Y+C A N  G +      +V++   I  R L P   R  +++       + F C +   N ++P+ + W K+   +L  D +   +F +N  +L IL       G+Y C A N  G  S +  L + S  + P  F +   ++ + LG S  F+C   G+    I W   +  I P       +  N   LT+  V K + G + C A N  G      +L V  P    + K+E    V++   T +   C   G P+  + W +D   I     FR  +  DS   +LE+ +   ED+G YTC   N     S S  + +  PP        I    G  V L C ++GT PF + WY       S     +Y+ +SE  L    I  V     G Y+C A ND G      ++ +   P+  +   ++ + V+   +Q+Q  I    P  V+ ++  G  + +  N + +    +      ++E  + G  TC  KN AG       ++V E    V  P S+    G + T+ C V G P+ +  W KDG+ L +   N+++   FN  + + I ++ P D+G Y   +    G ++ TAS  +S  T P     P     ++ET   S       C+    P   + W   G  I S        ++   ++T+  +   ++G+Y CIA N  GS E S  L V   P     Q  DP + +  T       V+G    S+ W K    ++  +   + + D    L +    +  +G Y CI SN AG+A    HL +K+P  F     + S   G+ LIL     G P  +++W KN
Sbjct: 6263 PGRQQAIPDSTVEFKAILKGTPPFKIKWFKDDVELVSGPKCFIGLEGSTSF-LNLYSVDASKTGQYTCHVTN------DVGSDSCTTMLLVTEPPKFVKKLEASKIVKAGDSSRLECKI-AGSPEIRVVWFRN--EHELPASDKYRM--------TFIDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIVETLKNAEVSLECELSGTPPFEVVWYKDKRQLR-SSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFVS-KLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIVEKAGPMTVTVGETCTLECKVAGTPELSVEWYKD---GKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDVSDRAVPP-SFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPSFVKEPEP-LEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPAAFLKR-LSDHSVEPGKSIILESTYTGTLPI-SVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFV-TELEPLEAAVGDSVSLQCQVAG--TPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTAS-SKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVSIDV-----IAGESADFECHVTGAQPMRITWSKDNKEIR---PGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKVAKQGESIQL--ECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVF---TQKPSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLSDTSTLIGDAVELR-AIVEGFQPISVV-WLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLEPARII--EKPEPMTVTTGNPFALECVVTGTPELSAKWFKDG------RELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVS-DRIVPPSFIRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPSFEQTPDSVEVL--PGMSLTFTSVIRGTPPFKVKWFKGSR-----ELVPGESCNISLEDFVTE----LELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVK-----RLADFSVETGSPIVLEATYTGT--PPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPPYFI--EPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTKLRS----APAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASS---AVLV---IKARKLPPFFARKLKDVHETLGFPVAFECRI---NGSEPLQVSWYKDGV-LLKDDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKL-ILSEHEVPPFFDLKPVSVDLALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGVQEPPRF-IKKLEPSRIVKQDEFTRYE--CKIGGSPEIKVLWYKDETEIQESSKFRM-SFVDS-VAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKGADVHLECELQGTPPFHVSWYKDKRELRSGK---KYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKL-SDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIVEKPESIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTS--DNKYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVP-----PSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPP--SFVQKPDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKN 8831          

HSP 6 Score: 531.946 bits (1369), Expect = 5.084e-150
Identity = 640/2720 (23.53%), Postives = 1103/2720 (40.55%), Query Frame = 1
Query: 1405 PVSVSCPAKIQVKRGHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNV-TLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKN-ASIEPFKDAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTL---PAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDG---NIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDI----GFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNSLI-IKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEI----EYSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKD--GDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAP---PQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPG---RVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLL-ITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQET-LIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAINIG--ESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEIT--NGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNV---FVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTY--METIXXXXXXXXXXQ----LHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDG-ELIR-NNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDG---SRIDFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPT-LDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGA---PPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRV---RTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRIS--PDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPV-ILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFY-KDMPISPYDMMNFVISNNAKVLTIPSVN-KEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVI---ISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQF-LSEQ--GLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITL---SKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPIS-VTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKP---EDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPK-LKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLN-----SNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAK--PRVRVYQSDDPSESIKRTILM-CKVEGKVD-SIVWLKNGVIVQNS----SRLYINDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLV---KSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLI----KYDFVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQGE 9282
            P  VS    + V  G   ++   ++   P  + W K   ++I  +++N++     NV TL+  +A   + G Y          Q+   G  R+ +   ++  P  +       ++   +   LEC V  T   + ++W+K      L ++++ +   Y K      S L ILS    D G Y    ++  G S     +        P+ +   K    +   S    C+   + P + +WF    ++       +  +D     ++++++   D G   C A N AG DE R  L+    P  +      E+ L G   T      G P  K+ W F G+   + G   NI   +T+  L++  I+ +  G++ CV +N+AG +  +  L +     F  R+ D         G++I +     G  P  V W +    G+NI  +        +   ++ I   +  D   Y C+ +N+ G+  +     +S +  P   F    + +  +    V +   V   P   +SW K   ++    EY         TLV   V   D   YTC A+N +GTA       +Q + +     +   D +   G  + L C+  G    ++ W + G  L  +  L+     + + L +      H+G ++C+A+N         +++ + P   P    + +S  ++ + E+ +  C +T   P  +I W K+ + +   PG    +   G    L++    + ++G Y C+ATN+V  D    Q+++   PK           K+GE + L CKI G  +P  K SW  +  +L  + +    S I+   LL I +  +E  G Y C+  N  G A  S  + +   P   Q          + + L C  SG P  ++ W+  +K +  N+  +K+  ++ +T L +    +   GEY C A NE G D  +  V    P   +K     ++    ++G  +    ++    P  + W K+  ++ +     R     + +TL L   +  +SG Y C   N       +  L VL    I+ K    +V   N      + C   G P     W+KD  +L +  +  IT  N   +L I     SD  +Y   V N  G+      V+V    VPPS   I   +    + G++  L C VSG     + W     E ++ P   S+ S+    L+   ++ S    YTC+A N AGS        +  PP      PD    +L    L  +      P   ++WFK   EL+   +  +++ +  T+L L   Q  + G Y CLV+N  G    + T  + +     F  +     V  G  + L     G P   + W KD    S+ +   + +++    L +  +   D  +Y C+ EN  GQ      V V   P  ++P       VE  +G    L+C V G P   I+W K+   +   P+Y+ +   N   L I  +  SD G YSC A N+ G +     + I A   PP   R   L +    +G  +   C  NGS    ++++KDG  L         DA+ +   +       L +    ++  G Y C+ASN +G       + +     PP FD   V   V+    ++ + +C + G A  P KITW +    +  GG+ +++   +   +TV  V + DAG+Y C+A N   K S    + V   PRF K    ++I   Q+   +  C+  G P   +LWY+ E EI  +  ++ +   +   +V+++ N+  +D+  Y C A N  G+      + V  PP   K+   P      +   +   C +     T P  + W K+   +  G     ++ N   S+ ILN  + + G Y C+A N  G D+    + + +PP+F    S     I+  +G  V  Q   EG+   S++WF  K   +   D +    S N   L    V     G + C  +N+ G       L V+ PA +      ++  +G + ++ CT  G P+   KW +DGK +    +Y     ++   L+I +    D+G Y+    N + +DS +  + +     PP      K      G  V++ C V G+ P  + W+  GN +ISS    +YQ  L++    L ++ + +  SG Y C+A N AG  E    L V   P   +  + +   VL         I++G P   ++W +    L    +       + + L +F+ +     G  TCI  N AG+   T  + ++   K    ++  + ++G  + +     G P  +VTWKK+G  +      R    +  +  I ++     ED G Y C  E +  + S ++  L I   P FV + + +K  V ++   S +C+    P+  + W      +           N   ++    V   ++GEY C A+N VG V  S  L V  +  P     Q  D  E++   ++  C + G    S+ W K+G  +++S    +    N   L I +      G Y C A+N  G A     L++   K+PP F +    + A +GE     C   G     +SW K+ + I    KY  +  L  +  L ++ V K  SG Y C A +  G+
Sbjct: 6537 PRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIR-ESENIRITFVENVATLQFAKAEPANAGKYIC--------QIKNDGGMRENMATLMVLEPAVIVEKAGPMTVTVGETCTLECKVAGTP-ELSVEWYKD--GKLLTSSQKHKFSFYNKI-----SSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSD-NVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPSFVKEPEPLEV-LPGKNVTFTSVIRGTPPFKVNW-FRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPAAFLKRLSDHSVEP----GKSIILESTYTGTLPISVTWKKD---GFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGR--DVCGALVSTLEPP--YFVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVS-IDVIAGESADFECHVTGAQPM-RITWSKDNKEIR--PGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKVAKQGESIQLECKISG--SPEIKVSWFRNDSELHES-WKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVR-NSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVK----KLSDTSTLIGDAVELRAIVEGFQPISVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLEPARIIEKPEPMTVTTGN---PFALECVVTGTPELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSF--IRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPSF-EQTPDSVE-VLPGMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAG--SASCTTHLFVKEPATFVKRLADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPPYFIEP----LEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKARKLPPFFARK--LKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLL-------KDDANLQTSFV--HNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPV--SVDLALGESGTFKCHVTGTA--PIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGVQEPPRFIKKLEPSRI-VKQDEFTRYECKIGGSPEIKVLWYKDETEI-QESSKF-RMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKK---PHPIETLKGADVHLECELQG---TPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLS----DISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIVEKPESIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGN-EISSG--RKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQ--KPDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFD-VDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNG--INVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQIL-ILEPPYFVKQLEPVKVSVGDS--ASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAISGSEPISVSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSARLILTEGKNPPFFDIRLAPVDAVVGESADFECHVTGTQPIKVSWAKDSREIRSGGKYQ-ISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGK 9160          

HSP 7 Score: 516.538 bits (1329), Expect = 2.356e-145
Identity = 662/2740 (24.16%), Postives = 1098/2740 (40.07%), Query Frame = 1
Query: 1447 GHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNVTLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKNASIEPFKDAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSK----LIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTL---PAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGN--IIINETIGTLDINRIEKNMKGQWVCVATNSAGSS--RKSFN-LDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRY---FINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQES----VQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCL--VVESKPPAVISWLKNGKEIEYSNRIM----AKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATN----DHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGR---VEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKM-VGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTP---NKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGST--LTLFEVKHLDSGIYKCLAINIG--ESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEI--TNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLK----------GSTTNLWCNVSGFPTPQIRWTYME----TIXXXXXXXXXXQLHFMNVDKSHITR---YTCIATNEAGSARKLFDPVLTYPPKIV-SLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGT--QLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRR---VLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTL--DPGG--KRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEI-----FMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEP-KVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGTR--ITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILA-DKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPV-ILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFY-KDMPISPYDMMNFVISNNAKVLTIPSVN-KEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGI-------FRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIIS----PPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQG---LIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKN---YYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVE----LLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLG-NRFRFNSENEINIYDLKPEDTGNYIC-IGERSGAEASTASTYLSIFTRPKFVYKPK-LKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLN---------SNGRGSITLQSVRSENAGEYKCIAKNRVG--SVEYSFMLEVIAKPRVRVYQSDDPSESIKRTI-LMCKVEGKVD-SIVWLKNGVIVQNSSRLYI----NDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSP---PVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIK--YDFVKSLIKNG-SLRIIGVQKEHSGVYFCVASSNQGE 9282
            G   +++C ++      + W+KN+ ++  + T  + F   S   L+I        G Y+ E V  +       G+      + +  PP  +   + A I    +A L+C V S +    + WFK   + +++++K++R+         FS K    L I S + +D GEY CV  +E G     G + TH L   P       ++  +   ++T       + P + +W + G+E+   D +I +      + + I +V+    G+  C A+N AG      +L      KI+      ++   GD  T+  +  G P+ K  W  +G P+       I     +  L     E +  GQ+    +N  GSS    +F  LD    P     + N+D        + C++ G  P RV W +         IA  DRY   F+    SL I  + M D   + C A N  G    S    VQ   S +  P      SK V+  S      VCL    +   P  I W K  KE+           A +++L +  VK  D   YTC   N  G  +    L V+     +   +     K GD   L C+  G P  KI W    R +      R+      + L +  +  E +G + C A N    DH + +    V VK  P  +KE     E+  + +V L   + +G P  +I W+K+   L    GR     I      L++      + G Y+C+ TNEV S     ++T L  P +   K+    +  G        + G    T  W   S  +    N      + +    L ++ +  +  G Y C   N  G  + S  + + E   I +      V   +  TL    SG      KW FK          YK+ V +    L +        GEY+   +N+ G+    + + V    +D+  P    K +     I G  I   C++  + P  I+WFK++ +I  S   +++K S   +T  L + +++  DSG Y C A N       +  L V   P  + K  S+   ++N  T + +     G       W+KDN +L SG    +   +   +L +   + +D   Y C ++N+ G         +FV         +E P+F+K          G +T   C ++G P  ++ W Y++    T      +S    L    +  + +     Y C A N+AG+A    +  +  PP  +  L P +   ++K  ++ L C     P   + W K+   IR++ +  +T+R +   LH+     SD G Y+C+VSN+ G    +  V +  PPS  F  K       L  +        G P   I W KD   +D      +   D    L + S     +GRY C A+N  G       V+  Y   L  +P    ++   V+ T    + LEC+V+G P   + WLKDG  I     +      N     I ++   D+G+Y+   +N FG          +D  I  PPS  +     + ++  G  + + C  +GS   +  +FKDG  +           S K RL+  +    L + + +  D+  Y C  SN  G D     + V+ PP F    V+P +     + T   +  L G   PP KI W +  V L SG    I  +G+   + + +V     G+Y CH  N+V   S    + V   P+F K    +KI    +++ ++ C+  G P   ++W+R E E+ A DK R    D +   +V+Q+ N+  +D+  + C A N  G+     ++ V  PP  +  S  P    +K N +++  C +   + T P  ++W K+   +         + N   S+ ILN  + + G Y C+A+N  G D+    + +  PP+F +  +    ++TV  G     Q   EG+    + W   K+  I   + +      N   L          G + C  +N+ G    +  L V+ PA++      +    G + ++ C   G P+  ++W +DGK +       F +  K  S    L I   + +D G YT    N + + S +  VV +S    PP      K+    +G   +L C V G+ P  + W+      +S     +YQ         L ++ +     G Y CVA N AG  E R  L V   P   +  E E   VL         ++ G P   + W R    L K      Y+  T + L +FN + I   G  TC+  N AG+   T ++ V+     L ++S     + + G S+ +     G    +VTWKKDG ++      N         + I +    D G Y C I   +G +   A   +S    P FV + + L+  V ++   S +C+    P+  + W + G   ++KL          +N   ++    V   ++GEY C A+N +G  S +  F ++    P     Q  D  +++   + L C++ G     + W ++GV++++   L      N   L I Q     +G Y C ASN  G A     L  + P   P F + P +I    GE     C   G     I+W K+ K I+   ++  + + N   LRI+ V K  SG Y C A+++ G+
Sbjct: 4679 GESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYF-VNSEAILDITDVKVEDSGSYSCEAVNDV-------GSDSCSTEIVIKEPPSFIKTLEPADIVRGTNALLQCEV-SGTGPFEISWFKD--KKQIRSSKKYRL---------FSQKSLVCLEIFSFNSADVGEYECVVANEVG---KCGCMATHLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTW-MKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKEPAKIIERAELIQV-TAGDPATLEYTVAGTPELKPKWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVDSVVNGTCRLDCKIAGSLPMRVSWFKD-----GKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPSFVTKP-----GSKDVLPGSA-----VCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKEPATFVEKLEPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSI----VIVKESPYFTKE-FKPIEVLKEYDVMLLAEV-AGTPPFEITWFKDNTILRS--GRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVT-LREPPSFIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEITEDDNIRMTFENNV--ASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATITEEAVSIDVTQGDPATLQVKFSGTKEITAKW-FKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINV----LDLIIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISAS---EKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEKPQSQ---DVNPNTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVG--TATSKATLFV---------KEPPQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSW-YLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVE---VVKYSDVELECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPS--FIKKIENTTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESG-------VERCYAFLLVQEPAQIVEKAKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNI--PPSFTKKLTKMDKVL--GSSIHMECKVSGSLPISAQWFKDGKEI---------STSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPSF---LVKPGRQQAIPDSTVEFKAILKGT--PPFKIKWFKDDVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPKFVKKLEASKIVKAGDSS-RLECKIAGSPEIRVVWFRNEHELPASDKYRMTFIDSV---AVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPP--VFSSFPPIVETLK-NAEVSLECEL---SGTPPFEVVWYKDKRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFVSKLN----SLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIVEKAGPMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISS----LRILSVERQDAGTYTFQVQNNVGKSSCTA-VVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSG---AKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPSFVK--EPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELFN-IDISQSGEYTCVVSNNAGQASCTTRLFVKEPAAFLKRLS---DHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGA--LVSTLEPPYFVTELEPLEAAVGDS--VSLQCQVAGTPEITVSW-YKG---DTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGK 7278          

HSP 8 Score: 514.612 bits (1324), Expect = 9.470e-145
Identity = 622/2612 (23.81%), Postives = 1040/2612 (39.82%), Query Frame = 1
Query: 1903 LIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKE-ISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDP-RISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEI--PLEGDQQTVR------CSATGVPQPKITWEFNGSPVTIDG--NIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQ---DNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKK----VIVCLVVESKPPAVISWLKNGKEIEYS--NRIMAKDNTLVIK--TVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISK--EGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVY--GKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDL-QRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGG--SAKMSYDVIILESP-----KIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFA-PYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKC-LAINIGESLN-FTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQL--ISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRW------TYMETIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELI--RNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRRVL---LSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLP-------CPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWER--HGVPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGN--SVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVIL-WTKENSPILIGDTDYYLTF-NNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRET---ITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKE-GGIFKCIARNEVGSIMKVYKLEV----IMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNG--ITLSKVKNYYTTTDSGLF-IFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISVTGDE------GSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSE------NEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWK-SFRCEATSHPKPDIKWMFNG---RAIESKLNSNGRGSITLQSVRSE--NAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESI---KRTILMCKVEG-KVDSIVWLKNGVIVQNSSRLYI----NDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFT-LLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIK--YDFVKSLIKNGSLRIIG-VQKEHSGVYFCVASSNQGEVHSQPIYLTVQIPGGWSAWQEWSKCSLSCGKGFISRKRLCNNPP 9414
            LII     S  G+Y C+AE+E G   +VG +     PA  ++  E I     D  T       TP     W+ +GR L  +   RIS  N+V  +Q+K  + +  DSG+   +  N  G        +      +L  D+A     PL      V       C   G    +++W  +G  +       I   E   +L+I R++ N  G + C ATNS GS   S  L +   P       + D   G  + ++   +G  P  ++W +G     N  +  G   +I +   ++SL +  +   D   Y C   N  G V+ S  + +   A      T  +++     LKK     + C V  + PP  I+W  N +EI+ S  +R+   ++T V++   V  ED   Y C A+N+ G+      + V+  P    +FK     K+ DV++L  +  G P  +I W K    L      +  I      L +       AG + C  TN+  + +   +V+++ PP   K  E  S    G+         +    P   + W K+   + E    + +  + N+  +Y  G      G Y C+A N+ +   R   +  +  P     + + I   +G+  TL  K  G    T KW      L L  +    +T++    + L I     +  G YT +  N  G  S K   +V+ L  P     K+ + +     FID    L CI +G+    I+W    + I  +        +N   L + +      G Y+C A N+ G +Q +  +TV   PY   K  ++++  N       +    ++  T P  IKWFK+  +++    +  +K     ++L LF  K  DSG Y C L+ ++G + +  TL V   P  + K S   V+   + T     C   G P  R  WY D +++  I    +   +G  T  I   R  +   Y C   N+AG    + ++ V  PP+   I   +  E +K S   L C V+G P  ++ W             +     +   LH    D S    Y CI +NE GS        L  PP  +    +    +LK      S  + + P++ I W KD +++   +N+ ++  +    L + +      G Y C   N+ G+++    + +  P  I    KA +  V     + L CV  G P+ K++W KDG +I   R       ++     + S M+ D+G+Y    EN  G +     ++V          K+  K+++ +G ++ +EC VSG    +  W KDG  I+    YR      S  LE+  ++  D   Y+C   N  G       +T+  PPS         +++K G +  +P           G+P   I +FKD   L          +  K  + +      L LYS   + +G Y C+ +N +G D     + V  PP+F       K+    + +R LEC + G   P  ++ W R  H +P S    +        I + N+   D+G++ C AQN     S    V V   P F  +     +E ++N  V + CE +G PP  ++WY+ ++++ + K    K+ I   N  + + I N+   D   Y C A N  G+      + +  PP+ + +     +  V          S+      +P+ + W KE   ++    +  +TF  N  +L     +   +G+Y C+ KN  G   +   L V  P       ++  E    +TV +G +   +C   G+P  S+ W+     ++      F   N    L I SV ++  G +    +N VG       ++V    + P+  R  K       G S  + C   G     + W  +   I    +Y T        L++      D G YTC   N    D     + +  PP      + + V  G+ V    ++ GT PF+++W+      +       Y   +   L +  +    SG Y CV +N+AG       L  + +P  F    ++ +      + ++      +P  V TW+++G  IT S+  N  TT  + +  I NS K  D G  +C  +N AG D     +   L+  +  P  VT  E      G SV++ C+V G P+ TV+W K    L+     R  F +       N++NI      D+G Y C  E S   AS+ + +     +    +  +LK++ Q      +  C         + W  +G   R  E+   S      TL+ ++++  ++G+Y C A N +G+   S  L      +   +     S  +   +     C V G +   I W K+   ++      I    N  +L I +    D+G Y C A+N  G+      L VK PP F   L  +  A  GE + L C   G P   +SW++N   +   + +  S I + +L  I     E SG Y C A +  G+  S    LTV+ P  ++  Q+ S      G   I +  +   PP
Sbjct: 4908 LIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKE-PAKIIERAELIQVTAGDPATLEYTVAGTPELKPKWYKDGRPLVASKKYRISFKNNV--AQLKFYSAELHDSGQYTFEISNEVGSSSCETTFT------VLDRDIAPFFTKPLRNVDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKG-----NKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKEPA------TFVEKLEPSQLLKKGDATQLACKVTGT-PPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPYFTKEFKPIEVLKEYDVMLL-AEVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPPSFIKKIESTSSLRGGT---AAFQATLKGSLPI-TVTWLKDSDEITE-DDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKND-AGIQRCSALLSVKEPATITEEAVSIDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISVTDT---VSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKMDSIKGSFID----LECIVAGSHPISIQWFKDDQEISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEKPQSQDVNPN-----TRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDT-STSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKEPPQFIKKPSPVLVLRNGQSTTF--ECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTF--IRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFIK-KIENTTTVLKSSATFQSTVAGSPPIS-ITWLKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQIV--EKAKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPS---------FLVKPGRQQAIPDSTVEFKAILKGTPPFKIKWFKDDVEL---------VSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPKFVKKLEASKIVKAGDSSR-LECKIAG--SPEIRVVWFRNEHELPASDKYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVF--SSFPPIVETLKNAEVSLECELSGTPPFEVVWYKDKRQLRSSK----KYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFVSKL---NSLTVVAGEPAELQASIEG---AQPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEP-------AVIVEKAGPMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTRRLK-NTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPSFVKEPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRL-FVKEPAAFLKRLSDHSVEPGKSIILESTYTGTLPISV-TWKKDGFNITTSEKCNIVTTEKTCILEILNSTK-RDAGQYSCEIENEAGRD-----VCGALVSTLEPPYFVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNI-----NDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDA-SCSTALTVKAPPVFT--QKPSPVGALKGSDVILQCEISGTPP 7413          

HSP 9 Score: 512.686 bits (1319), Expect = 3.559e-144
Identity = 625/2575 (24.27%), Postives = 1034/2575 (40.16%), Query Frame = 1
Query: 1921 SESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFID---NDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKL--------SYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIIN--ETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRY---FINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRI----MAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKN--ILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQ--GIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTC-----IASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENE-GGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAINI--GESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQL--ISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXXXXXXXX------XQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIR--NNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDF---RRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITW----------ERHGVPLSSG-GSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSV--MQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPV-ILWTKENSPILIGDTDYYLTF-NNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKE-GGIFKCIARNEVGSIMKVYKLEV----IMPA----LVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGI---FRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLP-------CIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQG----LIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTT-TDSGLFI-FNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKV-SLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSEN---EINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLNSNGRGSI-----TLQSVRSE--NAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRT-ILMCKVEGKVD-SIVWLKNGVIVQNSSRLYINDFNLI----INQAKSKDTGIYQCIASNSAGEAQGQVHLLVKS---PPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNK-KLIKYDFVKSLIKNG--SLRIIGVQKEHSGVYFCVASSNQGEVHSQPIYLTVQIP 9321
            +E   GEYVC A ++ G + A     T    AA V +++I  ++         +C   S P   F WF  GRE+  +D + SI +    S ++I   +  D GE  CKA N  G       L        +++S PK L+          G      C+ TG P  +  W+ +G+ ++   N  I+  E    L+++ +    +G + C A+N  G+      L I   P     +  +  +  + + + CQV+      V W +    G  +P   G  Y   F ++  +L I    ++D   Y+C A N+ G    S  + +     P          ++       + C  ++  P   ++W KN KE+  SN +    +  +  L I  VK ED   Y+C A N VG+     E+ ++  P  I   +   D   G   +LQC+  G    +I W K  + +      R+        L ++S      G + C   N+           +K PP   K+ + D      + V L   +    P   + W K GQ ++   G+++++      +L +        G Y C A NE  S +   ++ I+  P     +   I    G+  TL   + G P    KW +K     +    + I+      N   +    +EL   G YT + +N  GS+       +L+   I  F  K +  +D+ +  TC     IA   P  ++ W    K I  +        E   +L + R      G ++C A N  G KD   +++    P    K  +K+     ++ G  +        + P  I+WFK   ++         K +L+ S+L L+ VK  DSG Y C   N+  G   +  L V    T + K     ++   + T L   C   G P  +  W+ ++ ++   S  R+        L +  V   D   Y C   NEAG D  +  V V   P        +  E LK     L   V+G P  +I W    TI                 L  +    +    Y C  TNE GS+       L  PP  +          L+ G          +   T+ W KD + I   +N+R+   N    L+L   +    G Y C   N  G+ + +  + +  P +I    +A +  V  G    L     G  +   +W KDG  +      ++ ++D    L + ST + D+G Y    +N  G++     + V          K+  K++   G  + LEC+V+G    +I W KD   I+    Y++    N+  LEI  ++ +D+G Y+C A N  G  +    +T+  PP         +  +     ++L     G+    I +FKD   L          +   + +        L L++AK TDSG Y C  SN +G    + ++ V+ PP+F      P +     Q+ + EC + G   P  +++W          ++HG+    G  + +IS  G R  VEN     +G Y C A+N+    S    ++V   P F +      +E V+ + V++ CE TG PP  + W +  +EI + K    K+ +    SV  + IT   P D   Y C  +N GG+      +++  PP  +K+    EN         TF  +V     + P+ I W K++  IL  D + Y++F ++  +L I +  +  SGRYTC+AKN +G +     L V  P +         +++ V     +  +C   G+P   + W      I P    +    NN     I SV K+  G +     N+ GS      L V    I P+    L ++DK+      G+S  + C   G      +W +DGK I    +Y      R+  LE+ + + EDT  YTC  +N    D+ S  + +  PP       S +V+ G Q  +P        I++GT PF+I W+      +S    G   F+  +G    L +  V    +G Y C   ND G       L V   PK  +  E           +++CKI  G P+  + W RN   L     Y  T  DS   I  N+L  ED G   C A+N AG    + ++ V+  P   S P  V   + + V++ C++ G P   V W KD + L++    +++  S+N    I+I ++   D G Y C  +      +   T + +   P+FV K     VV     +       + P   ++W+     +  + + N R +      TLQ  ++E  NAG+Y C  KN  G  E    L V+ +P V V ++   + ++  T  L CKV G  + S+ W K+G ++ +S +   + +N I    I   + +D G Y     N+ G++     + V     PP FT    N    LG   IL C   G    +++W+  K K++     ++   +   +L++  +     G Y CVA++  G    + + LTVQ P
Sbjct: 4351 TEDHQGEYVCEALNDSGKT-ATSAKLTVVKRAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESD-KCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRPKSLTT-------FVGKAAKFICTVTGTPVIETIWQKDGAALSPSPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHFIKELEPVQSAINKKVHLECQVDEDRKVTVTWSK---DGQKLP--PGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVR--EPPSFVKKVDPSYLMLPGESARLHCK-LKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEP-ADIVRGTNALLQCEVSGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMATHLLKEPPTFVKK-VDDLIALGGQTVTLQAAVRGSEPI-SVTWMK-GQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGEL-IVKEPAKIIERAELIQVTAGDPATLEYTVAGTPELKPKW-YKDGRPLVASKKYRIS---FKNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDR-DIAPFFTKPLRNVDSVVNGTCRLDCKIAGSLPM-RVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPSFVTKPGSKD-----VLPGSAVCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKEALE-SSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKEPATFVEKLEPSQLLKKGDATQL--ACKVTGTPPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPYFT--KEFKPIEVLKEYDVMLLAEVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPPSFIKKIESTSS--LRGGTAAFQATLKGSLPITVTWLKDSDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATI--TEEAVSIDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEKPQSQD--VNPNTRVQLKALVGGTAPMTIKWFKDNKEL---------HSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKEPPQF-IKKPSPVLVLRNGQSTTFECQITGT--PKIRVSWYLDGNEITAIQKHGISFIDGLATFQIS--GAR--VEN-----SGTYVCEARNDAGTASCSIELKVKEPPTFIRE--LKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSK----KYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFIKKI---ENTTTVLKSSATFQSTVAG---SPPISITWLKDDQ-ILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQIVEK----AKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKLTKMDKV-----LGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPP-------SFLVKPGRQQAIPDSTVEFKAILKGTPPFKIKWFKDDVELVS----GPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPKFVKKLEASKIVKAGDSSRLECKIA-GSPEIRVVWFRNEHELPASDKYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIVETLKNAEVSLECELSGTPPFEVVWYKDKRQLRS--SKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCT-VKLKEPPRFVSKLNSLTVVAGEPAELQASIEGAQPI-FVQWLKEKEEV-IRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVL-EPAVIVEKAGPMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAV-LTVQEP 6819          

HSP 10 Score: 506.138 bits (1302), Expect = 3.601e-142
Identity = 619/2592 (23.88%), Postives = 1029/2592 (39.70%), Query Frame = 1
Query: 1741 IEPFKDA-----ELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGV--SEAVGFIKTHTLPAASVDE-KEISFIDNDSITASCRALSTPPPTFSWFLNGREL-DPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLE---GDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIINETIGT--LDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGS----YGENITIRCQVEGQPPPRVKWLRGIAG-----GYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNR--IMAK--DNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIII---GDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKG-GRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPL-VEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEV--SSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFK--KKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISL--DGSTLTLFEVKHLDSGIYKCLAIN-IGESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGG--RVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLK----------GSTTNLWCNVSGFPTPQIRWTYMETIXXXXXXXXXXQ-------LHFMNVDKSHITRYTCIATNEAGSARKLFDPVLT---YPP----KIVSLDPDKKRWILKDGEL-RLSCNSDAAPVATIEWFKDGELIR--NNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLF-CVSEGRPKPKIEWRKDGSRIDFR---RVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRT-----DSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRIS----PDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEV---FLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPV-ILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKE-GGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFR----YGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIIS---PPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGY--QEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPV-ITWERNGITLSKVKNYYTTTDSGLFIFNSLKIE--DEGSLTCIAKNVAGEDRLTFQITVE--LLPKV---SLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRF-NSENEINIYDLKPEDTGNYIC-IGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIE-----SKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRV-----------RVYQSDDPSESIK-----RTILMCKVEGK-VDSIVWLKNG-VIVQNSSRLYI----NDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAA 9120
            +EP + A      L+C V  T   + + W+K        +TK      Y+       + L+    + +D+GEY C AE+  G   S+ V  I+   LP +   + K+I       +T +CR   + P    W+ +G  L D  + + S V++V  + +KI       SG+  C A N  G      +L+     K    D+ K + ++   G+     C  TG    +ITW  +   +   GN  I     T  L I ++ K   GQ+ C ATN  G    S  L +   P+   FV  ++ S     GE+I + C++ G P  +V W R  +       YN+        FIN    L I   S ED   YIC+A N  G    S  + +    AP + FTQ    V       VI+   +   PP  + W+K+ K++  S +  I +K  D +L I  ++A D   Y C A N+VG+      +  +  P  +    D  T I    GD + L+   +G     + W K  G  +      RI    + + L + S    ++G + C   ND         ++V  P +I  E      + +     L C++T G P    +W+K+G+ L  +    +    +   LK+      + G Y  +  N V  S+ +    ++  + P +   K+  +    G  + L C++ G    +  W    +  ++   P   ++   +   L ++ +     GIYTC   NV GS + S  + + E P   Q  D   V    ++T T +  G P  K+KW FK  ++L+P  +    +     E  + E    +  G+YSCL  N+ G     + + V  P     T  K +    +  G  I        TPP  + W K+E  I +S   +R  I++    + L + E    D   Y CL  N  G+ +   LV ++ P    +        I E   L   C  +G P  R  WYK++++L S    +++  N   +L+I KV  SD   Y C   N  G              ++  I  R+ P F            G      C ++G    Q+ W Y + +      +  +        L  +  D+SHI +Y C A+N  G+A      +L+    PP    K VS+D       L  GE     C+        I W KD   IR   N ++ +      L +L   + D G Y C  SN  G D  +  + +  PP  +F  K    ++        + C   G P+ K+ W KD + I      R+   D    L +++    D+G Y C A N  G    S  ++V   P      K+ + +E   G  V LEC + G P   ++W KD   +     Y+         + I+ + A+D G Y C A N  G       + + APP   +   L++    VG E++L     G+   ++ +FKD    ++   S N   SY + +   Q  ++    + K T     D+G+ +C A+      V+E +  V  P     +         T  T +LECT+ G   P     W + G  L+S    +IS      G +I   NV   D+G Y    QN V K S   +++V    + P F +    T    +  ++V M C+  G PP ++ W+ +  EI + + +Y +  +      + +  ++  D+  Y C ATN  G+ E    ++V  PP  +++   P+   V     +TF   V     T P  + W K +S ++ GD       ++   L + +  + +SG YTC   N AG+ S T  L + +P KF    + +    +++ G  +  +    G+P  S+ W    + ++P    N   +  + +L IPS   E  G + C   N  G      ++ ++ P         V+   G S S+ C   G P+  + W + G    R    Y     +    L        D+G Y C   N + + S S  + +     PP      + +   VG  V+  C + G+ P  + WY  G     S  +      +   L I +  +  +G Y C A N  G      R+ L     P  F         V+      +C +     QP+ ++W ++   +     Y  +          LK++  D G  TC A N  G+D  T Q+ ++  L+P      L  +V   EG+S  +  +V G    TV W K+   +Q        F N+   + +      D G Y C +   +G+   T+S  +    +P    +      V E  +    C         I+W+  GR I+     S   ++G   + L+ V   ++G+Y C A N  GS      + +  KP V           R++   +P +SI+         + KV G  + ++ W K     +    R++I    ++  L I      D+G+Y+C+A N  GE +  V+L V        + G++ A L +  IL   A
Sbjct: 7012 LEPLEAAVGDSVSLQCQVAGTP-EITVSWYKG-------DTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNV--ATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDI-KPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPK---FVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNM-------SFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVK---APPV-FTQKPSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLSDTSTLI----GDAVELRAIVEGFQPISVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLEPARII-EKPEPMTVTTGNPFALECVVT-GTPELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGN--EIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPSFEQTPDSVEVLPGMSLTFTSVIRGTPPFKVKW-FKGSRELVPGESCNISLEDFVTELELFE-VQPLESGDYSCLVTNDAGSASCTTHLFVKEP----ATFVKRLADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQS---ERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPPYFIEPLEHVEAVIGEPATL--QCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVG---------AVASSAVLVIKARKLPPFFARKLKDVHETLGFPVAFECRINGSEPLQVSW-YKDGVLLKDDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSVD-------LALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGVQEPP--RFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFR---KKPHPIETLKGADVHLECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKK--LSDISTVVGKEVQLQTTIEGAEPISVVWFKDKG--EIVRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFAT----LSVLEPATIVEKPESIKVT---------TGDTCTLECTVAGT--PELSTKWFKDGKELTSDNKYKISFFNKVSGLKII--NVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETN--GLSGSSVVMECKVYGSPPISVSWFHEGNEISSGR-KY-QTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQK---PDPMDVLTGTNVTFTSIVKG---TPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDY----SIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYK-GDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAISGSEPISVSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSARLILTEGKNPPFFDIRLAPVDAVVGESADFECHVTGT--QPIKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTKRLSETVEETEGNSFKLEGRVAGSQPITVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVIKEPKKPPVFDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKDKPAVAPATKKAAVDGRLFFVSEP-QSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDERKKQEKIEGDLRAMLKKTPILKKGA 9498          

HSP 11 Score: 491.886 bits (1265), Expect = 6.846e-138
Identity = 624/2607 (23.94%), Postives = 1030/2607 (39.51%), Query Frame = 1
Query: 1753 KDAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILS---ASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPA--ASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDP-RISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPV--TIDGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRG---IAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVV-ESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSN--RIMAKDNTLVIKTVKAE--DEAIYTCIAKNQVGTAKFDIE---LDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQ-ISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQ--KNILKVYGKNEDETGSYECKATNEVS----SDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYK-MVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAP--YIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLF----EVKHLDSGIYKCLAIN-IGESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGG--RVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVF---VPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXXXXXXXXXQLH----FMNVDKSHIT---RYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNI--TNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLF-CVSEGRPKPKIEWRKDGSRIDF---RRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHG---VPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVF---LKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKE-GGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQG-LIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLS---KVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVE---LLPKVSLPISVTGDE-GSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFN-SEN--EINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLNSNGRGSITLQSVRSE---------NAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGKVD-SIVWLKNGVIVQNSSRLYINDFN----LIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYK-NKKLIKYDFVKSLIKN--GSLRIIGVQKEHSGVYFCVASSNQGEVHSQPIY 9303
            K   LEC V      V + W K     +L   K ++I         F  K+  L    A   D+G YVC A +E G S     +     P+    VD   +  +  +S    C+   +P    +WF N +EL  ++  R+  VN   E+ + I++VK +DSG   C+A N  G D    ++     P  +      +I + G    ++C  +G    +I+W  +   +  +    +   +++  L+I        G++ CV  N  G         +   P     V ++    G+ +T++  V G  P  V W++G   I     I ++     F N    LII  + +     Y C A+N+ G  Q SV   I    A  I   +  QV   +    +  V    E KP     W K+G+ +  S   RI  K+N   +K   AE  D   YT    N+VG++  +     LD    P      +  +D+       L C+  G    ++ W K G+ +      RI      + L +  +    AG FTC ATN   +      + V+ PP  ++K G  D   GS   V L        P   I W+K  + LV   G   I  +  ++ L++Y     ++G+Y CK +N       S + F +       K   S+++    K+G+   L CK+ G  TP  K +W ++  +++ +     +       L +T +  E  G Y C+  N  GS   S  VI+ ESP   +      V  +  + L    +G P  +I W FK   I  +   YK  + ++  +L + +  +   GEY C   NE G    ++ VT+  P  +I      K I     + GG   F   +  + P  + W K+  +I +    D  +++ + +  +L+    EVKH   G Y C A N  G      L+ +  P  + + +    I++ +     +     G       W+KD  +L  G   ++ +T+    L I    + D   Y   V N+ G       +NV    +PPS       +  + +KGS  +L C V+G     I+W + +              H    F+ + +   T    YTC ATN+AG  +      +  PP  V  +  + + +  +  ++L          TI+WFKD + + +    ++   +  T L L  A+ +D G Y C +SN +G      T+ +  PP  +F  K     V   G    F C   G PK ++ W  DG+ I       +   D      ++     ++G Y C A N  G    S +++V   PT     +    VE      V LEC V+G P   +TWLK+   I     Y      +   L I     SD G Y C+  N  G       V +  PPS  + +I N   + +           GSP  +I + KD   LD  D   N   S+   +   Q R      S     SG Y C A N  G +     + V+ P +         V+       +LEC + G   P  K+ W + G   VP S   S+    +     +++V + D+G+Y    +N+    S    + V    + P F K    TK++ V  +++ M C+ +G  P +  W++  +EI +   +Y      R  S +++ N++ +D   Y C  +N  G       ++V  PP  +   + P   +   +  + F   +      K  I W K++  ++ G   +     +   L + +  + ++G+YTC   N  G DS T +L VT PPKF         +  V+ G S   +C   GSP   ++WF  +  +   D       ++  V+ + +++ E  G F C A+N  GS     K+ V  P +       V        S+ C   G P   + W +D + +    +Y   + +    + I +    D G Y C   N++  D+    V +  PP+  S   S+ V  GE   L   +EG +P  + W       I  +      F+     L   +    ++G Y C   ND G +E   TL VL +P +        T  +     ++CK+  G P+  + W ++G  L+   K K  +    S L I  S++ +D G+ T   +N  G+   T  + V    + P  +  +  TG   G+S  + CKV G    +V W  +   +  V G +++   S+N   + +  L   D GNY C+     A +      L++   P FV +P+   V+   +  +F       P   + W    R    +L    R +I  +   +E          +GEY C+  N  G    +  L V          SD   E  K  IL     G +  S+ W K+G  +  S +  I        L I  +  +D G Y C   N AG       +    PP F      + A +G+ + L C   G P  T+SWYK + KL      ++   N   +L    V    SG Y C A ++ G   S+ ++
Sbjct: 4586 KKVHLECQV-DEDRKVTVTWSKD--GQKLPPGKDYKI--------CFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVREPPSFVKKVDPSYL-MLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVN--SEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEPADI-VRGTNALLQCEVSGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMATHLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMS-----FSNGVAVLIIPDVQISFGGKYTCLAENEAGS-QTSVGELIVKEPAKIIERAELIQVTAGDPATLEYTVAGTPELKP----KWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRN-VDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPSFVTKPGSKDVLPGSA--VCLKSTFQGSTPL-TIRWFKGNKELVS-GGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKEPATFVEKLEPSQLL----KKGDATQLACKVTG--TPPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPYFTKEFKPIEVLKEYDVMLLAEVAGTPPFEITW-FKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPPSFI------KKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEITED---DNIRMTFENNVASLYLSGIEVKH--DGKYVCQAKNDAGIQRCSALLSVKEPATITEEAVS--IDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFT--KKLKKMDSIKGSFIDLECIVAGSHPISIQW-FKDDQEISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFV--EKPQSQDVNPNTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKEPP--QFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFI---RELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFIK-KIENTTTV-LKSSATFQSTVAGSPPISITWLKDDQILDEDD---NVYISFVDSVATLQIR------SVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQI--VEKAKSVDVTEKDPMTLECVVAGT--PELKVKWLKDGKQIVP-SRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKK--LTKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEI-STSAKYRLVCHERSVS-LEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPSFL---VKPGRQQAIPDSTVEFKAILKGTPPFK--IKWFKDDVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPKF---VKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIVETLKNAEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVL-EPAVIVEKAGPMTVTVGETCTLECKVA-GTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRIL-SVERQDAGTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKI--VSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANV-AGSDECRAVLTVQEPPSFVKEPEPLEVLP-GKNVTFTSVIRGTPPFKVNWFRGAR----ELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPAAFLKRLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTASSKTVF 7093          

HSP 12 Score: 450.669 bits (1158), Expect = 2.177e-125
Identity = 570/2418 (23.57%), Postives = 963/2418 (39.83%), Query Frame = 1
Query: 2299 ILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNI--IINETIGTLDINRIE-KNMKGQWVCVATNSAGSSRKSFNLDI--GFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQD---NSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSN--RIMAKDNT--LVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPG-RVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTK----EGEKLTLNCKIDGFPTPTKKWSW---KSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPII---VGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDG--STLTLFEVKHLDSGIYKC-LAINIGESLNFTLVVLISPTILGKHSSKSVININEETD--LYITCWSEGNPAPRYLWYKDNSQLISGGRVEIT--NGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTY--METIX----XXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVS-LDPDKKRWILKDGEL-RLSCNSDAAPVATIEWFKDGELIRNN--LRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRR---VLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVR---TPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRIS-PDGTR-ITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQ-ITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNG-QSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQL--GTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVN---KEGGIFKCIARNEVGSIMKVYKLEVIMPA--LVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFR----YGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQ--PKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTD--SGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSL-PISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENE---INIYDLKPEDTGNYIC-IGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLNS-----NGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDP-SESIK--RTILMCKVEGKVD-SIVWLKNGVIVQNSSRLYINDFNL-----IINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKL-------IKYDFVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQG 9279
            ++   L   +  EGD   +  S T   +  + W F    V  D     + ++   TL I+++  ++ +G++VC A N +G +  S  L +     P IK  +  ++ + G      C+++  P  R +W +     Y       D+  I      +SL I    + D   Y C A N++G V  +  + ++  A P    ++ K +          +C V  + P     W K+G  +  S   RI   +N   L +  +  +D  +Y+C A N+ G      EL +  KP  I + +    A +  V  L+CQ   D K  + W K G+ L      +I      + L +     + +GT+ CTA+N+  +      V+V+ PP   K+    Y +   E+  L+C +  G+P  ++ W+KN + L E    R+     + IL +     +++GSY C+A N+V SDS   +I I   P       IK         G    L C++ G  T   + SW   K  I   ++       S +    L I    S   G Y C   N  G        ++ E P  ++  D  +     T+TL     G+    + W+  +++I  +             LI+       GG+Y+CLAENE G       + V       K P K I    +I    G   T    +  TP  + KW+K+   +  S    +++IS     + L  +  +  DSG Y   ++  +G S   T   ++   I     +K + N++   +    + C   G+   R  W+KD  ++ +  R  I    G  +L I +V  +D   + C  TN  G    +  + V  PPS   ++   + + L GS   L     G     IRW     E ++         +  S L    V  S    YTC  +N AG      +  +  P   V  L+P +   +LK G+  +L+C     P   I WF +   I+ +   R++       L L +    D G Y C   N+ G D  +  V  ++  S  F  +    +V    ++ L     G P  +I W KD + +   R     + D    L +   +  DAG YQC   N  G +  S  V +   P+     K+        GGT   +  + G     +TWLKD   I    + R     N   L +  ++    G+Y C AKN  G       +++  P +I    +  +  +  GD   L    +G+      +FKDG  L +           K ++ V+    +L + S ++ DSG Y     N +G    +  + V     PP F T  ++ K++        LEC + G    P  I W +    +S+    + S  D T  + +  ++  D+G Y C A N+        ++ V   P F +      +    NT VQ+     G  P T+ W++  +E+ +   R    D    ++ +++   +  D+ TY C  +N  GT   K  + V  PP+ +K+   P    V  N Q  TF C +      +  + W  + + I      + ++F +G  +  I   + + SG Y CEA+N AG  S +  L V  PP F       RE   V++   + V  +C   G+P   + W   +  I       + +++   V  +        + G ++CI  NE GS     ++ +  P   + +++      +S  +F    T  G P   I W +D + +      Y +  DS    L+I       +GRYTC   N+   +     +++  P +I    KS+ V   + + L C+V GT   ++ W   G   + S         +     I  V K  SG Y     ND G       L VL Q  P  F    T+   VL + + M+CK+   +P     W ++G  +S    Y       S     N+L++ED  + TC   NVAG+D  +  +TV+  P   + P        S+V     ++G P   + W KD   L  V G +     E     +N+Y +    TG Y C +    G+++ T  T L +   PKFV K +   +V+        C+    P+  + W  N   + +         +    I + ++ +E++G++ C A+N  GS   S  + V   P   V+ S  P  E++K     L C++ G     +VW K+   +++S +  I   N      I+N   + D G Y C A N  G       + +K PP F     +++   GE   L  + EG     + W K K+        I+  FV+++    +L+    +  ++G Y C   ++ G
Sbjct: 4290 MIHTPLVDTVSEEGDIVHLTTSITNAKE--VNWYFENKLVPSDEKFKCLQDQNTYTLVIDKVNTEDHQGEYVCEALNDSGKTATSAKLTVVKRAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYE-----SDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTE-AYPPTFLSRPKSLTTFVGKAAKFICTVTGT-PVIETIWQKDGAALSPSPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHFIKELEPVQSAINKKVH-LECQVDEDRKVTVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVREPPSFVKKVDPSYLMLPGESARLHCKL-KGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPP-----SFIKTLEPADIVRGTNALLQCEVSG--TGPFEISWFKDKKQIRSSKKYRLFSQKSLV---CLEIFSFNSADVGEYECVVANEVGKCGCMATHLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIV-------KEPAKIIERAELIQVTAGDPATLEYTVAGTPELKPKWYKDGRPLVAS---KKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDI-APFFTKPLRNVDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPSF--VTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKEPATFVEKLEPSQ---LLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSIV--IVKESPYFTKEFKPIEVLKEYDVMLLAEVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPPSFI---KKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATITEEAVSID--VTQGDPATLQVKFSGTKEITAKWFKDGQELTL---------GSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSF-TKKLK-KMDSIKGSFIDLECIVAG--SHPISIQWFKDDQEISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEKPQSQDVNP--NTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKD--DTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKEPPQFIKK---PSPVLVLRNGQSTTFECQITGTPKIR--VSWYLDGNEI-TAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTF------IRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIR--SSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFIKKIENTTTVLKSSATFQ--STVAGSPPISITWLKDDQILDEDDNVYISFVDS-VATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQIVEKAKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISA-QWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPSFLVKPGRQQAIPDSTVEFKAILKGTPPFKIKWFKDDVEL--VSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCT--TMLLVTEPPKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPP---VFSSFPPIVETLKNAEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKIASKNFHTSIHILN-VDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENV---ATLQFAKAEPANAGKYICQIKNDGG 6617          

HSP 13 Score: 139.428 bits (350), Expect = 1.898e-31
Identity = 366/1756 (20.84%), Postives = 637/1756 (36.28%), Query Frame = 1
Query: 4318 GGNITFSCVMNSTPPAEIKWFKNEIDIYKS------LPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAINIGESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSE-GNPAPRYLWYKDNSQLISGGRVEITNGGKT--LLIKKVRRSDDSVYQC-HVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXX------XXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLL---NAQESDIGIYKCLVSNKLGLDKQA----WTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRI---DFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFD-VQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITW-LKDGIPINRLPSYRYRIIGNSK--QLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEP-KV-----NWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGT--RITVENVKQYDAGEYKCHAQNEVSKISL-VFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEIL-ADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPA--EGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQG---LIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQ--PKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLS---KVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVEL----LPKVSLPI----------SVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERS-GAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGKVDSIVWLKNGVIVQNSSRLYI----NDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKS-------------------------PPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKN----GSLRIIGVQKEHSGVYFCVASSNQGE 9282
            G +  F   +   P  E +W+KN + I +S       P+D          L + +V   DS      AINI    +    +L+    L   + +    + +E D   T   E   P  +  WYKD  ++  G +  + +  K   L I  +  SD   Y C  V +E  +      V   V   +  +   E PE   G    L C VS     + +W + +                   L   +V K     Y+ +   +  + +    P    P  I+    D+K  + +   ++L        V  + W KDG+ ++ + RV+I     Q H+L   +  + D G Y   +   LGL        ++VD++ P             V  G    L C         ++W  +  +I   D  + ++      L +N T  +D G Y+ I        ++S + +++  G        R      T      +E   SGI    + W  KD       PS +Y+I  + K  +L ++ M   D G+Y+  A       +  + V  GA      ++ L +  +    E    C    +P+    + +DG  L + +   ++   +K+RL+++          A + D              D+ EY+ +V T        VE  K+     N    +T+    T+         + W ++GV L S     IS  GT   + ++N    D   Y        +   L V  V++  KP+         + A++N TV      +    P + W+ +  EI  +DK R       R    + + NI P DA  Y  TA  G    + K  +  +   K MK      N  V E    +F C V ++N+     +W K    I + +    +       L I+N  +++S  YT     + G D  +  LTVT     P   +   + I  +   ++ F+     EG    S  W    + I   D            L I +V+            +  S   +Y     +     +  I+V E+    F    +    P   ++W +D + +    R   + +     L I   +  D G+YT      +S     V+   +   +I S KK + V   ++ ++   V        HWY  G  +I+  +   ++++ E+    + I   R+  +G Y  VA    G     +TL V     P++ +  E +   V +      C ++ G PQP I+W +    LS   K K  +   +  L +  +   ED    TC AKN  G    +  ++VE+     P   +P+               EG      C+V G       + KD +   +      +F    ++ I +  PED G Y  +   + G  +STA+  L     P+ +   +++  + E   K F   ++S    + + + +     SK+N       TL+            ++++ V   ++    E      ++   + D S     T+ +  +      I W  NGV++  S+        +D +LII   K +D G Y C+ASN  G+     +L + S                         PP F      I    G   I      G P PT++W+K  K +      ++I N    G+  +   Q+E SG+Y C A +  GE
Sbjct: 2092 GSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNV------CELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSG---ELECIVSP-ENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMKP---RPIAILQGLSDQK--VCEGDIVQLEVKVSLESVEGV-WMKDGQEVQPSDRVHIVI-DKQSHMLLIEDMTKEDAGNYSFTIP-ALGLSTSGRVSVYSVDVITP--------LKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVEKIKIIRG-------LRDLTCTETQNVVFEVELSHSGI---DVLWNFKDK---EIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGK--LTVAGGA-----ISKPLTDQTVAESQEAVFECEV-ANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIA----------ATKLD--------------DIGEYTYKVATSKTSAKLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPK--------DVTALENATVAFEVSVSHDTVP-VKWFHKSVEIKPSDKHR---LVSERKVHKLMLQNISPSDAGEY--TAVVGQLECKAKLFVETLHITKTMK------NIEVPETKTASFECEVSHFNVPS---MWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTF----VCGNDQVSATLTVT-----PIMITSMLKDINAEEKDTITFEVTVNYEGI---SYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSE---PDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDV---RIRSIKKEVQVIEKQRAVVEFEV-NEDDVDAHWYKDGI-EINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVA----GRNRSSVTLYVNAPEPPQVLQ--ELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFP-EDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEA---PESILHERIEQEI-EMEMKEF---SSSFLSAEEEGLHSAELQLSKINE------TLE-----------LLSESPVYPTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGE 3702          

HSP 14 Score: 133.265 bits (334), Expect = 1.201e-29
Identity = 320/1573 (20.34%), Postives = 610/1573 (38.78%), Query Frame = 1
Query: 2011 PAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSA---TGVPQPKI--TWEFNGSPVTI--DGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVT---NIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQD---NSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAF-TQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRIMAKD----NTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQ--LTVYSITEEHAGTFTCTATNDHAA---VVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPG-RVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITI--LVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFN---DKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQ-ETLIVERAASMHGGEYSCLAENEGGKDQKNSI-VTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHL--DSGIYKCLAINIGESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKT--LLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVS--GFPTPQIRWTY----METIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGT--QLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDF-RRVLLSDDGYH--LTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTV------VLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKD-----ASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKN 6558
            P  +V   + + ++ D IT  C      P    WF +G E+ P+ P+ SI  D     +KI     +D GE +C          V ++   I + K          PL G +  V  +A     + +P +   W+  G P+T   D  II +     L ++  +  M G+     +  A +++ + NL +   P I  F+T   ++     +     C+V  +P    +WL+G        I   DR+ + +D   +S++IK  + ED++ Y+ +A+++H     S ++ I GI   ++ F T  K V  +   K+  V  V  S     + W KN + +  +  +  +D    +++  K +  +D +     A      AK  +   ++  P   G  + +    + D ++LQC+      P ++W K G+   ++P    VI  DG +  L +    +   G +TC    D  +    +++ ++ +  P       +   E+   E       I+  +      W   G+ L++ P   ++  G+ + L ++    D+TG  + +A N  SS     +  +  L+ P      +  +    GE  T +C++     P + W  K   L+        +   +  + L +  ++ E  G       +     K   ++ + E P  ++F    +   V    T  L C  S     K+KW FK       +  Y++V + +   L++          Y+C A     KD K S  + V  P+++   P  ++      +     F C + S   A++KWFK+  +I K     ++ I   G+   L   K L  D   Y C       S    L VL    +  K+ +   I ++E   + + C     P    +WYK + ++I  GR EI   G+   L+I+     D   Y C + +   + K    V+     +   IS  +  E L+G      C++S   FP   ++W      +E+ +   ++++  +   +  D +     T +     G+AR      LT   K+  + P K   + +  E+  +C  +    A  +WF++ E I ++ +  I  +     L + +A   D   Y   ++N  G + ++    I+    ++        +     ++  +C    R    ++W K+G  + F  RV    D Y   LT+      D G Y   A    GQ     ++ +   PT          VE     TV      V  C +S      + W ++G  I     Y++   G+  +L I   +  D   Y+C  ++   +  +F++                E  +++   +R P     +P  ++ F  + N  D  ++   ++        K +++   +   L +   K  D G Y+  A +      +E +      P+  T++     +   +  + L   +   A P A+  W +   PLS+  +I  + + T   +   K+ D G YK   QN+  K     N++V   P   +N
Sbjct: 12590 PYFTVKLHDKTAVEKDEITLKCEVSKDVP--VKWFKDGEEIVPS-PKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEK----------PLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGE----VSFQAANAKSAANLKVKELPLI--FITPLSDVKVFEKDEAKFECEVSREPK-TFRWLKGTQE-----ITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHT----SGKLIIEGI---RLKFLTPLKDVTAKE--KESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMSSEAKLTV---LEGDPYFTGKLQDYTGV-EKDEVILQCEISKADAP-VKWFKDGK--EIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRP-------LHSVEVMETETARFETEISEDDIH--ANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRP------LKDVTVTAGETATFDCELSYEDIPVE-WYLKGKKLEPSDKVVPRSEGKV--HTLTLRDVKLEDAGEVQLTAKDF----KTHANLFVKEPP--VEFTKPLEDQTVEEGATAVLECEVSRE-NAKVKW-FKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDA-----KDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMA---RFECEL-SRENAKVKWFKDGAEIKKG---KKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTS--GMLTVLEEEAVFTKNLAN--IEVSETDTIKLVC-EVSKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGK--VKVHEL---AAEFISKPQNLEILEGEKAEFVCSISKESFP---VQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVM--VGAARAAAH--LTVIEKLRIVVPLKDTRVKEQQEVVFNCEVNTEG-AKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWC-KVNRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTA----GQDKSVAELLIIEAPT--------EFVEHLEDQTVTEFDDAVFSCQLSR-EKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKSRARLFVE----------------EIPVEI---IRPPQDILEAPGADVVFLAELNK-DKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAA----PKIKTAD----QDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLST-KTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRN 14022          

HSP 15 Score: 129.798 bits (325), Expect = 1.427e-28
Identity = 159/622 (25.56%), Postives = 250/622 (40.19%), Query Frame = 1
Query: 5425 LGGNLYLFCVSEGRPKPKIEWRKDGSR-IDFRRVLLSDDG--YHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLK--------DGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNS-LDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLY--QCNASNAIGY-DVMEYS--VRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGS-----------------IRISPDGTRITVENVKQYDAG-EY----KCH---AQNEVSKIS--LVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKI----MKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNP---KSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFP 7137
            LG    L C   GRP P I+W + G   I  R+  +S DG  + LTV +  + D G Y CIA N  G+ + S  + +   P   PG     K    VG T+ L  +  G P PA+TW          + I I     Y + ++ N         + + AG+Y     N FG ++  +DV I   P      I+ E ++K    +    PA+           DG S +  + +   +     +  LVS    + T      T++  Y  + +A N  G  D +E S  V +++P E   +  +P +   T  +    C           + W+    P S GG+                 I ++ +  R TV +VK    G EY    KC     ++E S+IS  +    +V ++   +K +L   +     +   + C+ TG+P P + WYRQ +EI+AD  +Y   +   G   + I ++  DDA  Y   ATN GG++     + V +P KI        +G  +    E + I    S        PVI W K     LI +  +Y         +++ P   +  ++G Y   AKN  G D  T  L V   P  P
Sbjct: 31473 LGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKN-------VQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPAD-----------DGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAVTKDS----CV----------VAWKP---PASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRN-LNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFS----GKPDPVITWQKGQD--LIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPP 32052          

HSP 16 Score: 126.331 bits (316), Expect = 1.484e-27
Identity = 367/1792 (20.48%), Postives = 627/1792 (34.99%), Query Frame = 1
Query: 2851 IAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRIM---AKDNT--LVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIII--GDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIA---GQKNILKVYGKNEDETGSYEC-----KATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKND--LLITQMRSELQGIY--TCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNT-ITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPI-IVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSL------PKDRFKISLDGS--TLTLFEVKHLDSGIYKCLAINIGESLNFTLVVLISPTILGKHSSKSVIN--INEETDLYITCWSEGNPAPRYLWYKDNSQ--LISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNL-WCNVSGFPTPQIRWTYMETIXXXXXXXXXX------QLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIR--NNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFR---RVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVS--GIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYI--IKVGDELR--LPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAI--------GYDVMEYSV--------RVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQ------MSCECTGYPPPTLLWYRQEQ--------EILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGP----------ENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSP---------------------------------------------------PKFPTDFS--------IFRETIT---VQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKEG-GIFKCIARNEVGSIMKVYKLEV---------------IMPALVRL----------DKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGK----GIFRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVII 7677
            + APKI      Q V + +     V +V   KP     W KNG +IE S+RI     +DN   LVI+ V AED A     A N  G       L VQ K +I    + +  +  +   +   +C+T  +P  K++W K G  +      R+        L++ +I    A  ++C    D         +   A  +  KE + D E+    + EL CI++  N   K  WY N   L +  G+  I    G++N L V    +++ G Y       K T ++    R     I +    SD K+      EG+ + L  K+      + +  W     ++Q  P    +  IDK    LLI  M  E  G Y  T     +  S ++S   + + +P       K V  I+ T   L C  S      +KW    + I P+     +V   ++ L++ R  +   G Y  +     G+ + N                 N++   I I+ G    +C        E++   + ID+  +       P  ++KI   G    LT+  +   D G Y   A   GE++    +     T+ G   SK + +  + E  +    C    NP  +  W +D     L +  R E     + L+I   +  D   Y   V       K   +  V +  ++  +++ ET + +   T  L   NV G     ++W     +         S       L   N      + Y         SAR   + V     KI+    D            +S + D  PV   +WF     I+  +  R+    +  +L L N   SD G Y  +V  +L    + +   + I  ++K          +    +  F V      P + W K+G  I+     ++++    + L + +T   D+  Y  +     G   +S  + VT  P +     +    E     T+  E  V+  GI   +  WLK+G+ I      + R    +  L I  +   DA  Y+ VA        ++++          R+    ++I  IKV ++ R    C  +  P+  + + KD   L + D    +   Y  RLL+          S + +D+G Y   A   +        G DV   S+        + R   EF+ +  +   +W+ +    +E               ERH   +      RI     R+ +   +Q DAGEY   A    S ++L  N            +    ++ +Q  TVQ           +G P P + WY++EQ        + L D + Y           + +    P+DA  Y C A N  G       +SV +P  +      P          ++    E     F C V   ++    + W  ++  I          F +   L I     ++ G YT  A N  GQ S T  L++ +P                                                   P +PT F         IF + ++   + +G          G P P I WF+  + ++P     FV   +   L I     E  G + C+A N+ G  +    L++               +  +L +L          +   +R   G       T  G P P + W ++ K     ++       + +G   + D + ED+G Y C   N + + + + +++++
Sbjct: 2075 MEAPKIFERIQSQTVGQGSDAHFRVRVV--GKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECET-SEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKE-LQDIEVPESYSGELECIVSPENIEGK--WYHNDVEL-KSNGKYTITSRRGRQN-LTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPR----PIAILQGLSDQKVC-----EGDIVQLEVKVS---LESVEGVWMKDGQEVQ--PSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPL------KDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIV----GRVETNC----------------NLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYA---GENMTSGKL-----TVAGGAISKPLTDQTVAESQEAVFEC-EVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSAKLKVEA-VKIKKTLKNLTVTETQDAV--FTVELTHPNVKG-----VQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVETV-----KIIKKPKDVTALENATVAFEVSVSHDTVPV---KWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVV-GQLECKAKLFVETLHITKTMKNIEVPETKTASFECEVSHFNV------PSM-WLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVC----GNDQVSATLTVT--PIMITSMLKDINAEEK--DTITFEVTVNYEGI---SYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEA---------RHIEFRKHIKDIKVLEKKRAMFECEVS-EPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIP---------STRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKD---GIEINFQ---------VQERHKYVVER----RIH----RMFISETRQSDAGEYTFVAGRNRSSVTLYVNAP----------EPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEY----------TLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLK---VSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLSKINETLELLSESPVYPTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLVL 3712          

HSP 17 Score: 124.79 bits (312), Expect = 4.988e-27
Identity = 211/989 (21.33%), Postives = 391/989 (39.53%), Query Frame = 1
Query: 1741 IEPFK-----DAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTL---PAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGREL-DPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGI--DEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIIN--ETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDI-------GFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNI---PIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNR----IMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIG-------DFKTFIDAKDGDVIVLQCQTK-------GDPKPKIEWRKGGRPLTMEPGLRIVISPDG--SQLTVYSITEEHAGTFTCTATNDHAAV-----------VKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQ-ITILVAPKASDSKMIKIYTKEGEKLT----------LNCKIDGFPTPTKKWSWKSSILDLQ-RNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGST--LTLFEVKHLDSGIYKCLA 4503
            +EP K      A L+C +  T   + + W+K     +L+ T  +++ H++ +     + L+      +D+GEY+C AE+  G   A  F+        P+ S   +++       +   C    + P + SW+ +G+ L D  + + S +++   + + I       +G+  C A N  G      R+ L+    P    + LA    + G+     C  TG    K++W  +   +   G   I+  E    L + +++K   GQ+ C A N  G    +  L+I        F  R+ + V   +G+   +  +  +V G  P  V W +      NI   P +  +  F N    L ++   M D   Y C   N  G    +  I I     P + F Q    V  S  + V +   V+   P  I WLK G+EI+ S+R      +    L ++ V   D   Y C A N  G+     ++ ++ KP +         D + F  ++   + V++  T        GDP P ++W KG +   +  G R+ I   G  ++L +   T+  +G + C A N+H  +            K+ K+       + K  I     G +E +++  ++ + +P  + E Y     + +  G ++      +LK     E+ET   E +       D + F+ +   +  + S ++ + +  K+ E  T          ++ KI+    P  K SW      L+  + F I+    D++ L +   + + QG Y      V G    S  + ++E        D ++     T T+TC  S  P  K +W    +++ P       V      L +    +   G+Y+C  E+     + ++ + + A  I      +NI    +    + TF C + S   A + W+K   ++ +S    ++    DG    +T+  V   D G+Y  +A
Sbjct: 8894 LEPVKVSVGDSASLQCQLAGTP-EIGVSWYKG--DTKLRPTTTYKM-HFRNN----VATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAISGSEPISVSWYKDGKPLKDSPNVQTSFLDNT--ATLNIFKTDRSLAGQYSCTATNPIGSASSSARLILTEGKNPPFFDIRLAPVDAVVGESADFECHVTGTQPIKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTKRLSETVEETEGN---SFKLEGRVAGSQPITVAWYKN-----NIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVIKEPKKPPV-FDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKDKPAVAPATKKAAVDGRLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKG-KWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDERKKQEKIEGDLRAMLKKTPILKKGAGEEEEIDIMELLKNVDPK-EYEKYARMYGITDFRGLLQAF---ELLK--QSQEEETHRLEIEEIERSERDEKEFEELVSFIQQRLSQTEPVTLI-KDIENQTVLKDNDAVFEIDIKIN---YPEIKLSWYKGTEKLEPSDKFEISIDG-DRHTLRVKNCQLKDQGNYRL----VCGPHIASAKLTVIEPAWERHLQDVTLKE-GQTCTMTCQFS-VPNVKSEWFRNGRILKPQGRHKTEVEHKVHKLTIADVRAEDQGQYTCKYEDL----ETSAELRIEAEPIQFTKRIQNIV---VSEHQSATFECEV-SFDDAIVTWYKGPTELTES---QKYNFRNDGRCHYMTIHNVTPDDEGVYSVIA 9834          

HSP 18 Score: 117.472 bits (293), Expect = 7.721e-25
Identity = 380/1832 (20.74%), Postives = 673/1832 (36.74%), Query Frame = 1
Query: 3388 EFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNI--LKVYGKNEDETGSYECKATN---EVSSDSRFF-QITILVAPKASDSKMIKIYTKEGEKL-TLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTC---DGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGK---DQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLF--EVKHLDSGIYK----CLAINIGESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVE-ITNGGKT-LLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGI---SMRETP------EFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELI--RNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPK-IEWRKDGSRIDFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENT-----HGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSK--QLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFF-------KDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTL--MGVADPPAKITWERHGVPLSSGG--SIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTK-IEAVQNTTVQMSCECTGYPPPTLLWYRQEQEI-LADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRV-KENMQITFHCSVYNYNMTKPVILWTKENSPI--LIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNA-KVLTIPSVNKEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDK-------------IEVRERSGTSFSVLCTAEGYPKPVIKWTRDGK----GIFRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPT----ETETTG------------VLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNY---YTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGE-----------------DRLTFQITVELLPKVSLPIS---------VTGDEGSSVTIICKVEGKPKPTVTWKKDGQSL-----QNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIF 8511
            E   S++AP     E I    +G   +      +  G P P+ EWYKNG  +           + N+  L +     +++ S   KA N   E SS +    Q   L+       ++  +  KE + + T  C+      P  K  W    +++        +S    + L I  + +     Y+C   +  NV  +AK+  +  ++E  K +Q  +    +   +  L CI S     + KW      +  N          ++ L V+       GEYS + + +        K   + +     D K           +  G+I    V  S    E  W K+  ++    P DR  I +D  +  L   ++   D+G Y      L ++    ++   V +I+P           +N+ E T   + C           WY ++ Q+    RV+ I  G K  L+I +   SD+  Y+  V    G  + N +++V     I G+   +  ET       E        LW     F   +I+ +    I +   +   + L+ M  D+    +YT  A     S +      LT     +S  P   + + +  E    C   A P +  EW +DG+ +   NN+R        +L +   +  DIG Y    + K+   K +  + +    ++K   K   +         +F V    P  K ++W K+G       VL S++ Y ++V  T+ +   +   I + +      G+   S  + V     +    K+   V      TV  E  VS    P + W    + I   PS ++R++   K  +L +  +  SDAG Y+ V      + ++F++                 +I K    + +P     S    ++ F       K+G  ++M         S K +++V  +   L + +    DS  Y     N       + S  +   P   TS ++  +N     T + E T+   G++       W ++GV + S     +R       + + NV   DA +Y   A    S  +L      +++ R  + + + K I+ ++       CE +  P  T+ W + +QE+ + D+ +  K   +     + I + +  DA  Y   A  GG     K     +    +  RS+  E   + K+   + F  +  + +       W K+   I   + +   Y+       + I   +  ++G YT     +AG++  +  L V +P   P       + +TVQ G    F     G P P I W+ ++  +S      F+       +L I +  ++  ++ C A+N+ G       L V +P +V  D+              +     G      C   G    V  +++D K      FR     D  T  LEI +A  ED G YT   +N + Q S + ++       +E+P+  +  R+ +++ +                    + SS+ L       E+GL        HS   +    N+        TLE+L +  ++ PT    E E TG             +  V  +   ++ GIP+P I W  NG+ L+   +Y   +   D  L I  + K+EDEG  TC+A N  G+                 D  T     + L K+  P           +   +G        V G+P PTVTW K+ + L       ++ N    N      + D + ED+G YIC  E    E++ A+  L + 
Sbjct: 2070 ELSPSMEAPKIF--ERIQSQTVGQGSDAHFRVRVV-GKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLIT---FTQELQDVVAKEKDTMATFECETS---EPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESY---SGELECIVSPENI-EGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQK-----------VCEGDIVQLEVKVSLESVEGVWMKDGQEVQ---PSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPL--------KDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIV----GRVETNCNLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLW----NFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEG---KYTFYAGENMTSGK------LTVAGGAIS-KPLTDQTVAESQEAVFECEV-ANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEY----TYKVATSKTSAKLKVE---AVKIK-KTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGV------VLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKII----KKPKDVTALENATVAFEVSVSHDTVP-VKWFHKSVEIK--PSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETL---------------HITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEM---------SEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGND------QVSATLTVTPIMITSMLK-DINAEEKDTITFEVTVNYEGIS-----YKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATL------YVEARHIEFRKHIKDIKVLEKKRAMFECEVS-EPDITVQWMKDDQELQITDRIKIQKEKYVHR---LLIPSTRMSDAGKYTVVA--GGNVSTAKL---FVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAH-----WYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTF----VAGRNRSSVTLYVNAPE--PPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFED--TYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANL------SLEAPESILHERIEQEIEMEM-----------------KEFSSSFLS----AEEEGL--------HSAELQLSKINE--------TLELLSESPVY-PTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVI-GIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFT-KLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNP---NGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLVLL 3713          

HSP 19 Score: 106.686 bits (265), Expect = 1.518e-21
Identity = 357/1800 (19.83%), Postives = 647/1800 (35.94%), Query Frame = 1
Query: 2335 EGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNII---INETIGTLDINRIEKNMKGQWVCVATNSAG-SSRKSFNLD-----IGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNS------LIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQ-VVVESTLKKVIVCLV----VESKPPAVISWLKNGKEIE----YSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAK--DGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCT------ATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVE--IAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIP-PNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKH---LDSGIYKCLAINIGESLNF---TLVVLISPT-ILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRW------TYMETIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGT--QLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPP-SIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFR-RVLLSDDGY--HLTVNSTMETDAGRYQCIAENTHGQTDI---SFDVQVTYGPTLDPGGKRYYKVERTV--GGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSK--QLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTP---------PEFDTSNVEPKVNWFTN--QTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRIS--PDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKI--MKRSLGPENHRVKENMQITF----HCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFN-NGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTS-------------------------PPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFY--KDMPISPYDMMNFVISNNAKVLTIPSVNKEGGIFKCIARNEVGSIMKVYKLEVIM 7410
            +G     R    G P P+  W  NG  +     I      + +  L I  +        +  A N AG +S  +F L      I F   ++D V     +     T  C+   +P  +VKW +       + +  GD+Y ++ D        L I     ED S  + + +N    V+ + ++ + G     + F +  Q + V  +    + C+V    +E K      W  N  E++    Y+         L +K V  ED+  Y+ +   +  T K    L ++ +PI I   +   D K  +GD++ L+ +   +    + W K G+ +     + IVI      L +  +T+E AG ++ T      +T+   +V   + V V  P       + D  +       L C ++  + +  ++WY N +  ++   RV+  + G K  L +   +  + G Y+      V ++       I +     D    +      E    +  ID        W++K   +          +  I K  L +  M  + +G YT        S K++     +  P      D++V      +    +A  NP  K +WL   K +P  N +  +  G ++  LI+        GEY+          + ++ + V A  + +K   KN+T   +    +  F+  +       ++W KN + +  +   +++ IS+ G+  +L  +K+   +D  +Y      +G S      T+ ++  P  +    ++     ++   D     W   +     +   D  +L+S  +V        L+++ +  SD   Y   V  +     K F   + +  ++  I + ET       T +  C VS F  P + W        M      ++     QL  MN        YT +  N+  SA     P++     I S+  D            ++ N +     + +W K+G  I++  +  +  +     L++ N    D   Y  +        K   T  + +    I+F       +V L     +F      P   ++W KD   +    R+ +  + Y   L + ST  +DAG+Y  +A        +     DV++           R  K E  V      V+E  V+     A  W KDGI IN     R++ +   +  ++ I   + SDAG Y+ VA      + ++++     PP + +   L    ++ G   R     +G P P I+++K+   L            +K + L   +   L L  A   D+ +Y C A N  G      S+ V  P         P +  + + P  +  T+  Q    +C + G      K++W      +      R++   D  ++ +      D G Y   A N V ++S                           +T  +S E     P ++L  R EQEI  + + +    +      +    +Q           +    T+E   E S + P K    K   GP   +   N  I+       SV    + KP I W   N  +L    DY   F+ +  SL IL  K ++ G YTC A N  G+   +  L + S                         PP F  +    R       G    F+    G P P++ WF   K +  S Y  +    + +   +      ++ G++ C A N +G      +L V++
Sbjct: 2091 QGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMA---TFECET-SEPFVKVKWYKD-----GMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDEN----VKTTAKLIVEGAV---VEFVKELQDIEVPESYSGELECIVSPENIEGK------WYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCK----LKMKPRPIAI--LQGLSDQKVCEGDIVQLEVKVSLESVEGV-WMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSV---YSVDVITP-------LKDVNVIEGTKAVLECKVSVPDVT-SVKWYLNDE-QIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKL-IVGRVETNCNLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVL------WNFKDKEIKPSSKYKIEAHGKIYK--LTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAISKP----LTDQTVAESQEAVFECEVA--NPDSKGEWLRDGKHLPLTNNIRSESDG-HKRRLIIAATKLDDIGEYTYKV----ATSKTSAKLKVEA--VKIKKTLKNLT---VTETQDAVFTVELTHPNVKGVQWIKNGVVLESN---EKYAISVKGTIYSL-RIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVE---IKPSDKHRLVSERKVH------KLMLQNISPSDAGEYTA-VVGQLECKAKLFVETLHITKTMKNIEVPET------KTASFECEVSHFNVPSM-WLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVTPIM-----ITSMLKDINAEEKDTITFEVTVNYEG---ISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAG------KATSTATLYVEARHIEFRKHIKDIKV-LEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRI-----------RSIKKEVQVIEKQRAVVEFEVNEDDVDA-HWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAP--EPPQVLQE--LQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLL---------STGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTD---LKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVS---------------------------STANLSLEA----PESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQ----------LSKINETLELLSE-SPVYPTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFF-NGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAKSLEKLGGPCPPHFLKELKPIR----CAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLVLL 3713          

HSP 20 Score: 103.605 bits (257), Expect = 1.187e-20
Identity = 303/1571 (19.29%), Postives = 573/1571 (36.47%), Query Frame = 1
Query: 1759 AELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIP----LEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNI--IINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNI---PIALGDRYFINQDNS---LIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRIMAKDN----TLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYS-------ITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEI--PGRVEIAGQKNILKVYGKNEDETGSYECKAT-NEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLF--EVKHLDSGIYKCLAINIGESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKD----NSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXX------XXXXXXXQLHFMNVDKSHITRYTCIATNEAGSAR----------KLFDP---VLTYPPKIVSLDPDKKRWILKDGE-LRLSCNSDAAPVATIEWFKDGELIRNN--LRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRRVLLS--DDGYH---LTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPAN-----------------------GSPNPNIAFFKDGNSL---DMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIG 6216
             ELEC V  +  N+  KW+ +    ELK+  ++ I   +   N     L +   ++ D GEY  V + +    +    +K    P A +       +    I      +S       W  +G+E+ P+D R+ IV D Q   + I ++  +D+G        +       + LS      + S+D+   +     +EG +  + C  +      + W  N   +  D  +  I+  T   L INR   + +G +  +     G    + NL +    +I   + ++  +  +N+    ++            GI   +N     I    +Y I        L +  +  +D+  Y   A    G+   S ++ ++G A   I+   + Q V ES  + V  C V  + P +   WL++GK +  +N I ++ +     L+I   K +D   YT     +V T+K   +L V+   I     K     +  D +     T  + K  ++W K G  + +E   +  IS  G   T+YS       I +E    F        A +  E    +K P  ++          + EN  +   ++  + +  ++W+      VEI    +  +  ++ + K+  +N   + + E  A   ++   ++ F  T+ +        M  I   E +  +  C++  F  P+  W      +++      +    + +  ++ T      +  + C    V  +  ++  ++I    K I   +K  +  + T+    I+        KWL     I           +   +L +         +Y+ +A    GK    + + V A +I+ +   K+I    ++      F C + S P   ++W K++ ++  +   DR KI  +     L     +  D+G Y  +A   G +++ T  + +    +   S K  + + E+    +      +    + WYKD    N Q+    +  +      + I + R+SD   Y    T  AG ++ +  + V  P     +   +      G        +SG P P+I W   E + S       L       L  +         YTC A N+ G A           ++  P   +  YPP I++   D    +  +G+  R  C      +  + W+   + I+ +   R+       QL +  A   D G Y  + SN +G       + +  P SI        H+                   +IE   +    +F    LS  ++G H   L ++   ET     + ++E+    T    + + T GP      K     + ++G    L   V GIP P I W  +G+ +     Y++   G+   L I+  +  D G Y+C+A N +G+      + I +     ++      + K  ++L  PCP +                       G P P + +FK+   L     + +  N + S               +   +R DSGLY C A N +G
Sbjct: 2284 GELECIV--SPENIEGKWYHN--DVELKSNGKYTITSRRGRQN-----LTVKDVTKEDQGEYSFVIDGKKTTCK----LKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSD-RVHIVIDKQSHMLLIEDMTKEDAG--------NYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIV----GRVETNCNLSVE-KIKIIRGLRDLTCTETQNVVFEVELSHS---------GIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYA----GENMTSGKLTVAGGA---ISKPLTDQTVAESQ-EAVFECEV--ANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTY----KVATSKTSAKLKVEAVKIK-KTLKNLTVTETQDAVFTVELTHPNVK-GVQWIKNG--VVLESNEKYAISVKG---TIYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVT----------ALENATVAFEVSVSHDTVPVKWFHKS---VEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETLHIT-----KTMKNIEVPETKTASFECEVSHFNVPSM-WLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVT-PIMITSMLKDINAEEKDTITFEVTVNYEGIS-------YKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVA----GKATSTATLYVEARHIEFRKHIKDIK---VLEKKRAMFECEV-SEPDITVQWMKDDQELQIT---DRIKIQKEKYVHRLLIPSTRMSDAGKYTVVA---GGNVS-TAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAH-WYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEY----TFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDT---VTSEGQPARFQCRVSGTDLK-VSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESI-------LHE-------------------RIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLSKINET----LELLSESPVYPTKFDSEKEGT-GPIFI---KEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGS-----------GTFIVNDPQREDSGLYICKAENMLG 3701          

HSP 21 Score: 100.523 bits (249), Expect = 9.132e-20
Identity = 193/937 (20.60%), Postives = 328/937 (35.01%), Query Frame = 1
Query: 6670 LADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIP------PKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPV--ILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDF--------------SIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGI---FRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNK----------ISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSK---VKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQ------------------------------ITVELLPKVSLPIS-----VTGDEGSSVT------IICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENE---INIYDLKPEDTGNYICIGERSGAEASTA----------STYLSIFTRPKFVYKPKLKNVVQET-RWKSFRCE------ATSHPKPDIKWMFNGRAIESKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGKVDSIVWLKNGVIVQNSSRLYI----NDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVK----SPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKN 9159
            L+  ER  +FDI      M+               A     T E+K+E+    P      P+I  R     +HRV       F  +V     +KP   + W      +      +Y   +   +L IL+  +D+SG Y     N  G+ S    L VT       D+              S+F E    +     +F+  +E   + S+      M  +   + ++  S +A++ +     K           E  S  +  K  +    L +   + V E     FS  C  +G P P + W R G+ +    R+   T       EI+  +  D G Y+    N             Q ++  +  + SPP+++SP+    V+  E V  P  V+   P      +P   + + T   ++  +S    I   ++ + S             +EI   L  +V+  + R  E                         +TW ++G  L +    + +Y+   +     N+L   D+G   C      G  +   Q                              +T +  PK   PIS     VTG + ++V+         K  G+P+PT  W KDG+++    G +++ + +     + I+     D+G Y C  + S    S++          +    + T+      P+ K VVQE    K+ R E      A S  K  +K   +   I  ++  +   S+    V  E       I K    S E     E+      + + +       +R +L   + G  D + W+ NGV + NS         +D  L I QA  +D GI  CI+    G  + Q  L +       P F   P + + N G+ ++  C   G P P I W+KN
Sbjct: 33255 LSRFERSARFDIFSRYESMK--------------AALKTQKTSERKYEVLSQQPFTLDHAPRITLRM---RSHRVPCGQNTRFILNV----QSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDVTG-----GDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHSASAEMKSAALEEKS---------LEEKSTTRKIKTTLAARILTKPRSMTVYEGESARFS--CDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEPR--VKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPKITQFLKAEAS-------------KEI-AKLTCVVESSVLRAKE-------------------------VTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQ--GGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEE-------ITKTSQASEEVRTHAEI------KAFSTQMSINEGQRLVLKANIAGATD-VKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKN 34097          

HSP 22 Score: 100.138 bits (248), Expect = 1.126e-19
Identity = 246/1207 (20.38%), Postives = 432/1207 (35.79%), Query Frame = 1
Query: 5968 LNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASN---AIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGT--RITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTI-PSVNKEGGIFKCIARN-EVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCV--ANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKI-LEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFN--SLKIEDEGSLTCIAKNVAGED---RLTFQITVELLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSE---NEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIES--KLNSNGRGSI---TLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIK-----------RTILMCKVEGKVDSIVWLKNG-VIVQNSSRLYIND---FNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQGEVHSQPIYLTVQIPGGWSAWQEWSKCSLSCGKGFISRKRLCNNPPPSEFGMTCIGEDFEKRD 9465
            L +Y     DE+ L C  + +  P + +FKDG      ++ P+K+A  K       +++ML L  A ++D G Y C+      +   D+ +  +++  P           V     +T   E     +++      W+  G  L       I  +G    + + N +    G     A N  S   L     V    R  K+   T  E     T    CE + Y    + WY + +++    +  P+ +       + + +++ +DA     TA +     +    + V  PP    + L  E+  V+E       C V   N     + W K  + IL       +     + L I +   ++   YTC+AK+     +   V     PP    +F      + V+      F+C         + WF     I      + +     ++L I   +  +   + C  R      ++ V + E +      L  IEV E    +  ++C     P   + W +  + I    RY   T+ R  IL I +A  ED G Y C   +  S+    V V  ++   I  P+ ++ +  GE+    C +     F + W        S           ++ L++        G Y  +  A   A +  +   L ++V  K  R  E +   V N      C++  EG       W RN   +     Y       ++        ++D+ +      N  GE+        +  E L  V     +   E  SVT  CKV  +   T+ W K+G+ +     NR  +  +   + + I D    D G YI     +G + S A   L I   P    +      V E     F C+  S  K ++KW  NGR I+   K      GSI    ++  R ++  EY C  ++R              K R R++  + P E I+             + + ++      + WL+N  V+VQ      +++     L I   K +D G Y+ IA +    A+    L + + P       ++  ++G+ L +    + YP     W+K  + +    + +  +  S RI+  +K   G Y  V  +  G+         + +PG           +L   + F     L    P ++ G   IG   E+RD
Sbjct: 12951 LQDYTGVEKDEVILQCEISKADAP-VKWFKDGK-----EIKPSKNAVIK----ADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRPLH--------SVEVMETETARFETE---ISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGE-----TATFDCELS-YEDIPVEWYLKGKKLEPSDKVVPRSE--GKVHTLTLRDVKLEDAGEVQLTAKD----FKTHANLFVKEPPVEFTKPL--EDQTVEEGATAVLECEVSRENAK---VKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVV-----PPHV--EFLRPLTDLQVREKEMARFECEL-SRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLTVLEEEAVFTK--NLANIEVSETD--TIKLVCEV-SKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPS--SRTDGKVKVHELAAEFISKPQ-NLEILEGEKAEFVCSI-SKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIEKLRIVVPLKDTRVKEQQEV-VFN------CEVNTEGAKA---KWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKV-NRLNVTLKWTKNGEEVP--FDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVT---AGQDKSVAE--LLIIEAPTEFVEHLEDQTVTEFDDAVFSCQL-SREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDR--------------KSRARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAK----LELAAAPKIKTADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVR--------NLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRD 14057          

HSP 23 Score: 92.4337 bits (228), Expect = 2.537e-17
Identity = 404/1998 (20.22%), Postives = 728/1998 (36.44%), Query Frame = 1
Query: 1729 KNASIEPFKDAELECNVFSTSSNVVLKWFK---SIPRYELKNTKRFRIEH--YKKSPNAFSSKLIILSASESDNGEY---VCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEG----DQQTVRCSATGVPQPKITWEFNGSPVTIDG----NIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSY---GENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVES---TLKKVIVCLVVESKPPAVISWLKNGKEI----EYSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPK-IEWYKNGQPLVEIPG--RVEIA--GQKNILKVYGKNEDETGSYECKATNEVSSDS--------RFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKII--QFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEI---DIYKS--------LPKDRFKISLDGS--TLTLFEVKHLDSGIYKCLAINIGESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGK--TLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFV-PPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXXXXXXX------XXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVD-----IMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRK-DGSRIDFRRVLLSDDGYH--LTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQAS--DAGRYSCV--AKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVM--------EYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHG--VPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQ--ITNIQPDDADTYACTATNGGGTIE---KKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKEGGIFKCIARNEVGSIMKVYKLEVI-MPALVRLDKIEVRE 7449
            ++  ++P   A   C++   + N+  KWFK    IP      T+  R  +  Y K  NA     I   A E +   Y   + + E E  + + +  +  +   +AS D  EIS  D                   W L G  L P+ P   I  +  +  + +  VK   +GE++ +A N+       I  + +++ K + LD A  +PL+     +++  R       +  + W  +  P  I      +II +     L IN  + + +G +         S+R         G R+K F++ ++      GE  T  C++  +    V W +  A  +     L       + + L +K ++++D    I   + Q  ++  + Q+++   A P        +  VE    TLK    C V +  P   + W K+G+EI    +YS +       L IK    +D+  Y C      GT K    + V+ + I +      ++   G+    + +   +P    +W+  G+PLT  P   I+       L +++      G  +  A N  +A      + VK  P I    +SD ++  K+  +  C ++     PK   W K  Q   EI G  R E+   G K+ + +     ++   Y  +A ++ +S          +F      V  K  +S +  +          N ++  F    +  + +S  +  +     IT   +  +D   +Q+R E  G+           AK++    +LE       +  D + V  D  I L C  S    P +KW    K I P+          +  LI+++A     G+Y+C    + G D+ +  + +    I +  P  ++               VM +    E   F+ EI   DI+ +        L     +I  +G   +L L   +   +G     A N+  S +      + P ++G       + +         C       P   WY    +L    +V   + GK  TL ++ V+  D    Q        +D K    N+FV  P +      E     +G+T  L C VS     +++W    T                 +L   +     I  YTC A +   S       +   PP +  L P     + +    R  C   +   A ++WFKDG  I+   + +I ++G    L+        I KCL+ ++     +  T        ++     F       +V+    + L C    +P  ++ W K D   I+  R  +  +G    L + +    DAG Y C   ++  +TD    V       +     +   +E   G      C +S    P + W +D   +      +Y +I + K+  ++   A+  D G Y  +  A      + +   + I  P        L +  +K   E+   C  N +      +F+  N   +FD       S K  +L       L +  A   D   Y  + +N  G +V         E  +R+  P + D   +E K   F  +   L  TL           W ++G  VP  +  S R+      +T+++    D GEY   A  + S   L+    +   P  +   L  +     +  V  SC+ +      + WYR  +EI   K    K+   +  S+ +  I + + DD   YAC   +         ++  + +I PP+ +  + G +         + F   +   N  K  + W + N  ++ GD    ++      L I + K  + G Y   AK+   +      L + + PK  T      + + V +G  +    P +  P     WF ++ P+S   +       + ++L     +K  G +K + +N+ G       L+VI +P  VR   +EV E
Sbjct: 12240 RDQHVKPKGTAIFACDIAKDTPNI--KWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPED-IAEYAVEIEGKRYPAKLTLGEREVELLKPIEDVTIYEKESASFD-AEISEADIPG---------------QWKLKGELLRPS-PTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNA-------ITTAILTV-KEIELDFA--VPLKDVTVPERRQARFECVLTREANVIW--SKGPDIIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAEVEGKKTSARLFVT-----GIRLK-FMSPLEDQTVKEGETATFVCELSHEKM-HVVWFKNDAKLHTSRTVLISSE--GKTHKLEMKEVTLDD----ISQIKAQVKELSSTAQLKVLE-ADPYFTVKLHDKTAVEKDEITLK----CEVSKDVP---VKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVC----DCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHFEIEL-SEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAA----NLKVKELPLIFITPLSDVKVFEKDEAKFECEVSR---EPKTFRWLKGTQ---EITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLKFLTPLKDVTAKEKESAVFTVELSHD-----NIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDD--TSQIRVEAMGM--------SSEAKLT----VLEGDPYFTGKLQDYTGVEKDEVI-LQCEISKADAP-VKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTC----DCGTDKTSGKLDIEDREIKLVRPLHSVE--------------VMET----ETARFETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLR----VKPRVIGLLRPLKDVTVTAGETATFDCELSYEDIP-VEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQL-----TAKDFKTH-ANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSR-ENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCN-----LNVVPPHVEFLRPLTDLQVREKEMARFECEL-SRENAKVKWFKDGAEIKKGKKYDIISKGAVRILV--------INKCLLDDEAEYSCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVC-EVSKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSS--RTDGKVKVHELAAEFIS----KPQNLEILEGEKAEFVCSISKESFP-VQWKRDDKTLES--GDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIEKLRIVVP--------LKDTRVKEQQEVVFNCEVN-TEGAKAKWFR--NEEAIFD-------SSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLK-DIETMEKKSVTFWCKVNRLNVTL----------KWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELL----IIEAPTEFVEHLEDQTVTEFDDAV-FSCQLS-REKANVKWYRNGREIKEGK----KYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGAD---------VVF---LAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAK----LELAAAPKIKT----ADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKTIDTTAEQTSFRILEAKKGDK--GRYKIVLQNKHGKAEGFINLKVIDVPGPVR--NLEVTE 14027          

HSP 24 Score: 90.1225 bits (222), Expect = 1.456e-16
Identity = 145/596 (24.33%), Postives = 230/596 (38.59%), Query Frame = 1
Query: 3304 QLTVYSITEEHAGTFTCTATND-------HAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPG-RVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMI--KIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSV--VFIDNTITLTCIASGNPTPKI--KWLFKKKLIPPNAVGYKM-VGENQETLIVERAASMHGGEYSCLAENEG--------------GKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFK---ISLDGSTLTLFEVKHLDSGI-----YKCLAINIGESLNFTLVVLISPT----ILGKHSSKSVININ--EETDLYITCWSEGNPAPRYLWYKDNSQLISGG---RVEITNGG-KTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRE---TPEFLKGSTTNLWCNVSGFPTPQIRW 4941
            Q T+  + E     F   A N+         A+  + K++    P I KE + D      E  +L+C I  G P P I+WY+ G+ L++    ++   G+ + L V  + +++ G Y C ATNEV       ++ +   P+      +  K Y   G  L L+    G P P   W     +L    N   I N+    + ++    R    G Y    +NV G+     DV I + P      DK    + I+  +  + + S  P       W+        N V  K    E  E  +V  A S+       L EN G                 + +S+V + +P+     P K     P I       SCV+   PPA     K      +   K + K   ++ +    T+F VK+L  G+      KC  +  GES    +   I+P     I   H  + + N+N   +++  + C   G+P P   WY+   ++I+ G   R++   GG   L+I  V   D +VYQ   TN+ G       + V VP  I+     E       L+G   ++    SG P P I W
Sbjct: 31416 QFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIRKE-MKDVTTKLGEAAQLSCQIV-GRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSEN-ITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKP------DKPTGPIVIEALLKNSAVISWKPPADDGGSWIT-------NYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGK-----PTITAVT-KDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLG-GESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITW 31988          

HSP 25 Score: 88.5817 bits (218), Expect = 3.504e-16
Identity = 272/1239 (21.95%), Postives = 465/1239 (37.53%), Query Frame = 1
Query: 5704 VGGTVVLECLVSGIPTPAIT-WLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVA--------DPPAKITWER--HGVPLSSGGSIRISPDGTR--ITVENVKQYDAGEYKCHAQNEV--SKISLVFNVEVFLKP----RFYKNQLYTKIEAVQNTTVQMSCECTG---YPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGT---IEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQS--LTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKV--LTIPSVNKEGGIFKCIAR-NEVGSIMKVYKLEVIMPALVRL-DKIEVRERSGTSFSVLC-TAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCT-GTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRP-FRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQP-VITWERNGITLSKVKNYYTTTD--SGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQ-ITVELLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSE-NEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFT-RPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLNS-----NGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGKVDSIV--WLKNGVIVQNSSRLYIND----FNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLP-GNISANLGEVLILPCAAEGYPIPTISWY-KNKKLIKYDFV--KSLIKNGSLRIIGVQKEHSG 9246
            VG + + ECLVS  P+ AIT W+KDG  I   P +R+   G  ++L II +Q SDAG Y+CV +    +      + +   P      +  E  +  G  L L C  N     ++ + KDG    +    P +       L+     + LT+  A  TD+G Y     NA   + +E S  V+         VE   +W     R       G A        D P  I W +    +P        I  DG    + ++N    D  EY    + +   +K++L       LKP      Y+ +  +    +    +    +  G    P PT        EI A+           G   + +  ++ D A      A N   T     K+ E+   +P K         +  V E  Q  F C +      +  ++W+K   P +I  +D +    +G+   L I + + D+ G YT E   + G+ +   +       KF +      E  TV+ G +  F C         ++WF  D  +  +     +IS+  K   L +  V  +  I +  A+  E+ S  ++  LE      V+L DK  V +      ++ C  ++  P   +KW +DG+ I    +Y  K D    IL+I  A  +D G Y C  GT+K ++ + +V+  +I   K+E P   + V VGE       +E + P     W   G    +S      +   +  LI+   +   +G     A N          L+V   P IF    ++         + +C++     +P    W +    ++    +    D      +  S   EDE      A++     +L  + I ++ L  +     VT  E  S     ++       V W K+ Q L        +   + + I   DL  +DT        R  A   ++   L++    P F  K +    V++      +CE +    P +KW  +G+ I+   N+       +  + L+     + G+Y C      G+ + S  L++  +  +++ +     E ++      + E   D I   W   G  +  +    I +     +L+++  +   TG     A+N    A    HL VK   +  L P  +++   GE     C      IP + WY K KKL   D V  +S  K  +L +  V+ E +G
Sbjct: 12059 VGSSAIFECLVS--PSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLYLSCELNK--ERDVVWRKDGK---IVVEKPGRIVPGVIGLM-----RALTINDADDTDAGTYTVTVENA---NNLECSSCVKV--------VEVIRDWLVKPIRDQHVKPKGTAIFACDIAKDTP-NIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRYPAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWKLKGELLRPSPTC-------EIKAEG----------GKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEIELDFAVPLK---------DVTVPERRQARFECVLTR----EANVIWSK--GPDIIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAE---VEGKKTSARLFVTGIRLKFMSPL----EDQTVKEGETATFVCELSHEKM-HVVWFKNDAKL--HTSRTVLISSEGKTHKLEMKEVTLD-DISQIKAQVKELSSTAQLKVLEADPYFTVKLHDKTAVEK---DEITLKCEVSKDVP---VKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDK-TKANVTVEARLI---KVEKPLYGVEVFVGETAHFE--IELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAA----NLKVKELPLIFITPLSDVKVFEKDEAKFECEVSR---EPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLKFLTPLK---DVTAKEKESAVFTVEL-SHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQI-----RVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDEV-ILQCEISKADAP-VKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTC----DCGTDKTSGKLDIEDR-EIKLVRPLHSVEVMETETARFETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSA----HLRVKPRVIGLLRPLKDVTVTAGETATFDCELSYEDIP-VEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAG 13190          

HSP 26 Score: 85.8853 bits (211), Expect = 2.458e-15
Identity = 218/1014 (21.50%), Postives = 385/1014 (37.97%), Query Frame = 1
Query: 1729 KNASIEPFKDAELECNVFSTSSNVVLKWF-KSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGE--LICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSAT----GVPQPKITWEFNGSPV--TIDGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNL-DIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQD---NSLIIKGLSMEDQSAYICDAQNQHGKVQ---ESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNR------IMAKDNTLVIKTVKAEDEAIYTCIA-KNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITE--EHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEG------------ISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRV------EIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKA----SDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGE-NQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAP---YIDMKT----------------PNKNITYNPIIVGGNI--TFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAIN-IGESL-NFTLVVLISPT 4557
            K   +   ++A +   V  +   V +KWF KS+   E+K + + R+   +K       KL++ + S SD GEY  V     G  E    +   TL       K I   +  + +  C       P+  W  NG E++ ++ +  IV   +  Q+ I N   +DS E   +C      G D+V   L+   +  I+   + K+I  E ++ T+    T    G+      W  NG  +  T    +   +   +L+I  +       +  VA  +  ++        I F   IKD    I     +     C+V  +P   V+W++      +  + + DR  I ++   + L+I    M D   Y   A       +   E   +RI  I          K+V V    + V+   V E    A   W K+G EI +  +      +  + + + I   +  D   YT +A +N+     +   ++    P ++ + +  +  + G          G P+PKI W K  + L+   G +     DG + T+  I    E A  +TC A ND+        +SV+ P  +S +             + D      +     C ++  +   K+ WY   + +   P R       E   Q  I + Y ++E   G+Y   A+N V   S    ++ L AP++       + I++  KE     L+ + +G  +   + S  +  L+L      ++ SP+       T+  SE +G                        P  I+    + + + +  TL+    G P PKI+W F   L+ P+A  YK V + +  +LI+        GEY+C+A N+ GK   ++ + + +    + D +T                P+      PI     +   F   +   P   + WFK    +  S+            T  + + +  DSG+Y C A N +GES     L+VL+  T
Sbjct: 2800 KPKDVTALENATVAFEVSVSHDTVPVKWFHKSV---EIKPSDKHRLVSERKV-----HKLMLQNISPSDAGEYTAVV----GQLECKAKLFVETLHITKT-MKNIEVPETKTASFECEVSHFNVPSM-WLKNGVEIEMSE-KFKIVVQGKLHQLIIMNTSTEDSAEYTFVC------GNDQVSATLT---VTPIMITSMLKDINAE-EKDTITFEVTVNYEGI---SYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKD----IKVLEKKRAMFECEV-SEPDITVQWMKD-----DQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSI---------KKEVQVIEKQRAVVEFEVNEDDVDA--HWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLY---VNAPEPPQVLQELQP-VTVQSGKPARFCAVISGRPQPKISWYKEEQLLST--GFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDL--KVSWYSKDKKIK--PSRFFRMTQFEDTYQLEIAEAYPEDE---GTYTFVASNAVGQVSSTANLS-LEAPESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLSKINETLEL------LSESPV-----YPTKFDSEKEGT----------------------GPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSA-DYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLVLLEDT 3716          

HSP 27 Score: 84.7297 bits (208), Expect = 5.349e-15
Identity = 148/625 (23.68%), Postives = 232/625 (37.12%), Query Frame = 1
Query: 7624 TGTNKISQDSKSVDVVIIS--PPKIESPKKSIMVRVGEQVLLPCIVEGTRPF-RIHWYTPGNNQISSTILGEYQFLSE---QGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIF--RPTETETTGVLNTVLQMQCKILEGIPQPVITW--------ERNGITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGE-------------DRLTFQITVELLPKVSLPIS---VTGDEGSSVTIICKVEGKPKPTVTWKKDGQS----------LQNVLGNRFRFNSENEINIYDLKPEDTGNYICIG---ERSGA------EASTASTYLSIFTRPKFVYKPKLKNVVQETR------WKSFRCEATSHPKPDIKWMFNGRAIESKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGKVDSIV-WLKNGV-IVQNSSRLYINDF-----NLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLP-----GNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNGSLRII----GVQKEHSGVYFCVASSNQG 9279
            TG ++  + + S+   + S   P I    K +  ++GE   L C + G RP   I WY  G   I S    +Y+  S+     L +    ++  GVY C+A N+ G  E    L +   P+     P + +  G + + L++    + G P P +TW            IT+   ++Y     + L + N  +    G       NV G              D+ T  I +E L K S  IS      D GS +T     + + K    W+    +          L    G  FR +++N   I D  P +  + + I    E+ GA       A T  + +  +  P      K++N   E R      W S   E        +K +  G   E ++     G  +  S  SE       I       ++     E +    VR YQS+          L+CKV G    IV W + G  I+ +  +  I +F      LII      D  +YQ  A+N  G   G   L V+ P    L       G + A  GEV+ +     G P P I+W K + LI  +    +I   S   +    GV+++ +G Y   A +  G
Sbjct: 31438 TGLSRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVG-RPLPDIKWYRFGKELIQSR---KYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYI-GRPVPAMTWFHGQKLLQNSENITIENTEHY-----THLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISD--PLEVSSVVIIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEP------ITPKSDVPIQAPHFKEELRNLNVR-YQSN--------ATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFG 32035          

HSP 28 Score: 81.2629 bits (199), Expect = 5.943e-14
Identity = 192/985 (19.49%), Postives = 355/985 (36.04%), Query Frame = 1
Query: 2107 SWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDE------VRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIINETI--GTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIA-FTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRIM---AKDNT--LVIKTVKAEDEAIYTCIAKNQVGTAKFDIEL----------------------------------------DVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDS----KMIKIYT-----KEGEKLTLNCKIDGFPTPTKKWSWKS-SILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIIL----ESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNI---TYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAINIGESLNFTLVVLISPTILGK----HSSKSVININEETDLYITCWSEGNPAPRYLW----YKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNV 4824
            S F    E++ +     + + + E++  +S+ +   S E+   A     ++E      ++  L+   L K  S+ +      EG+     C   G P P +TW   G  ++      +  T    T +I+ ++ + +G +  V  NS G     F L I      +  VT+                   PPRVK           P A+     +        K +S  +      + + QH  V           A PKI  F +++     + L  V+   V+ +K    ++W K+GK+++ +       + D T  L I  +   D+  Y C    + GT+K +++                                          + +KP+I+   +    + D  V     +  G+P+P   W K G+ +T     ++     G  L ++      +G +TCT  N   +V    K+++KA        I D E       + + I        + E  +      EI  ++  A  +  L +  +      S E K +   S +       I    +AS+       IK ++      EG++L L   I G      KW      + + +   +G++ S      L I Q     +GI TC      G  K  YD+ +     ++P  I       +     +  TC  SG P+P+I+W      I  ++        N  +L +  A+    G+Y+  A+N  G+    + + V  P ++   P++ +   T     + G+ +   V  S    E  +         S+ + +F      S  ++ E   ++      + I+    L  +   ++   I G      +  S I+I+E   L + C   G P P   W     K +SQ      +E T+   TL+I  V++ D  +Y   + NE G D    ++++
Sbjct: 33424 SSFKKTSEMEASSSVREVKSQMTETRESLSSYEHSASAEMKSAALEEKSLEEKSTTRKIKTTLAARILTKPRSMTV-----YEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTS-------------------PPRVK---SPEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTE-KVQHLPVS----------APPKITQFLKAEASKEIAKLTCVVESSVLRAKE---VTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDS-VAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKA--------IKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEI--KMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAG--ATDVKWVLNGVELTNSEEYRYGVSGS---DQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVL-PLVE--EPSREVVLRTSGDTSLQGSFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQE-SFVEMSSSSFMGISNMTQLESSTSKMLKAGIRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 34347          

HSP 29 Score: 78.5666 bits (192), Expect = 3.740e-13
Identity = 101/452 (22.35%), Postives = 191/452 (42.26%), Query Frame = 1
Query: 7963 PKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKN---YYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDR----LTFQITVELLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEIN---IYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFV-YKPKLKNV-VQETRWKSFRCEATSHPKPDIKWMFNGRAIESK-----LNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPR-VRVYQSDDPSESIKRTILMCKVEGKVDSI--VWLKNGVIVQNSSRLYI----NDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIK-YDFVKSLIKNGSLRIIGVQKEHS 9243
            PKIF   +++T G   +    + +++ G P P   W +NG+ + +      Y+   +    +   +  ED  S+   A N+AGE      L  Q    +     L   V  ++ +  T  C+   +P   V W KDG  +    G+++R +S+ +++   I  +   D  +Y C+      E     T   +      V +  +L+++ V E+      C   S    + KW  N   ++S       +  GR ++T++ V  E+ GEY  +   +  + +         KPR + + Q     +  +  I+  +V+  ++S+  VW+K+G  VQ S R++I        L+I     +D G Y            G+V   V S  V T L  +++   G   +L C      + ++ WY N + IK  D V++++K    R++ + + H+
Sbjct: 2078 PKIFERIQSQTVG-QGSDAHFRVRVV-GKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECET-SEPFVKVKWYKDGMEVHE--GDKYRMHSDRKVHFLSILTIDTSDAEDYSCVL----VEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELEC-IVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKM------KPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVS--VYSVDVITPL-KDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLV-INRTHA 2509          

HSP 30 Score: 78.5666 bits (192), Expect = 3.867e-13
Identity = 104/381 (27.30%), Postives = 162/381 (42.52%), Query Frame = 1
Query: 7609 GRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQ---VLLPCIVEG-TRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVR---KDHSGVYRCVANNDAG----YQEIRI--TLEVL------VQPKIFRPTETE---------TTGVLNTVLQMQCKILEGI-----PQPVITWERNGITL---SKVKNYYTTTDSGLF--IFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVS----------LPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSEN----EINIYDLKPEDTGNYICIGERSGAEASTASTYLSI----FTRPKFVYKPKLKNVVQETRWKSFR 8583
             R +C G  + SQ   SV  V ++  +I      IM  VGE+   V   C +E   +  ++ WY  G  Q+ ++   +Y+   E G+ I  V+   K   G YRC   ND G    Y E+ +    EV          KI R T+T          T  + N    +   +  G+     P+P +TW ++G  +      K Y   +D GL+    NS+  +D+   T +A+N  GED    ++TV L P  +          L  +    EG SV    +V G P PT+ W+KDGQ L   LG       E      ++I D  PEDTG Y      + A +++   +L +    + + +F  K + +  VQ+   K+ R
Sbjct: 32468 ARISCGGAIR-SQKGVSVAKVKVASIEIGPVSGQIMHAVGEEGGHVKYVCKIENYDQSTQVTWYF-GVRQLENS--EKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLS--LGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNT-AGSTSCQAHLQVERLRYKKQEFKSKEEHERHVQKQIDKTLR 32841          

HSP 31 Score: 78.1814 bits (191), Expect = 5.776e-13
Identity = 53/182 (29.12%), Postives = 82/182 (45.05%), Query Frame = 1
Query: 5707 GGTVVLECLVSGIPTPAITWLKDG--IPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQ----MEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDG----NSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKR--TDSGLYQCNASNAIG 6216
            G T   E  +SG P P ++W +DG  I  + LP  +        +L I A+  +++GRYS  A N  GQ     E+ +      P  + R   L    ++ G ++RL     G P P + F++DG    +SLD                 +SQE  + +L  A+    DSG Y  NA+N++G
Sbjct:   20 GSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQR---LQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLD---------------FQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVG 183          

HSP 32 Score: 76.6406 bits (187), Expect = 1.378e-12
Identity = 139/605 (22.98%), Postives = 234/605 (38.68%), Query Frame = 1
Query: 3715 KMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKI---IQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAAS--MHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNK-NITYNPIIVGGNITFSCVMNSTPPAEI--KWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHL----DSGIYKCLA----INIGESLNFTLVVLI-----SPTILGKHSSKSVININEETDLYITCW----SEGNPAPR--YLWYKDNSQ--LISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKG------STTNLWCNVSGFPTPQIRWTYM--ETIXXXXXXXXX------XQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKI---VSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNN--LRVNITNRGTQLHLLNAQE-SDIGIYKCLVSNKLGLDKQAWTVDIMIPP 5382
            +M  + TK GE   L+C+I G P P  KW      L +Q   + ++ S    + L +     E +G+YTC  TN  G  + S  +++  +P+        +K    + +T+ L  +  G P P + W   +KL+  N+    +      T +V +      H G+Y         K Q +++       +D++  +K +    PI++   +  S V++  PPA+    W  N + + K   K+  +  L  S +++   + +    ++G Y  ++      I + L  + VV+I      P   GK +  +V       D  +  W    S+G    R  YL  ++  Q   IS    EI        +K +    +  ++    N  GE + +       P S   I      E L+       S   L C V+G P P ++W     E I   L            QL   +V     T Y   ATN+ GS        +  P KI    +L+       L+   + +       P   I W K  +LI NN   +V +T   T L   N  E  D G Y     N+ G+D++   +D+   P
Sbjct: 31465 EMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKEL-IQSRKYKMS-SDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLL-QNSENITIENTEHYTHLVMKNVQRKTHAGKY---------KVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYV-VEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAVTK-----DSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRE--TVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVP 32049          

HSP 33 Score: 75.485 bits (184), Expect = 3.919e-12
Identity = 176/919 (19.15%), Postives = 325/919 (35.36%), Query Frame = 1
Query: 5161 RLSCNSDAAPVATIEWFKDGELIRNNLR--VNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLV--SGIPTPAITWLKDGIPINRLPSYRYRIIGN-SKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDR-----------NRILNEYIIKVGDELRLPCP---------------------------ANGSPNPNIAFFKDGNSLDM---FDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEP-KVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGS---IRISPDGTRITV-ENVKQYDAGEY-KCHAQNEVSKISLVFN-VEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVII----PPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSP----------------TPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNK-EGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF-----RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIIS 7680
            R SC++D  PV T+ W + G+++  + R  V  T   +   + + Q SD G Y  +V N  G  +  +T+ I          KA   + A+     +       P+P++   K    +   + + S +  H    S  ET     +                +V + P   P     +           L C+V  S +    +TW KDG  +     +++    + + +L+I  +  SD G Y C      G  +  +     A  SI             ++   E  +    E + P P                           A G P P   + KDG ++     + LS +K   +            L ++    +DSGLY C   N+ G       + ++   + +   V   K +  T Q +++      V +  ++       + +S   S   + +  + +++ + E VK+  A    K     E++K S     V    + + +  Q+   I   Q   ++ +          + W     E L + E Y ++ +   +  + I      D     C +    G ++ ++++++       P  + +   P +  + E   + F C +       P I W K N PI I          N  SL I N    +SG+YT +AKN  GQ S T  L V    + P+   + R +    L  S + Q     +                    + +             +FV  +++  + I ++ + E    K +     G   K+  L    P+ + +D+       G   +V C   G P P + W+  G+ I      R+  +       L I D +++D G YT +  N+   DS +V++ I S
Sbjct: 33506 RFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQ---------KARVTEKAVTSPPRV-----KSPEPRV---KSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTE----------------KVQHLPVSAPPKITQFLKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFF------------LEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITPQKKAV------VQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQM--SINEGQRLVLKANIAGAT----DVKWVLNGVE-LTNSEEY-RYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQ---PRSQNINEGQNVLFTCEISG--EPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSLQGSFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMTQLESSTSKMLKAGIRGIPPKIEAL----PSDISIDE-------GKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHIRS 34349          

HSP 34 Score: 73.9442 bits (180), Expect = 1.087e-11
Identity = 116/522 (22.22%), Postives = 218/522 (41.76%), Query Frame = 1
Query: 7873 RKDHSGVYRCVANNDAG-YQEIRITLEVLVQPKIFRPTETETTGVLN------TVLQMQCKILE-GIPQPVITWERNGITLSKVKNYYTTTDSGL--FIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISVTGDEGSSVT--IICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNS-ENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNV-VQETRWKSFRCEATSHPKPDIKWMFNGRAIES----KLNSNGR-GSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKV-EGKVDSIVWLKNGV----IVQNSSRLYIND--FNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSP--PVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNG---SLRIIGVQKEHSGVYFCVASSNQGEVHSQPIYLTVQIPGGWSAWQE 9345
            RK H  + + ++ +DAG Y  +   LE   + K+F  T   T  + N           +C++    +P     W +NG+ +   + +       L   I  +   ED    T     V G D+++  +TV  +   S+   +  +E  ++T  +    EG    +  W K+G  +++    + R     + +NI ++   D  +Y  +   +G   STA+ Y+         ++  +K++ V E +   F CE  S P   ++WM + + ++     K+        + + S R  +AG+Y  +A    G+V  + +       R+R  + +      +R ++  +V E  VD+  W K+G+     VQ   +  +      + I++ +  D G Y  +A    G  +  V L V +P  P        ++   G+         G P P ISWYK ++L+   F    + +G   +L +I    E + VY C A ++ G V +    L+V++P   S  QE
Sbjct: 2846 RKVHKLMLQNISPSDAGEYTAVVGQLEC--KAKLFVETLHITKTMKNIEVPETKTASFECEVSHFNVPS---MWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTF----VCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGI---SYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFV---AGKATSTATLYVEAR---HIEFRKHIKDIKVLEKKRAMFECEV-SEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAG---GNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAH-WYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVA----GRNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYG-VATTSASLSVEVPEVVSPDQE 3339          

HSP 35 Score: 72.7886 bits (177), Expect = 2.268e-11
Identity = 147/730 (20.14%), Postives = 263/730 (36.03%), Query Frame = 1
Query: 2947 PPAVISWLKNGKEIEYSNRIMAKDNT----LVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKP-------IIIGDFKT----FIDAKD----------------------------------GDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPD---GSQLTVYSIT-EEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVEL--NCIITSGNPSPKIEWYKNG-------------QPLVEIPGRVEIAGQKNILKVYGKNED-ETGSYECKATNEVSSDSRFFQITIL-------------------VAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPT--PKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGS-TLTLFEVKHLDSGIYKCLAINIGESLNFTLVVLISPTILGKHSSKSV-------ININEETDLYITCWSEGNPAPRYLWYKDNSQLISGG----RVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFV 4830
            P   ++W +   +IE S        +    L+I+   AED   +TC A N+ GT      L VQ           +   F T    F++++D                                  G  +V  CQ  G+PKP + W+K G PLT   G R  +S +   G    V S+T  + AG +T    N H            A   + +E  +DYE+  K   E+     +T+    PK+     G             Q L+    R ++A    +++ Y ++++    S+E +   E+  + R  + T+                          DS++      EG  +T +CK+ G+P P   W +K          + +      +  L I  +  E +GIYT   +N+ G+A  S                   ++++    L     G PT  P ++ + + + + P +V    +  +   +   R +                +  ++ +  ++ P   +K     +++   + G    F   +   P  E  WF +   I       +  I  DG+ +L +      DSG +  +A N     + ++++ +      +H  K +       +NI E + L +   + GNP P  +W K++  ++       R+E T G   L I      D + Y     N+AG D     VNV V
Sbjct:  970 PSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTT--GYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHG--------ETSASASLLEE--ADYELLMKSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALI----RKKMAKDTVVVRTYVEDQEFHISSFEERLIKEI--EYRIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAW-YKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICS-----------------GKLYVEPAAPL-----GAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKP----VSFK-CLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDY-THKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAV---EHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEV 1649          

HSP 36 Score: 72.7886 bits (177), Expect = 2.507e-11
Identity = 56/173 (32.37%), Postives = 73/173 (42.20%), Query Frame = 1
Query: 5425 LGGNLYLFCVSEGRPKPKIEWRKDGSRI-----DFRRVLLSDDG-YHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGP-----TLDPGGKRYYK-VERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIG-NSKQLEIIAMQASDAGRYSCVAKNTFG 5904
            +G N+         P+P + W K G +I     D +    SD G Y LT+NS    D   Y  +A N +G+      + VT  P     TL P  KR     E   G +V  E  VSGIP P + W KDG P++  P+      G +   L I      D G Y   A NT G
Sbjct: 32630 VGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAG 32802          

HSP 37 Score: 72.4034 bits (176), Expect = 2.964e-11
Identity = 142/666 (21.32%), Postives = 237/666 (35.59%), Query Frame = 1
Query: 4375 WFKNEIDIYKSLPKDRFKISLDGSTLTLF--EVKHLDSGIYKCLAINIGESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGK--TLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEF-------------LKGSTTNLWCNVSGF--------------PTPQIRWTYMETIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRI----DFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTY----------------------GPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGN---SKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFK---DGNSLDMFDLSPN-----KDASYKKRLLVSQERQMLTLYSAK 6168
            W+K+ I+I   + ++R K  ++     +F  E +  D+G Y  +A     S+   +     P +L +      + +             G P P+  WYK+   L +G + +  + G+  TLL+ +    D +VY C   N+ G    +  ++V VP  ++    +E P +              +G      C VSG               P+   R T  E         +  QL            YT +A+N  G      +  L  P  I+         I ++ E+ +   S +   A  E     EL        ++     L LL    S+  +Y      K   +K+        P  IK  S A    +++G    L     G PKPKI+W  +G  +    D++ V   DD + L +  T   D G Y C+A N +G+T  S  +++                        GP      K    +    G   + E  V G P P +TW K+   +    S  Y II N   S    +   Q  D+G Y C A+N  G+     ++ +               +++  D    PC A  +P     F +    G +++  D         KD   K  L+  + +Q+   + AK
Sbjct: 3179 WYKDGIEINFQV-QERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQP---VTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVS--PDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFE---------DTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILH------ERIEQEIEMEMKEFSSSFLSAEEEGLHSAEL-------QLSKINETLELL----SESPVY----PTKFDSEKEG-----TGPIFIKEVSNA---DISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDD-HSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQL--CTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLV---------------LLEDTDMTDTPCKAKSTPEAPEDFPQTPLKGPAVEALDSEQEIATFVKDTILKAALITEENQQLSYEHIAK 3782          

HSP 38 Score: 69.707 bits (169), Expect = 1.715e-10
Identity = 101/478 (21.13%), Postives = 169/478 (35.36%), Query Frame = 1
Query: 5707 GGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRII---GNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGA------PPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKK-RLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVR---TPPEFDTSNVEPKVNWFTNQTRS-----------------------------------------------LECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGTRITVENVKQY--DAGEYKCHAQNEV----SKISLVFNVEVFL---------------------------------------KPRFYKNQLYTK-IEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISV 6822
            G T   +  V G P P   W  DG  I  +  Y ++++     ++ L I+    SD+G ++ VA+N  G+  I + +T+ A      P  +++ + +N   IK G  L +   A G+PNP+I + K+ +      + P+K   Y K R+  ++    L + S    DS  Y   A N  G D     V V      PE +   + P+  +   +  +                                                EC L  + DP   + W   G PL +   +R+  +    +++    Y  D+G   C A N+     +  +L+   E  L                                       KP      LY + +  ++  T +  C  TGYP P + WY   Q I   K    ++D   G   + I + +  D      TA N  G IE K ++ +
Sbjct: 1471 GQTARFDLKVVGRPMPETFWFHDGQQI--VNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVN---IKEGSRLEMKVRATGNPNPDIVWLKNSDI-----IVPHK---YPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIV---LYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYD---GIHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEI 1929          

HSP 39 Score: 68.9366 bits (167), Expect = 3.054e-10
Identity = 169/841 (20.10%), Postives = 281/841 (33.41%), Query Frame = 1
Query: 1447 GHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNV-TLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKNASIEPFKDAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLI-------------ILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASV--DEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEV---------------------------------------RIKLSYISLPKILSLDLAKEIPLEGDQQ------------------------TVRCSATGVPQPKITWEFNGSPVTIDGNIIINETI-GT--LDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNI------DGSYGENITIR----------------------------------CQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNS---LIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIA---APKIAFT-------QSKQVVVESTLKKVIVCLVV---ESKPPAVISWLKNGKEIEYSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVK-----APPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQP 3540
            G   +    VQS+    + WY N  ++   ++  + +  TS V TLEI   +    G Y A            KG   D   + V       +  +       +D E+  +VF                 EL  T+ + +  +KK+    +S  +             + S   S + E    A  E  + E     K  T  AA +    + ++  + +S   SC     P PT +W   G+ L  T  R  +     +S  +IS+V+  D G      +NS G  E                                        R+K    S PK +S    K  P E  Q                         T    ++ +   ++TW  +G  +  +G+   + +  GT  L IN + ++ +G++VC  +   G+S+ +          I + V+ I      D    E+   R                                   +  G+P P   W +         I  G +Y +++D     L I      D   Y C  +N  G V  S ++ I  I    A K++         Q K VV E   +K +    +   E+K    ++  +   ++  S  +     T + K++   +E   T  A  +V T               I  F T +   +G  +VL+    G     ++W   G  LT     R  +S     LT+   +    G  TC +      V  ++ +++      AP  IS+       I   +NV   C I SG PSP+IEW+KN  P
Sbjct: 33315 GQNTRFILNVQSKPTAEVKWYHNGVEL--QESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCT-------NYKGEASDYATLDVTGGDYTTYASQR------RDEEVPRSVFP----------------ELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHSASAEMKSAALEEKSLEEKSTTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLS-TSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPKITQFLKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKA-----ITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSI-VHEEITKTSQASEEVRTHAE------------IKAFSTQMSINEGQRLVLKANIAG--ATDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQP--RSQNINEGQNVLFTCEI-SGEPSPEIEWFKNNLP 34100          

HSP 40 Score: 68.9366 bits (167), Expect = 3.671e-10
Identity = 152/684 (22.22%), Postives = 257/684 (37.57%), Query Frame = 1
Query: 2995 SNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAK-FDIELDVQTK------PIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHA--GTFTCTATNDHAAVVKEFKVSVKAPPQISK-EGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKN---EDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKK-WSWKSSILDLQRNPFGITNSPIDK---NDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQ-FNDKSVVFIDN-----------TITL----TCIASGNPT-----PKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYS--CLAENEGGKDQKNSI---------VTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDG-STLTLFEVKHLDSGIYKCLAINIGESLNFT--LVVLISPTILGKHSSKSVININEETDLY-----ITCWSEGNPAPRYLWYKDNSQLISGG--RVEITNGGKTLLIKK-VRRSDDSVYQCHVTNEAGEDKKNFDVNVF-VPPSINGISMRE 4863
            SN+   KD    I  +    E  +   A+N+ G ++     + ++TK      P I  + K  +  K G+   L CQ  G P P I+W + G+ L      +  +S DG   T+  +TEE    G +TC ATN+   V    K+ ++A PQ      + +   G+  +     ++  G P P + W+ +GQ L++    + I   ++   +  KN   +   G Y+ + +N   +      + I   P      ++       E L  N  +  +  P     SW             ITN  ++K    +    Q+ S    + TC   N+  +A   + V    +  I       SVV I +           TIT     +C+ +  P       KI+  + +K          +  E     +      + G EY      EN GG+ + + I         V + AP+   +  N N+ Y       N T  C +   P   +KW++   +I     K R +    G   L +  V   D+ +Y+  A N G S++ T  L V +   I   H  K++  +     L      I     G P P   W K    + + G  +V +T    +L+    V R D   Y     N  G D+K  +++V  VP    G+ + +
Sbjct: 31407 SNKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIRKEMKD-VTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQ--SRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWF-HGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVI------EALLKNSAVISWKPPADDGGSW-------------ITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQ-----SNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKI---HLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSD 32059          

HSP 41 Score: 68.5514 bits (166), Expect = 4.267e-10
Identity = 56/231 (24.24%), Postives = 95/231 (41.13%), Query Frame = 1
Query: 5545 HLTVNSTMETDAGRYQCIAENTHG-----QTDISFDVQVTYGPTLDPGGKRYYK-VERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNE-YIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIG 6216
              T+   +E     ++  AEN  G     +T +S   ++T G    PG ++  K V   +G    L C + G P P I W + G  + +   Y+    G +  L ++  +  D G Y+C+A N  G++E    + + A P       L E Y   VG  LRL     G P P + +F     L   +    ++  +   L++   +        ++T +G Y+   SN  G
Sbjct: 31416 QFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEA--PGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQ--------RKTHAGKYKVQLSNVFG 31636          

HSP 42 Score: 67.781 bits (164), Expect = 6.815e-10
Identity = 104/481 (21.62%), Postives = 184/481 (38.25%), Query Frame = 1
Query: 1903 LIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEK------EISFIDNDSITAS-------CRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQES-QIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLK-------------KVIVC---------LVVESKPPAVISWLKNGKEIEYSNRIMAKDN-----TLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPK 3222
            L+++ A   D   Y C A+++ GV+     +        S D++       I     D++T+        CR   T     SW+   +++ P+  R   +   +++ Q++I+   P+D G     A N+ G       LS  +   IL   + +EI +E                    EF+ S ++ +   + +     L +++I + ++     + + S     K  +   G GP     V+N D S G+  T+   V G P P+++W     G    P A     F   D+SLII    +ED+  Y C A N +GK   S  ++I+         T+++  V +S  K             K I C           V  +P   ++W K  K++  S       N     T ++   + ED  +Y C A+N +G +    EL               +  +D D+    C+ K  P+
Sbjct: 3296 LLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDL-KVSWYSKDKKIKPS--RFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMK------------------EFSSSFLSAEEEGLHS---AELQLSKINETLE-----LLSESPVYPTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWF--FNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGH-KDTETESAVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAEL--------------LVLLEDTDMTDTPCKAKSTPE 3730          

HSP 43 Score: 66.6254 bits (161), Expect = 1.812e-9
Identity = 57/200 (28.50%), Postives = 91/200 (45.50%), Query Frame = 1
Query: 2566 GPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQ----DNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVI-VCLVVESKPPAVISWLKNGKEIE---YSNRIMAKDNTLVI--KTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKP 3135
             P  K+ + N++  Y  N T+ C+V G P P VKW R    G  I IA G +Y I +     + LII  ++ +D + Y   A NQ G V  +  + +   A   +  T      V +   +V+ + +    KP  VI+W K    I+   +   I+ +  T ++    V+ +D   Y   AKN+ G  +  +ELDV   P
Sbjct: 31854 APHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYR---QGKEI-IADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVP 32049          

HSP 44 Score: 65.4698 bits (158), Expect = 3.173e-9
Identity = 279/1501 (18.59%), Postives = 533/1501 (35.51%), Query Frame = 1
Query: 4990 QLHFMNVDKSHITRYTCI---ATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNN---LRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRI-----DFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLE-------CLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQM-----EIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPN------PNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNAS-NAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGT--RITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTA----TNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVI--LWTKENSPILIGDTDYYLTFNNGQSLTILN----PKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKEGG---IFKCIARNEVGS-IMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPC-IVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNT-VLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGL--FIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEIN---IYDLKPEDTGNYICIGERSGAEASTASTYLSIFTR--PKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAI----ESKLNSNGR-GSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQ--SDDPSESIKRTILMCKVEGKVDSIVWLKNGVIVQNSSRLYINDFN----LIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNGSLRIIGVQKEH---SGVYFCVASSNQ 9276
            +LH ++V  S    YTC+      E  S  KL   V   P + V    +++  ++K   L LSC  +      + W KDG+++      +   +      L + +A ++D G Y   V N   L+  +    + +            H    G    +F     +  P I+W K    I     D   +L   +  +L + + M  D   Y    E       ++              G+R  ++ + +    + E         +S    P   W   G  +   P+   +  G  + L +  ++   AG     A N          EI +D  +           L +  +    + R  C      N      P+I       S D FD+     A  KK +LV  + Q          D G+Y            +    +R++     +   V+        +T +  C L   +     + W ++   L +  ++ IS +G   ++ ++ V   D  + K     +V ++S    ++V     ++  +L+ K  AV+   + + CE +   P  + W++  +EI+   +   K D LR   +++I      D   Y C      T    T+E +  I V  P   ++  +G   H              +   +++P +   W  +  P L    D  +  +  + + IL+      + E       AK+ A        L   +P    +D  +F +           F+C     P  +  W      I+  D    +       + I S   E     +F+   ++  G  I++  +L+ + P    L  +  +E+    F+V  + +      +KW ++ + +        + + +T  +   D   +DT +        +   S++   V+   P      +       ++V+L C I +   P  + W+  G     S          ++ LI+ +  K   G Y C    D    ++ I    +   K+ RP  +    V+ T   + + +I E        W+  G  L +  +     +  +   + ++ +++  G +   A NV     L  +  V  L +    ++VT   G + T  C++  +  P V W   G+ L+    ++    SE +++   + D+K ED G            A    T+ ++F +  P    KP     V+E       CE  S     +KW  NG  I    + ++ ++GR   + +     E+   Y C AK+     + S  L V+  P V   +  +D      +     C++  +   + W K+G  ++   +  I        L+IN+    D   Y C    +     G + +L +   VFT    NI  +  + + L C     P   + WYK  + I       ++  G  RI+ +Q  H   +G Y C   S++
Sbjct: 12101 KLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLV--VEELPVRFVKT-LEEEVTVVKGQPLYLSCELNKE--RDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIRDQHVKPKG--TAIFACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRYPAKLTL-------------GEREVELLKPIEDVTIYEKESASFDAEISEADIPG-QWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEIELDFAVP----------LKDVTVPERRQARFECVLTREANVIWSKGPDII-----KSSDKFDII----ADGKKHILVINDSQF--------DDEGVYTAEVEGKKTSARLFVTGIRLKFMSPLEDQTVK------EGETATFVCEL---SHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKA----QVKELSSTAQLKVLEADPYFTVKLHDKT-AVEKDEITLKCEVSKDVP--VKWFKDGEEIVPSPKYSIKADGLR--RILKIKKADLKDKGEYVCDCGTDKTKANVTVEARL-IKVEKPLYGVEVFVGETAH--------------FEIELSEPDVHGQWKLKGQP-LTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKELPLIFITPL---SDVKVFEKD-------EAKFECEVSREPK-TFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLKFLTP----LKDVTAKEKESAVFTVELSHDNI---RVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEA---MGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDEVILQCEISKADAP--VKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREI---KLVRPLHS--VEVMETETARFETEISEDDIH--ANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTA--GETATFDCELSYEDIP-VEWYLKGKKLEP--SDKVVPRSEGKVHTLTLRDVKLEDAGEVQLT-------AKDFKTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEV-SRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKD----FKTSCNLNVVP-PHVEFLRPLTDLQVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTA--RTSGMLTVL-EEEAVFTKNLANIEVSETDTIKLVCEV-SKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSR 13467          

HSP 45 Score: 62.7734 bits (151), Expect = 2.100e-8
Identity = 55/209 (26.32%), Postives = 92/209 (44.02%), Query Frame = 1
Query: 7144 FSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDM--MNFVISNNAKVLTIPSVNK-EGGIFKCIARNEVGSIMKVYKL----EVIMPALV-RLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGI-----FRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGE 7731
            F+   +++ V  G++  F+    G P P + WF     IS   +  +    S+    LTIP+V K   G +   A N  G      +L    E   P  V RL  + VR+ S     V  T  G P PV+K+ RDG  I     F+   + D  +  L I +A  ED+G Y+   TN + + + + ++++    ++ + K   +V   +
Sbjct:    8 FTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVT--GIPTPVVKFYRDGAEIQSSLDFQISQEGDLYS--LLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKTIVSTAQ 212          

HSP 46 Score: 62.003 bits (149), Expect = 4.531e-8
Identity = 50/171 (29.24%), Postives = 74/171 (43.27%), Query Frame = 1
Query: 7894 YRCVANNDAGYQEIRITLEVLVQPKI-------FRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSL--KIEDEGSLTCIAKNVAGE----DRLTFQITVELLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQN 8367
            +R  A N+ G    R T  + ++ K+        R    + T  L    Q+ C+I+ G P P I W R G  L + + Y  ++D        +  + EDEG  TCIA N  GE     +L  Q T +  P   L     G  GS++ +     G+P P +TW    + LQN
Sbjct: 31430 FRVFAENETGLSRPRRTA-MSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIV-GRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQN 31598          

HSP 47 Score: 61.6178 bits (148), Expect = 5.920e-8
Identity = 88/370 (23.78%), Postives = 155/370 (41.89%), Query Frame = 1
Query: 8248 VSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENE-----INIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGR--------AIESKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSD-DPSESIKRTILMCKVEGKVD------SIVWLKNGVIVQNSSRLYINDFNLI-INQAKSKDTGIYQCIASNSAGEAQG------QVHLLVKSPPV-FTLLPG-NISANLGEVLILPCAAEGYPIPTISWYKNKKLIK-YDFVK-SLIKNG-SLRIIGVQKEHSGVYFCV 9261
            V+L  SV    G  V ++   +G+P PTVTW+KD ++    LG+  R++ EN      + I  +   DTG YI   E    E  +++  + +   P    K ++K+V + T    +         P I ++   R         +  K +S    S  L  +  +    ++ +A+N +G  E     E +    V     D    +S K ++++   +   D        V  + G   Q  S   I+    I ++Q K +    ++  A N  G +         V  L+ +P V  + +PG  ++  +G  + L    +G P P+ISW K+   +K  +FV+ S  +N  +L I   +KEH G Y  +
Sbjct: 28202 VALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKN----LGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSST---SFKLIDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIGPITVKELIITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVI 28564          

HSP 48 Score: 61.2326 bits (147), Expect = 7.297e-8
Identity = 56/202 (27.72%), Postives = 85/202 (42.08%), Query Frame = 1
Query: 7669 VIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQG----LIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKI---LEGIPQPVITWERNGITLSKVKNY---YTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLP 8244
            V I  P  +   +++ VR      L C V G     + WY  G   I+  +  +Y+    +G    LII  V  D + VY+  A N  G      +LEV V  KI  P   E  G ++ +      I     G P PVITW++    +    +Y    T + + L   N ++ +D G     AKN  G D+ T ++ V  +P
Sbjct: 31850 VPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGL--KYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVP 32049          

HSP 49 Score: 60.8474 bits (146), Expect = 8.341e-8
Identity = 46/169 (27.22%), Postives = 73/169 (43.20%), Query Frame = 1
Query: 5419 VALGGNLYLFCVS-EGRPKPKIEWRKDGSRIDFR-----RVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQ 5907
            V L G+   F     G P P++ W +DG  I        ++  SD    LT+ +  + ++GRY   A N  GQ   + ++ V          +R   +    G  V L+  V+GIPTP + + +DG  I     ++    G+   L I      D+G YS  A N+ G+
Sbjct:   16 VVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGR 184          

HSP 50 Score: 60.8474 bits (146), Expect = 8.411e-8
Identity = 82/303 (27.06%), Postives = 127/303 (41.91%), Query Frame = 1
Query: 5194 ATIEWFKDGELIRNNLRVNITNRGT--QLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIP--PSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFR--RVLLSDDGYH--LTVNSTMETDAGRYQCIAENTHGQ--TDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRII--GNSKQLEIIAMQASDAGRYSCV-------AKNTFGQMEIFM-----DVTIGAPPSIDRNRILNEYII----KVGDELRLPCP 6018
            A   W KDG  IR + +      G   +LH+++ Q SD G Y C++  +LG  ++  T  +++   P     +      V  G  LYL C  E   +  + WRKDG  +  +  R++    G    LT+N   +TDAG Y    EN +    +     V+V     + P   ++ K +    GT +  C ++   TP I W K    I   P+ +  I+  GN   L+I      D   Y+         AK T G+ E+ +     DVTI    S   +  ++E  I    K+  EL  P P
Sbjct: 12074 AITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVL--RLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLYLSC--ELNKERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIRDQHVKPK----GTAIFACDIAK-DTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRYPAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWKLKGELLRPSP 12367          

HSP 51 Score: 58.9214 bits (141), Expect = 3.725e-7
Identity = 53/230 (23.04%), Postives = 98/230 (42.61%), Query Frame = 1
Query: 2497 QWVCVATNSAGSSRK-------SFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQD---NSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAA--PKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRIMAKDNT----LVIKTVKAEDEA-IYTCIAKNQVGTAKFDIELDVQTKP 3135
            ++   A N  G SR           L  G  P I+  + ++    GE   + CQ+ G+P P +KW R     +   +    +Y ++ D   ++L +     ED+  Y C A N+ G+V+ S ++ +       P     +     V STL+  ++ +    +P   ++W    K ++ S  I  ++      LV+K V+ +  A  Y     N  GT    +++++Q KP
Sbjct: 31429 EFRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYR-----FGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYI---GRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKP 31650          

HSP 52 Score: 58.5362 bits (140), Expect = 4.868e-7
Identity = 119/568 (20.95%), Postives = 211/568 (37.15%), Query Frame = 1
Query: 6931 KPVILWTKENSPILIGDTDYYLTFNNGQS-LTILNPKSDESGRYTCEAKNLAGQDSHTFVLTV-----TSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKEGG--IFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGI-----FRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKIS----QDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPT---------ETETTGVLNT-VLQMQCKILEGIPQPVITWERNGITLSKV------------KNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKV-SLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEIN---IYDLKPEDTGNY-ICIGERSGAEASTASTYL 8502
            +P  +WTK+   I  G   Y L+ + G   L I    + +SG YTC  KN AG  S +  LT+     T   K  T  +     IT Q    V  +   +   +  I      M  +       +    +KVL    V K     + K I   E+    +  + EV   A ++    ++    G    +     G     +KW  +G  +     +RYG     +T  L I  A   D G  TC    K      Q   ++   +   P   S  +S  +  G+ VL  C + G     I W+        S+ +   +  +   L I       SG Y   A N  G  +   T  ++V P +  P+         +T   G  ++  +QM     E       +   + +T  K             +++   + S     +++   +  +   +   + G           + PK+ +LP  ++ DEG  +T+ C   G+P P VTW   G+ + +    RF   + +++    I D++ +D G Y + +G   G++++T + ++
Sbjct: 33807 RPTAIWTKDGKAITQGG-KYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKT---SEITPQKKAVVQEEISQKALRSEEI-----KMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASE-EVRTHAEIKAFSTQMSINEGQRLVLKANIAGATD--VKWVLNGVELTNSEEYRYGVSGSDQT--LTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRG--QCSATASLMVLPLVEEPSREVVLRTSGDTSLQGSFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMTQLESSTSKMLKAGIRG-----------IPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 34347          

HSP 53 Score: 58.151 bits (139), Expect = 5.949e-7
Identity = 61/228 (26.75%), Postives = 98/228 (42.98%), Query Frame = 1
Query: 7345 FKCIARNEVG------SIMKV-YKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESP---KKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNN--QISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPT 7983
            F+  A NE G      + M +  KL       +R +  +V  + G +  + C   G P P IKW R GK +    +Y   +D RT  L +   ++ED G YTC  TN++ +   S  +++ + P+       K+     VG  + L  +  G RP     +  G    Q S  I  E        ++ +  RK H+G Y+   +N  G   +   L+V +Q K  +PT
Sbjct: 31430 FRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIG-RPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGT--VDAILDVEIQDKPDKPT 31654          

HSP 54 Score: 58.151 bits (139), Expect = 5.949e-7
Identity = 75/350 (21.43%), Postives = 137/350 (39.14%), Query Frame = 1
Query: 2557 IGFGPRIKDFVTNIDGSYGENITIRCQVEG-QPPPRVKWLRGIAGGYNIPIALGDRYFINQDNS---LIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGI----------AAPKIAFTQSKQVVVES----TL----------KKVIVCLVVESKPPAVISWLKNGKEIE-------YSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKP-----IIIGDFKTFI---DAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISP-DGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVE 3474
            I  GP +   + +  G  G ++   C++E      +V W  G+    N      ++Y I  ++    L +K ++  D   Y C   N +G+     ++ + G+             KI        ++E     TL          + V   + +   P   ++W K+G++I+       Y+         L I +V  +D+A YT +A+N+ G      +L V   P      +   FK  +   + ++G  +  + +  G P P ++W K G+PL++ P + I+    D   L +     E  G +  TATN   +       S +A  Q+ +      E  SKE  E
Sbjct: 32492 IEIGP-VSGQIMHAVGEEGGHVKYVCKIENYDQSTQVTWYFGVRQLEN-----SEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGS------TSCQAHLQVERLRYKKQEFKSKEEHE 32829          

HSP 55 Score: 58.151 bits (139), Expect = 6.152e-7
Identity = 48/176 (27.27%), Postives = 72/176 (40.91%), Query Frame = 1
Query: 3463 ENVELNCIITSGNPSPKIEWYKNGQPLVEIPG----RVEIAGQKNI--LKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTK--------EGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGS 3948
            ENV     IT  +P P + WYK+GQ +   PG    +      K +  L +     D+   Y   A N+   DS   ++T+ + P  +DS +  ++ +        EG+ +    ++ G P PT KW      L L  N   I +  +D   L I     E  G Y    TN  GS
Sbjct: 32632 ENVRFGVTITV-HPEPHVTWYKSGQKIK--PGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPN-IEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGS 32803          

HSP 56 Score: 57.7658 bits (138), Expect = 8.667e-7
Identity = 45/169 (26.63%), Postives = 76/169 (44.97%), Query Frame = 1
Query: 2092 PPPTFSWFLNGRELDP--TDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYI--------SLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNI-IINETIG--TLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDI 2559
            P P  +W+ +G+++ P   D + +  +D    Q+ I++V   D  E    A+N  G D  + KL+          +L  +    LA     EG         +G+P P + WE +G P+++  NI II+E +    L I        G +   ATN+AGS+    +L +
Sbjct: 32644 PEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 32812          

HSP 57 Score: 56.9954 bits (136), Expect = 1.350e-6
Identity = 43/175 (24.57%), Postives = 76/175 (43.43%), Query Frame = 1
Query: 8257 PISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNR--FRFNSENEINIYDLKPEDTGNYICIGERSGAEASTAS--TYLSIFTRPKFVYKPKLKNV-VQETRWKSFRCEATSHPKPDIKWMFNGRAIESKL-------NSNGRGSITLQSVRSENAGEYKCIAKNRVG 8745
            P+S    EG +     KV G+P P   W  DGQ + N   ++   + +    + I    P D+G +  + +     +S +   T  ++  + K ++  KLKNV ++E      +  AT +P PDI W+ N   I            + G  ++ + S  S+++  Y   A N+ G
Sbjct: 1463 PVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAG 1637          

HSP 58 Score: 56.6102 bits (135), Expect = 1.706e-6
Identity = 49/190 (25.79%), Postives = 85/190 (44.74%), Query Frame = 1
Query: 8518 PKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKL-------NSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKR---TILMCKVEGKVDSIV-WLKNGVIVQNSSRLYIND----FNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVK 9042
            P F  +P    VV E    +F    +  P P++ W  +G+ I +          S+GR  +T+ +V   N+G Y   A N  G    +  L V A+     +     S ++++     L  +V G    +V + ++G  +Q+S    I+     ++L+I +A  +D+G Y   A+NS G A     LLV+
Sbjct:    6 PTFT-QPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194          

HSP 59 Score: 56.6102 bits (135), Expect = 1.839e-6
Identity = 38/117 (32.48%), Postives = 54/117 (46.15%), Query Frame = 1
Query: 5362 VDIMIPPSIKFNSK-AGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRRVLLSDDGYH-LTVNSTMETDAGRYQCIAENTHGQTDISFDVQV--TYGPTLDPGGKRYYKVER 5700
            VD +  P +  ++     H V  G ++ LF   +GRP P   W K  S +  R  + + D +  LTV +    DAG+Y    EN  G   I+F V+V  T GP   PG   +  V R
Sbjct: 29276 VDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGP---PGPITFKDVTR 29389          

HSP 60 Score: 56.225 bits (134), Expect = 2.085e-6
Identity = 95/487 (19.51%), Postives = 185/487 (37.99%), Query Frame = 1
Query: 1435 QVKRGHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNVTLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKNASIEPFKDAE--------LECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGN---IIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAP 2862
            +VK    +  NC V +E      W++N+  I ++ +  +  ++    TL I  A+   Q  Y   +            N R + + +      +    +   +EP KD E          C V     NV LKW K+       N   +R++ YK         L I      D GEY+  A  +  V+E +  I+  T     ++++ ++  D+     SC+ LS       W+ NGRE+     +     D    ++ I + +  D  E  C  ++       R +L    +P +  +   ++I        V  +     + ++ W  N   V + G+   ++    I  L I  I+   +G++  +A +    ++    L++   P+IK    ++    G+ +T+    +  P    +W +      N P++        +  S  I      D+  Y    QN+HGK +  + +++  +  P
Sbjct: 13577 RVKEQQEVVFNCEVNTE-GAKAKWFRNEEAIFDS-SKYIILQKDLVYTLRIRDAHLDDQANYNVSLT-----------NHRGENVKSAANLIVEEEDLR--IVEPLKDIETMEKKSVTFWCKV--NRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHM-------LTIKDCGFPDEGEYIVTAGQDKSVAELL-IIEAPTEFVEHLEDQTVTEFDDAVF--SCQ-LSREKANVKWYRNGREIK-EGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKS----RARLFVEEIP-VEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNM-VVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAK----LELAAAPKIKTADQDLVVDVGKPLTMVVPYDAYPKAEAEWFK-----ENEPLSTKTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGP 14019          

HSP 61 Score: 56.225 bits (134), Expect = 2.138e-6
Identity = 43/169 (25.44%), Postives = 74/169 (43.79%), Query Frame = 1
Query: 4876 LKGSTTNLWCNVSGFPTPQIRWTYMETIXXXXXXXXXXQLHFMN---------VDKSHITRYTCIATNEAGSA---RKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQE--SDIGIYKCLVSNKLG 5340
            L+GST     ++SGFP P++ W + +            Q+ F +         V K++  RY+  ATN +G A    +L     T PP  V     +   + +  ++RL       P   +++++DG  I+++L   I+  G    LL A+    D G Y    +N +G
Sbjct:   18 LEGSTATFEAHISGFPVPEVSW-FRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQR--LQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVG 183          

HSP 62 Score: 54.6842 bits (130), Expect = 5.686e-6
Identity = 78/332 (23.49%), Postives = 122/332 (36.75%), Query Frame = 1
Query: 6787 GGTIEKKFEISVIIPPKIMKRSLGPENHRV-----KENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQS-LTILNPKSDESGRYTCEAKNLAGQDS---HTFVLTVTSPPKF---------------------PTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYD---MMNFVISNNAKVLTIPSVNKEGGI-FKCIARNEVGSIMKVYKLEVIM----------PALVR-LDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRYGTKTDSRTGI----LEITDAKEEDTGRYTCTGTN 7635
            GG I  +  +SV    K+    +GP + ++     +E   + + C + NY+ +  V  +       L     Y +T+ +G + L + +    + G Y C+  N  G+DS     FV  V     +                     P +F++     T  +G +V F       P P + W+     I P D      F        LTI SV  +    +  +ARN+ G      KL V +          P   R L   E +E     F +  +  G P P +KW +DG+ +           G+    L I D   EDTG Y  T TN
Sbjct: 32473 GGAIRSQKGVSVA-KVKVASIEIGPVSGQIMHAVGEEGGHVKYVCKIENYDQSTQVTWYFGVRQ--LENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVS--GIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATN 32799          
BLAST of Hemicentin-1 vs. Ensembl Human
Match: TTN (titin [Source:HGNC Symbol;Acc:HGNC:12403])

HSP 1 Score: 572.778 bits (1475), Expect = 2.189e-162
Identity = 633/2575 (24.58%), Postives = 1049/2575 (40.74%), Query Frame = 1
Query: 1807 KWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSE---AVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDP-RISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGN--IIINETI-GTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSY----GENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRY-FINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVE--SKPPAVISWLKNGKEIEYSNR--IMAKDNTLVIKTVK--AEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGIS-DYEIGSKENVELNCIITSGNPSPKIEWYKNGQPL-VEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITIL--VAPKASDSKMIKIYTKEGEKLTLNCKIDG-FPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIV---GGNITFSCVMNSTPPAEIKWF--KNEIDIYKSLPKDRFKIS-LDG-STLTLFEVKHLDSGIYKCLAINIG--ESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKT--LLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXX------XXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELI--RNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLG---LDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFR---RVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPT--LDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDG--TRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNK-EGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISST----ILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNY--YTTTDSGLFIFNSLKIEDEGSLTCIAKNVAG--EDRLTFQITVELLPKVSLPISVTGDE---GSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRF-NSENEINIYDLKPEDTGNYICIGERSGAEASTAS--TYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLNSN-----GRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPR-VRVYQSDDPSESIKRTILMCKVEGKVD-SIVWLKNGVIVQNSSRL---YINDFNLI-INQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYD---FVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQG 9279
            KW+K      L  +K++RI  +K +     ++L   SA   D+G+Y     +E G S        +     P  +   + +  + N +    C+   + P   SWF +G+E+  +D  RI+ V     + ++I  V   D+G   C+A NS G  +    L     P  ++   +K++ L G    ++ +  G     I W F G+   + G    I  E +  +L++  ++ +  G + C  +N AG    S NL   F      FV  ++ S     G+   + C+V G PP ++ W    A    I  +   R  F+     L +  + +ED   Y+C+AQN+ G          S I   K +   +K+      LK+  V L+ E    PP  I+W K+   +    +     +D+ + ++ +K  A D   Y C   N+VG++     + ++  P  I   ++    + G     Q   KG     + W K    +T +  +R+    + + L +  I  +H G + C A ND         +SVK P  I++E +S D   G    +++     SG      +W+K+GQ L +    ++ +    +ILK+    + ++G Y  +  N+V   S   +I +L  + P +   K+ K+ + +G  + L C + G  P   + +     I   ++  F   +   +   L I+Q+     G YTC  TN  G  + S  + + E P  ++      V  +  + L  +  G     IKW    K +   A       +   +L +  A +   G Y C   N+ G     + + V  P   +K P+      P++V   G + TF C +  TP   + W+   NEI   +     +  IS +DG +T  +   +  +SG Y C A N     S +  L V   PT + +     V+     +D+ + C   G P     W K+N ++ S  +  +T+      L I K   SD   YQC V+NE G    +  V +  PPS     +  T   LK S T     V+G P   I W   + I           + + + L   +VD  H  RYTC A NE+G  R     ++  P +IV  +  K   + +   + L C     P   ++W KDG+ I       ++  N      + +  + D G Y   V N  G    D     +D  IPPS  F  K       LG ++++ C   G      +W KDG  I      R++  +    L VN+    D   Y C   N  G    S  + V   P+  + PG     + +     TV  + ++ G P   I W KD + +   P     + G++  L + ++ AS  G+Y+C   N  G       + +  PP   + ++    I+K GD  RL C   GSP   + +F++ + L          AS K R+       ++ + +    DSG + C A N  G       V V+ PP F  S+  P V    N   SLEC L G   PP ++ W +    L S    +I+     T I + NV   D GEY C AQNEV   + V  V++   PRF        + A +   +Q S E  G  P  + W ++++E++ + E   +   +   + +Q    +P +A  Y C   N GG  E    + V+ P  I++++ GP    V E    T  C V      +  + W K+   +       +  +N   SL IL+ +  ++G YT + +N  G+ S T V+ V S    P  F+   +     LG S   +C   GS   S+ WF++   I          S+N   L + S++  + G + C+A N  GS      L V  P     +   +    G + +      G P   + W R  + +    R     +     LE+ +     +G YTC  +N   Q S +  + +  P           V  G+ ++L     GT P  + W   G N  +S     +  E   + E   I++  ++D +G Y C   N+AG       +  L  P      E     V ++V  +QC++  G P+  ++W +    L     Y  Y T +    +FN + I D G  TC A+N  G    +  F+I    LP  S    +   E   G  VT+ C++ G     V W +DG  L++    +  F ++   + I       +G Y C        AS+++  T       P F  KP   +V+       F C  T      I W  + + I    N           + +  V   ++G+Y C A N VG    S  L V   P+ V+  ++   ++  +   L CK+ G  +  + W +N   +  S +    +IN   L+ IN+A ++D+G Y C A N  G+A     L VK+PPVFT  P  + A  G  +IL C   G P   + W K++K ++      + S   + SL I+ ++    G Y C A++  G
Sbjct: 4049 KWYKD--GRPLVASKKYRI-SFKNN----VAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGT--ASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPSFVTKPGSKDV-LPGSAVCLKSTFQGSTPLTIRW-FKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANL---FVKEPATFVEKLEPSQLLKKGDATQLACKVTGTPPIKITWF---ANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDH------CSSIVIVKESPYFTKEFKPIEVLKEYDVMLLAEVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPPSFIKKIESTSSLRGG-TAAFQATLKGSLPITVTWLKDSDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATITEEAVSIDVTQGDPATLQVKF---SGTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASEKYKFSFHD---NTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEKPQSQDVNPNTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKEPPQFIKKPS------PVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQ-----KHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVEVVKY---SDVELECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFIK-KIENTTTVLKSSAT-FQSTVAGSPPISITWLKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQIV--EKAKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPS--FTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPSFLVKPG-----RQQAIPDSTVEFKAILKGTPPFKIKWFKDDVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPKFVK-KLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELP---------ASDKYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVF--SSFPPIVETLKNAEVSLECELSGT--PPFEVVWYKDKRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFVSKLNSLTVVAGEPAELQASIE--GAQPIFVQWLKEKEEVIRESENI-RITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIVEKA-GPMTVTVGETC--TLECKVAG--TPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDV-SDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPSFVKEPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPAAFLKRLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILE---ILNSTKRD-AGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSV-SLQCQVA-GTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQLPP-SFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVSIDVIA-GESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVG 6537          

HSP 2 Score: 572.778 bits (1475), Expect = 2.633e-162
Identity = 652/2712 (24.04%), Postives = 1108/2712 (40.86%), Query Frame = 1
Query: 1429 KIQVKRGHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNVT-LEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKNASIEPFKDAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGG--VSEAVGFIKTHTLPAASVDEKEISFI--DNDSITASCRALSTPPPTFSWFLNGRELDPTDPR-ISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIINETIGT--LDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRG---IAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRI-MAKDNTLV---IKTVKAEDEAIYTCIAKNQVGTAKFDIELDV--QTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQI-----SKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPG-RVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSIL---DLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLI-VERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNK---NITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAINI-GESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEIT--NGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNV---FVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXXXXXXXXX------QLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGT--QLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRR---VLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYY-----KVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQME---IFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTP---PEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGT--RITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPV-ILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKEG---GIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGI---FRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVI---ISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIE--DEGSLTCIAKNVAGEDRLTFQITV-ELLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEI-NIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYK-PKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIES----KLN-SNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAK--PRVRVYQSDDPSESIKRTILM-CKVEGKVD-SIVWLKNGVIVQNSSRLYI----NDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKS---PPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIK--YDFVKSLIKN-GSLRIIGVQKEHSGVYFCVASSNQGE 9282
            K+   +G  I + C+V    P  I W+K+D +I  + ++  +F    N   LEI +      G Y               G+ +    +TV  PP  V  P++  + P    +L+  V  T+  + +KWFK     EL +     +       +  S+ L + +A  +D+G Y+C   ++ G   S+A  F+K    P   + +     +  +  S T  C+   TP    SW+L+G E+       IS ++ +  +  +IS  + ++SG  +C+A+N AG     I+L     P  +      E+    D + + C  TG P  ++TW  N   +       + + +    L I + + +  G++ C+ +N  GS   S  + +   P     + N       + T +  V G PP  + WL+    +    N+ I+     F++   +L I+ +       Y C A+N+ G V+      +  +  P     ++K V V       + C VV   P   + WLK+GK+I  S    M+ +N +    I++V  +D   YT   +N  G++  D  L V  Q  P       T +D   G  I ++C+  G      +W K G+ ++     R+V       L V ++  E    +TC  +N          ++VK PP        ++ I D        VE   I+  G P  KI+W+K+   LV  P   + + G  + L +Y  +  +TG Y C  TN+V SDS    + +   PK           K G+   L CKI G P     W      L   D  R  F  + + I  N+L      +E  G + C+  N  GS   S  VI+ E P    F        +  ++L C  SG P  ++ W +K K    ++  YK+  +N  T I +    +   GEY C A+NE G D    + TV      +K P +    +    ++ G        +    P  ++W K + ++ +     R     + +TL   + +  ++G Y C   N  G   N   ++++ P ++ + +    + + E   L   C   G P     WYKD   L S  + + +  N   +L I  V R D   Y   V N  G+      V+V    VPPS     ++ T   L G++  L C V+G     + W + +T          +       L   ++D S +  YTC+A N AGS        +  PP  V  +P+    +L    +  +      P   + WF+    +    R NI    T  +L L N   S  G Y C+VSN  G  + + T  + +     F  +   H V  G ++ L     G     + W+KDG  I       ++ ++    L + ++ + DAG+Y C  EN  G+     DV      TL+P    Y+      +E  VG +V L+C V+G P   ++W K    +   P YR     N   L    +  +D+G Y+C A+N+ G      +F       PPS  R   L +    VG  + L C  NGS    + +++DG    +     N   S+   +        L +     + SG Y C+ASN +G       +  R P   P FD   V   ++    ++   EC + G    P +ITW +    +  GG+  I+  G    + +  V + D+G+Y C A N+V K      + V   P+F K    +K+ A Q  ++Q+ C+ +G P   + W+R + E L +  +Y     +   +++ I     +D+  Y C A NG G       ++V  PP   ++   P      +   +   C +   + T P  ++W K+   +         + +   SL ILN ++ + G Y C+A N  G D+ +  +    PP+F    S   +T T+ +G +V  +   EG    S++W  KD      +  N  IS    + T+   + E    G + C  +N+ G       L V+ PA +      +   +G  F++ C   G P+   KW +DG+ +    ++     ++   L+I  A+  D G Y+    N + + + +V V +   I PP      K +   +G  V+L C V G+ P  + W+  GN  +S          +   L +  +    +G+Y CVA N AG  E    L V  +P  F  T  ++  VL  +      ++ G P   + W +    L   ++   + +  +      +++  + G  +C+  N AG    T  + V E    V      + + GS + +     G P  +V+W KD   +            ++ I  I +   ED   Y C+ E    +       +S+   P F+     ++ V+ E    + +C+    P+  I W      + S    K+   N   S+ +  V   + GEY C A N VG+V  S +L + A+  P     +  D  E++   +   C++ G     + W K+GV++++ + L      N   L I Q      G Y C ASN  G A     L++     PP F L P ++   LGE     C   G     I+W K+ + I+   ++  +L++N  +L ++ V K  +G Y C AS+  G+
Sbjct: 4683 KMDSIKGSFIDLECIVAGSHPISIQWFKDDQEI--SASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSAT-------NKAGHNQCSGHLTVKEPPYFVEKPQSQDVNPNTRVQLKALVGGTAP-MTIKWFKD--NKELHSGAARSVWK-----DDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKE---PPQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGL--ATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVEVVKYSDVE-LECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFIKKIENTTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDNVYIS-----FVDSVATLQIRSVDNGHSGRYTCQAKNESG-VERCYAFLL--VQEPAQIVEKAKSVDVTEKDPMTLEC-VVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPSFLVKPGRQQAIPD------STVEFKAIL-KGTPPFKIKWFKDDVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRMTFIDSVAVIQMNNL-----STEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIVETLKNAEVSLECELSGTPPFEVVW-YKDKRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSD--TCVCTV-----KLKEPPRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIVEKAGPMTVTVGETCTL--ECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTR-RLKNTGGVL-GASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPSFVK-EPEPLE-VLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAG--QASCTTRLFVKEPAAFLKRLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGR-----DVCGALVSTLEPP---YFVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQ--LKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGV---LLRDDENLQTSFVDNVAT------LKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPV--SIDVIAGESADFECHVTGAQ--PMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKV-AKQGESIQLECKISGSPEIKVSWFRNDSE-LHESWKY-NMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQK---PSPVGALKGSDVILQCEI---SGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLS---DTSTL-IGDAVELRAIVEGFQPISVVWL-KDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLEPARIIEKPEPMTVTTGNPFALECVVTGTPELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQ-EPPSFEQT-PDSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQ-DICEALVSVLEPPYFIEPLEHVEAVIGEP--ATLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKARKLPPFFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSVDLALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGK 7292          

HSP 3 Score: 555.829 bits (1431), Expect = 3.247e-157
Identity = 634/2617 (24.23%), Postives = 1054/2617 (40.28%), Query Frame = 1
Query: 1741 IEPFKDAE--LECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGREL--DPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTID--GNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDI---GFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRY---FINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNR--IMAKDNT--LVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPG-RVEIAGQKNILKVYGKNEDETGSYECKATNEV--SSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDK-NDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFID----NTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGST--LTLFEVKHLDSGIYKCLAIN-IGESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNG--GKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPS-INGISMRETPEFLKGSTTNLWCNVSGFPTPQIRW--TYMETIXXXXXXXXX-----XQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNIT--NRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTV---DIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFR---RVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEP--KVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGS--IRISPDGTRITVENVKQYDAGEYKCHAQNEVSKI--SLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVI---IPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPV-ILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKE-GGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQI--SSTILGEYQFLSEQ--GLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTET--ETTGVLNTVLQMQCKILEGIPQPVITWERNGITLS---KVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVE---LLPKVSLPISVT-GDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENE---INIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLNSNGRGSITLQS---------VRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGKVD-SIVWLKNGVIVQNSSRLYINDFN----LIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYK-NKKLIKYDFVKSLIKN--GSLRIIGVQKEHSGVYFCVASSNQGEVHSQPIYLTVQ 9315
            +E  K+AE  LEC +  T    V+ W+K   + +L+++K+++I     +   F + + IL+   SD GEY C A++E G    V  +K    P        ++ +  +            P    W     E+  +  + RI+ V +V  + ++ +  +P ++G+ IC+ KN  G+ E    L  +  P ++           G+  T+ C   G P+  + W  +G  +T            I +L I  +E+   G +     N+ G S  +  +D+      P     + N  G  G +  + C+V G  P  V W           I  G +Y   F +   +L +  L   D   Y C A N  G    S + R         +F +  + +     K V    V+   PP  ++W +  +E+   +R  I  +D    L +  +       YTC+  N  G A     L V+     +         + G  I+L+    G     + W+K G  +T      IV +     L + + T+  AG ++C   N+    V    VS   PP    E +   E    ++V L C + +G P   + WYK    L   P  R         L     N +++G Y CKA N +  +S    F+I     P +   ++  I    G  +TL C+++G   P +   ++  +L   R+   +  S +D    L I Q      G Y+C  +N  G+A  S  +   E PK   F D   V ID     +    C  +G    +I W    K I P          N   L + +      G+Y+C A N+ GKD  ++ ++V  P   +K    +        G +I   C ++ +P  ++ WF+N+ ++++S    ++ +S   S   LT+ E    DSG Y C A N +G++   T + + +P +  +  S   +   + +D+ + C   G P    +W KD  Q+ +  + +IT+     +L I  +  SD   Y C  TNE G D  +  V    PP  +  +S   T   L G    L   V GF    + W     E I        +     + L   + + S+  +Y C   N+AG   +    VLT       ++  +   +       L C     P  + +WFKDG  +  + + +IT  N+   L +  A+ SD G+Y   V N +G      +V   D ++PPS  F  K       LG ++ L C   G     + W +DG+ I      +   S++   L ++    +D G Y C+A N  G  + S  + V   P+ +   +    VE   G ++    ++ G P   + W K    +    S    +     +LE+  +Q  ++G YSC+  N  G       + +  P +  +   L ++ ++ G  + L     G+P  ++++ KD   +           S +  + ++++  +L +  +   D   Y C   N  G D+ E  V V  PP F    +EP   V     +  +L+C + G   P  +I+W +    L S  +  ++   +   + +  V   D GEY C A N V  +  S V  ++    P F+  +L   +       V   C   G  P  + WY+    +  D      F  +   + +QI          Y C+A+N  GT     ++ +    +PP      L P +  +      TF C V     T P+ I W K+N  I  G         N  +LT+L     ++G+YTC A N+AG+DS +  L V  PP+F       R    V+      ++C   GSP   ++W+  +  I           ++  VL + +++ E  G + C A N  GS      L+V  P + R     +    G    + C  +G P   + W +D + +    +Y   +++    + I +    D G Y C  TN +  D+    + + +PP+       I   VG++V L   +EG  P  + W+      +  S  I   Y   SE    L   RV   ++G Y C   NDAG QE   TL VL    I    E+   TTG   T   ++C +  G P+    W ++G  L+   K K  +    SGL I N +   D G  +   +N  G+D  T  + V    + P  +  +  T G  GSSV + CKV G P  +V+W  +G  + +  G +++    +    + +  L+  D+G+Y CI   + A +   S  L++   P FV KP   +V+  T   +F       P   + W F G    S+L    R +++L+          V +  +GEY CI  N  G    +  L + A  +     +D   E  K  IL     G    S+ W KNG+ V  S R  I        L I  +  +D G Y C   N++G+      +L+  PP F      +  ++G+   L C   G P   +SWYK + KL      K   +N   +L    V    SG Y C A ++ GEV S   +LTVQ
Sbjct: 5526 VETLKNAEVSLECELSGTPPFEVV-WYKD--KRQLRSSKKYKI-----ASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENV--ATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLE-PAVIVEKAGPMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFH-----EKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAG----SDECRAVLTVQEPPSFVKEPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPAAFLKRLSDH-SVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTE-LEPLEAAVGDSVSLQCQV-AGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNG-SAPIQVCWYRDGVL--LRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTARE-PKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKVAKQ---GESIQLECKISGSPEIKVSWFRNDSELHESW---KYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSP--VGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLSDTST---LIGDAVELRAIVEGFQPISVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAG--MRECSAVLTVLEPARIIEKPEPMTVTTGNPFALECVVTGTPELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPS--FIRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPSFE---QTPDSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKR--LADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQ---------SERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPPYF----IEPLEHVEAVIGEPATLQCKVDGT--PEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKARKLPPFFARKL-KDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANLQTSF--VHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFF---DLKPVSVDLALGESGTFKCHVTG---TAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGVQEPPRFIKKLEPSR---IVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKGADVHLECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISY---SENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIVEKPESIKVTTGDTCT---LECTVA-GTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIIN-VAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISS--GRKYQTTLTDNTCALTVNMLEESDSGDYTCIA-TNMAGSDECSAPLTVREPPSFVQKPDPMDVLTGTNV-TFTSIVKGTPPFSVSW-FKG---SSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEV-SASTFLTVQ 8051          

HSP 4 Score: 551.206 bits (1419), Expect = 7.594e-156
Identity = 672/2759 (24.36%), Postives = 1110/2759 (40.23%), Query Frame = 1
Query: 1381 AIFSRDPLPVSVSCPAKIQVKRGHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNVTLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXK---NASIEPFKDAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPT-DPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVR--IKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIIN--ETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFV----TNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFI----NQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEI----EYSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNI--LKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILES---PKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDG--STLTLFEVKHLDSGIYKCLAINIGESLNFTLVVLI-SPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKTLLIKKVRRS--DDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXXXXXXXXXQ-------LHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGE------LRLSCNSDAAPVATIEWFKDGELIRN--NLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTV---DIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRI---DFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGP----TLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGTRITVE--NVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTT---VQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATN--GGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPV-ILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVN-KEGGIFKCIARNEVGSIMKVYKLEVIMPA--LVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQG-LIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPT-ETETTGVLNTV---LQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIEDE--GSLTCIAKNVAGEDRLTFQITV---ELLPKVSLPIS-VTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNS-ENEINIYDLKPE--DTGNYICIG-ERSGAEASTASTYLSIFTR---PKFVYKPKLKNVVQETRWKSFRCE---ATSHPKPDIKWMFNGRAIESKLN-----SNGRGSITLQSVRSENAGEYKCIAKNRVGSV--EYSFMLEVIAKPRVRVYQSDDPSESIKRTI-LMCKVEGKVD-SIVWLKNGVIVQNSSRLYINDFN----LIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPV---------------FTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNK--KLIKYD--FVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQGEVHS 9291
            A+ +    P  V  P  ++V  G  +    +++   P+ +NW++   +++     N+ F+ T    LE++  +    G Y             V  N       T L         K   + S+EP K   LE + ++ +  + + W K    + +  +++  I   +K+       L IL++++ D G+Y C  E+E G       + T   P    + + +     DS++  C+   TP  T SW+    +L PT + R    N+V  + +  + V   DSGE  CKA+NS G    +   ++    LP   +  L       G   T+ C   G    ++ W  +G  +  D N+  +  + + TL I + + +  GQ+ C A+N  G++  S  L     P+   F      +ID   GE+    C V G  P R+ W +      N  I  G  Y I    N  +  I+K +   D   Y C A N  GK   S Q+ +     PK         V +      + C +  S P   +SW +N  E+    +Y+   +     L I    AED   Y C A N VG A     L V+  P+      + + A  G  ++LQC+  G P  ++ W K  + +      +I      + L + ++     G + C ATN+  +      V  K PP+  K+ +SD      + VEL  I+    P   + W K+   ++       I+   NI  L++       +G Y C+  N+         +T+L  P     K   +    G    L C + G P  + KW      L           + +    +   +M    +G+Y+ +  N  G +  +  V + +    P  I+        +  ++ L C  SG+    + W      I           EN  TL +        G Y+C+A N  G D+ ++++TV  P    +TP+       ++ G ++TF+ V+  TPP ++KWFK   ++   +P +   ISL+   + L LFEV+ L+SG Y CL  N   S + T  + +  P    K  +    ++   + + +     G P     W KD   +    R  IT   K+ +++ +  +  D + Y C + NEAG+D     V+V  PP    I   E  E + G    L C V G P  +I W Y E        +   Q       L    VD S +  Y+C A N  G+       V+    K   L P   R  LKD        +   C  + +    + W+KDG L+++  NL+ +  +    L +L   +S IG Y C  SN LG    +  +   +  +PP   F+ K  +  +ALG +    C   G    KI W KD   I      ++ L ++   LTV    + DAG+Y C A N  G+   S  + V   P     L+P   R  K +         EC + G P   + W KD   I     +R   + +   LE+  +   D+G Y+C A N  G       + +  PP I R +      +K G ++ L C   G+P  +++++KD   L          +  K +++       + + +    D G YQC A+N +G D    S+ ++ PP F     +  ++    +   L+ T+ G A+P + + ++  G  +    +I IS      T++   V+  +AG+Y C  +N+   +   F     L+P      +  K E+++ TT     + C   G P  +  W++  +E+ +D +   K       S ++I N+ P D+  Y+    N  G  +     ++S    P    R L   N        +   C VY    + P+ + W  E + I  G        +N  +LT+   +  +SG YTC A N+AG D  +  LTV  PP F        + + V  GT+V F    +G+P  S+ WF     + P D  N  + ++   L +  V+  + G + CI  NE G       L +  PA  + RL+   + +  G    +  T  G P   + W ++G  +    R    T  ++ ILEI  +  ED G+Y C   N   +DS S  ++I+ PP      + + V VG+   L C + GT    + WY  G+ ++  T   +  F +    L+ ++V  + SG Y C A N  G  E+  +  + VQ +   P+   +   V  TV   +   C I    P  V +W ++G  L    N  T+        N  K +    G  +C A N  G    + ++ +   +  P   + ++ V    G S    C V G     V+W KD + +++  G +++ +  EN  ++  LK +  D+G Y C      G ++ TA   L+I  R   P F  +  L   V+ET   SF+ E   A S P   + W  N   I+   N      N    + ++     +AG Y C   N  GS     S +++   KP V        + S    + L C V+G     I WLK G  ++ S R   +  +    L +      D+G Y C ASN AG    +  + +K  P                F   P +I               G PIP + W K K  +L +    F+        L I    K  SG+Y CVA +  GE+ S
Sbjct: 5885 AVLTVQEPPSFVKEPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTV-AELELFNIDISQSGEYTC----------VVSNNAGQASCTTRLFVKEPAAFLKRLSDHSVEPGKSIILE-STYTGTLPISVTWKKD--GFNITTSEKCNIVTTEKT-----CILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNV--ATLVFNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARL-TAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKD-----NKEIRPGGNYTITCVGNTPHLRILK-VGKGDSGQYTCQATNDVGKDMCSAQLSVK--EPPKFVKKLEASKVAKQGESIQLECKISGS-PEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQK-PSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKK-LSDTSTLIGDAVELRAIVEGFQPI-SVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVL-EPARIIEKPEPMTVTTGNPFALECVVTGTPELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSD--KGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPSFEQTPDSV----EVLPGMSLTFTSVIRGTPPFKVKWFKGSREL---VPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLAD--FSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPPYF--IEPLEHVEAVIGEPATLQCKVDGTPEIRISW-YKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVI----KARKLPPFFAR-KLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPF--FDLKPVSVDLALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGVQEPPRFIKKLEPS--RIVKQDEFTR----YECKIGGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPP-IFRKKPHPIETLK-GADVHLECELQGTPPFHVSWYKDKRELR---------SGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLSD--ISTVVGKEVQLQTTIEG-AEPISVVWFKDKGEIVRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAG-MQECFATLSVLEP----ATIVEKPESIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNKY--KISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGL--SGSSVVMECKVYG---SPPISVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQK----PDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEK--GKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYK-GDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVG--EVSASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAISGSEPISV-SWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSARLILTEGKNPPFFDIRLAPVDAVVGESADFECHVTGTQPIKVSWAKDSREIRS--GGKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQ--LNIKERLIPPSFTKR--LSETVEETEGNSFKLEGRVAGSQPI-TVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVIKEPKKPPVFDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKDKPAVAPATKKAAVDGRLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIES 8538          

HSP 5 Score: 533.102 bits (1372), Expect = 2.509e-150
Identity = 632/2677 (23.61%), Postives = 1094/2677 (40.87%), Query Frame = 1
Query: 1423 PAKIQVKRGHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNVTLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKNASIEPFKDAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSA---SESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGN---IIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRY-FINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEI----EYSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKN-ILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTI----TLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVF----APYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGST--LTLFEVKHLDSGIYKCLAIN-IGESL-NFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEIT--NGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETP-EFLKGSTTNLWCNVSGFPTPQIRWTYMETIX------XXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKD-GELIRN--NLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRRVLLSDDGYHLT-VNSTME--------TDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYK-VERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRS---LECTLMGVADPPAKITW--ERHGVPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSV--MQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQ------ITFHCSVYNYNMTKPV-ILWTKENSPILIGDTDYYLTF-NNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNK-EGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIE----VRERSGTSFSVLCTAEGYPKPVIKWTRDGKGI-----FRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLI---IDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIE--DEGSLTCIAKNVAGEDRLTFQITV-ELLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFR---FNSENEINIYDLKPEDTGNY-ICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKS-----FRCEATSHPKPDIKWMFNGRAIESKLN-----SNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRT--ILMCKVEGKVD-SIVWLKNG--VIVQNSSRLYIND--FNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKN 9159
            P + Q      ++   +++   P+ I W+K+D ++++     +  + +++  L +Y  +    G Y   +         V  ++   +++   PP     +  +  ++    + LEC + + S  + + WF++   +EL  + ++R+         F   + ++     S  D+G+++C A++  G +     +     P  S     +  + N  ++  C    TPP    W+ + R+L  +  +  I +    + I I NV   D GE  CKA+N  G D     +     P+ +S  L     + G+   ++ S  G     + W      V  +     I   E + TL   + E    G+++C   N  G       L +     I +    +  + GE  T+ C+V G P   V+W +    G  +  +   ++ F N+ +SL I  +  +D   Y    QN  GK   +  + +S  A P  +FT+  +          I+   V    P  ++W     +I    +Y         TL + ++ + D   YTC+A N  G+ +    L VQ  P  + + +  ++   G  +      +G P  K+ W +G R L       I      ++L +++I    +G +TC  +N+        ++ VK P    K  +SD+ +   +++ L    T   P   + W K+G  +        +  +K  IL++    + + G Y C+  NE   D     ++ L  P    +++  +    G+ ++L C++ G  TP    SW      L+  P   T    +   L+  ++     G YTC   N  G+A  S  V  ++  ++     + +  I+ T+    TLTC  +G+   ++ W     L+  +        +N  TL + +    H G+YSC A N  G    ++ +T      +P+ D+K  + ++     I G +  F C +    P  I W K+  +I    P   + I+  G+T  L + +V   DSG Y C A N +G+ + +  L V   P  + K  +  V    E   L   C   G+P  +  W++++S+L    +  ++  N    L I +    D   Y C   N  G+   +  + V  PP     + + +P   LKGS   L C +SG P  ++ W                    ++ LH +N++ S +  Y C ATNE GS           PP+ V    D    I    ELR +      P++ + W KD GE+IR   N R++  +    L L + + S+ G Y C + N  G+ + +  + ++ P  I    K     V  G    L CV  G P+   +W KDG      R L +D  +H+T +N            +D G Y    +N+ G+++ +  V V+    + P   R  K V   +G +VVLEC VSG    ++ W +DG  I   P  +     N   L +  ++ SD G Y+CVA N  G  E    +T+  PPS ++     E +   G  L       G+P   + +FK        +L P +  +      V++    L L+  +  +SG Y C  +N  G       + V+ P  F       ++  F+ +T S   LE T  G   PP  ++W  + + +  S   SI ++   T + +      D  +Y C  +NE  +      V V   P F   +    +EAV      + C+  G P   + WY++  ++ +     P + +   N+V  + I  +   D   Y+C A N  G +      +V++   I  R L P   R  +++       + F C +   N ++P+ + W K+   +L  D +   +F +N  +L IL       G+Y C A N  G  S +  L + S  + P  F +   ++ + LG S  F+C   G+    I W   +  I P       +  N   LT+  V K + G + C A N  G      +L V  P    + K+E    V++   T +   C   G P+  + W +D   I     FR  +  DS   +LE+ +   ED+G YTC   N     S S  + +  PP        I    G  V L C ++GT PF + WY       S     +Y+ +SE  L    I  V     G Y+C A ND G      ++ +   P+  +   ++ + V+   +Q+Q  I    P  V+ ++  G  + +  N + +    +      ++E  + G  TC  KN AG       ++V E    V  P S+    G + T+ C V G P+ +  W KDG+ L +   N+++   FN  + + I ++ P D+G Y   +    G ++ TAS  +S  T P     P     ++ET   S       C+    P   + W   G  I S        ++   ++T+  +   ++G+Y CIA N  GS E S  L V   P     Q  DP + +  T       V+G    S+ W K    ++  +   + + D    L +    +  +G Y CI SN AG+A    HL +K+P  F     + S   G+ LIL     G P  +++W KN
Sbjct: 5336 PGRQQAIPDSTVEFKAILKGTPPFKIKWFKDDVELVSGPKCFIGLEGSTSF-LNLYSVDASKTGQYTCHVTN------DVGSDSCTTMLLVTEPPKFVKKLEASKIVKAGDSSRLECKI-AGSPEIRVVWFRN--EHELPASDKYRM--------TFIDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIVETLKNAEVSLECELSGTPPFEVVWYKDKRQLR-SSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFVS-KLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIVEKAGPMTVTVGETCTLECKVAGTPELSVEWYKD---GKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDVSDRAVPP-SFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPSFVKEPEP-LEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPAAFLKR-LSDHSVEPGKSIILESTYTGTLPI-SVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFV-TELEPLEAAVGDSVSLQCQVAG--TPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTAS-SKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVSIDV-----IAGESADFECHVTGAQPMRITWSKDNKEIR---PGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKVAKQGESIQL--ECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVF---TQKPSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLSDTSTLIGDAVELR-AIVEGFQPISVV-WLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLEPARII--EKPEPMTVTTGNPFALECVVTGTPELSAKWFKDG------RELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVS-DRIVPPSFIRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPSFEQTPDSVEVL--PGMSLTFTSVIRGTPPFKVKWFKGSR-----ELVPGESCNISLEDFVTE----LELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVK-----RLADFSVETGSPIVLEATYTGT--PPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPPYFI--EPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTKLRS----APAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASS---AVLV---IKARKLPPFFARKLKDVHETLGFPVAFECRI---NGSEPLQVSWYKDGV-LLKDDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKL-ILSEHEVPPFFDLKPVSVDLALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGVQEPPRF-IKKLEPSRIVKQDEFTRYE--CKIGGSPEIKVLWYKDETEIQESSKFRM-SFVDS-VAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKGADVHLECELQGTPPFHVSWYKDKRELRSGK---KYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKL-SDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIVEKPESIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTS--DNKYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVP-----PSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPP--SFVQKPDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKN 7904          

HSP 6 Score: 531.946 bits (1369), Expect = 5.159e-150
Identity = 640/2720 (23.53%), Postives = 1103/2720 (40.55%), Query Frame = 1
Query: 1405 PVSVSCPAKIQVKRGHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNV-TLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKN-ASIEPFKDAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTL---PAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDG---NIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDI----GFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNSLI-IKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEI----EYSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKD--GDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAP---PQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPG---RVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLL-ITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQET-LIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAINIG--ESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEIT--NGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNV---FVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTY--METIXXXXXXXXXXQ----LHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDG-ELIR-NNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDG---SRIDFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPT-LDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGA---PPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRV---RTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRIS--PDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPV-ILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFY-KDMPISPYDMMNFVISNNAKVLTIPSVN-KEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVI---ISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQF-LSEQ--GLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITL---SKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPIS-VTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKP---EDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPK-LKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLN-----SNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAK--PRVRVYQSDDPSESIKRTILM-CKVEGKVD-SIVWLKNGVIVQNS----SRLYINDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLV---KSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLI----KYDFVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQGE 9282
            P  VS    + V  G   ++   ++   P  + W K   ++I  +++N++     NV TL+  +A   + G Y          Q+   G  R+ +   ++  P  +       ++   +   LEC V  T   + ++W+K      L ++++ +   Y K      S L ILS    D G Y    ++  G S     +        P+ +   K    +   S    C+   + P + +WF    ++       +  +D     ++++++   D G   C A N AG DE R  L+    P  +      E+ L G   T      G P  K+ W F G+   + G   NI   +T+  L++  I+ +  G++ CV +N+AG +  +  L +     F  R+ D         G++I +     G  P  V W +    G+NI  +        +   ++ I   +  D   Y C+ +N+ G+  +     +S +  P   F    + +  +    V +   V   P   +SW K   ++    EY         TLV   V   D   YTC A+N +GTA       +Q + +     +   D +   G  + L C+  G    ++ W + G  L  +  L+     + + L +      H+G ++C+A+N         +++ + P   P    + +S  ++ + E+ +  C +T   P  +I W K+ + +   PG    +   G    L++    + ++G Y C+ATN+V  D    Q+++   PK           K+GE + L CKI G  +P  K SW  +  +L  + +    S I+   LL I +  +E  G Y C+  N  G A  S  + +   P   Q          + + L C  SG P  ++ W+  +K +  N+  +K+  ++ +T L +    +   GEY C A NE G D  +  V    P   +K     ++    ++G  +    ++    P  + W K+  ++ +     R     + +TL L   +  +SG Y C   N       +  L VL    I+ K    +V   N      + C   G P     W+KD  +L +  +  IT  N   +L I     SD  +Y   V N  G+      V+V    VPPS   I   +    + G++  L C VSG     + W     E ++ P   S+ S+    L+   ++ S    YTC+A N AGS        +  PP      PD    +L    L  +      P   ++WFK   EL+   +  +++ +  T+L L   Q  + G Y CLV+N  G    + T  + +     F  +     V  G  + L     G P   + W KD    S+ +   + +++    L +  +   D  +Y C+ EN  GQ      V V   P  ++P       VE  +G    L+C V G P   I+W K+   +   P+Y+ +   N   L I  +  SD G YSC A N+ G +     + I A   PP   R   L +    +G  +   C  NGS    ++++KDG  L         DA+ +   +       L +    ++  G Y C+ASN +G       + +     PP FD   V   V+    ++ + +C + G A  P KITW +    +  GG+ +++   +   +TV  V + DAG+Y C+A N   K S    + V   PRF K    ++I   Q+   +  C+  G P   +LWY+ E EI  +  ++ +   +   +V+++ N+  +D+  Y C A N  G+      + V  PP   K+   P      +   +   C +     T P  + W K+   +  G     ++ N   S+ ILN  + + G Y C+A N  G D+    + + +PP+F    S     I+  +G  V  Q   EG+   S++WF  K   +   D +    S N   L    V     G + C  +N+ G       L V+ PA +      ++  +G + ++ CT  G P+   KW +DGK +    +Y     ++   L+I +    D+G Y+    N + +DS +  + +     PP      K      G  V++ C V G+ P  + W+  GN +ISS    +YQ  L++    L ++ + +  SG Y C+A N AG  E    L V   P   +  + +   VL         I++G P   ++W +    L    +       + + L +F+ +     G  TCI  N AG+   T  + ++   K    ++  + ++G  + +     G P  +VTWKK+G  +      R    +  +  I ++     ED G Y C  E +  + S ++  L I   P FV + + +K  V ++   S +C+    P+  + W      +           N   ++    V   ++GEY C A+N VG V  S  L V  +  P     Q  D  E++   ++  C + G    S+ W K+G  +++S    +    N   L I +      G Y C A+N  G A     L++   K+PP F +    + A +GE     C   G     +SW K+ + I    KY  +  L  +  L ++ V K  SG Y C A +  G+
Sbjct: 5610 PRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIR-ESENIRITFVENVATLQFAKAEPANAGKYIC--------QIKNDGGMRENMATLMVLEPAVIVEKAGPMTVTVGETCTLECKVAGTP-ELSVEWYKD--GKLLTSSQKHKFSFYNKI-----SSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSD-NVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPSFVKEPEPLEV-LPGKNVTFTSVIRGTPPFKVNW-FRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPAAFLKRLSDHSVEP----GKSIILESTYTGTLPISVTWKKD---GFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGR--DVCGALVSTLEPP--YFVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVS-IDVIAGESADFECHVTGAQPM-RITWSKDNKEIR--PGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKVAKQGESIQLECKISG--SPEIKVSWFRNDSELHES-WKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVR-NSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVK----KLSDTSTLIGDAVELRAIVEGFQPISVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLEPARIIEKPEPMTVTTGNP---FALECVVTGTPELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSF--IRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPSF-EQTPDSVE-VLPGMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAG--SASCTTHLFVKEPATFVKRLADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPPYFIEP----LEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKARKLPPFFARK--LKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLL-------KDDANLQTSFV--HNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPV--SVDLALGESGTFKCHVTGTA--PIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGVQEPPRFIKKLEPSRI-VKQDEFTRYECKIGGSPEIKVLWYKDETEI-QESSKF-RMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKK---PHPIETLKGADVHLECELQG---TPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLS----DISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIVEKPESIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGN-EISSG--RKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQ--KPDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFD-VDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNG--INVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQIL-ILEPPYFVKQLEPVKVSVGDS--ASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAISGSEPISVSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSARLILTEGKNPPFFDIRLAPVDAVVGESADFECHVTGTQPIKVSWAKDSREIRSGGKYQ-ISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGK 8233          

HSP 7 Score: 516.538 bits (1329), Expect = 2.236e-145
Identity = 662/2740 (24.16%), Postives = 1098/2740 (40.07%), Query Frame = 1
Query: 1447 GHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNVTLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKNASIEPFKDAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSK----LIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTL---PAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGN--IIINETIGTLDINRIEKNMKGQWVCVATNSAGSS--RKSFN-LDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRY---FINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQES----VQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCL--VVESKPPAVISWLKNGKEIEYSNRIM----AKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATN----DHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGR---VEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKM-VGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTP---NKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGST--LTLFEVKHLDSGIYKCLAINIG--ESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEI--TNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLK----------GSTTNLWCNVSGFPTPQIRWTYME----TIXXXXXXXXXXQLHFMNVDKSHITR---YTCIATNEAGSARKLFDPVLTYPPKIV-SLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGT--QLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRR---VLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTL--DPGG--KRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEI-----FMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEP-KVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGTR--ITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILA-DKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPV-ILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFY-KDMPISPYDMMNFVISNNAKVLTIPSVN-KEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGI-------FRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIIS----PPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQG---LIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKN---YYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVE----LLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLG-NRFRFNSENEINIYDLKPEDTGNYIC-IGERSGAEASTASTYLSIFTRPKFVYKPK-LKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLN---------SNGRGSITLQSVRSENAGEYKCIAKNRVG--SVEYSFMLEVIAKPRVRVYQSDDPSESIKRTI-LMCKVEGKVD-SIVWLKNGVIVQNSSRLYI----NDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSP---PVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIK--YDFVKSLIKNG-SLRIIGVQKEHSGVYFCVASSNQGE 9282
            G   +++C ++      + W+KN+ ++  + T  + F   S   L+I        G Y+ E V  +       G+      + +  PP  +   + A I    +A L+C V S +    + WFK   + +++++K++R+         FS K    L I S + +D GEY CV  +E G     G + TH L   P       ++  +   ++T       + P + +W + G+E+   D +I +      + + I +V+    G+  C A+N AG      +L      KI+      ++   GD  T+  +  G P+ K  W  +G P+       I     +  L     E +  GQ+    +N  GSS    +F  LD    P     + N+D        + C++ G  P RV W +         IA  DRY   F+    SL I  + M D   + C A N  G    S    VQ   S +  P      SK V+  S      VCL    +   P  I W K  KE+           A +++L +  VK  D   YTC   N  G  +    L V+     +   +     K GD   L C+  G P  KI W    R +      R+      + L +  +  E +G + C A N    DH + +    V VK  P  +KE     E+  + +V L   + +G P  +I W+K+   L    GR     I      L++      + G Y+C+ TNEV S     ++T L  P +   K+    +  G        + G    T  W   S  +    N      + +    L ++ +  +  G Y C   N  G  + S  + + E   I +      V   +  TL    SG      KW FK          YK+ V +    L +        GEY+   +N+ G+    + + V    +D+  P    K +     I G  I   C++  + P  I+WFK++ +I  S   +++K S   +T  L + +++  DSG Y C A N       +  L V   P  + K  S+   ++N  T + +     G       W+KDN +L SG    +   +   +L +   + +D   Y C ++N+ G         +FV         +E P+F+K          G +T   C ++G P  ++ W Y++    T      +S    L    +  + +     Y C A N+AG+A    +  +  PP  +  L P +   ++K  ++ L C     P   + W K+   IR++ +  +T+R +   LH+     SD G Y+C+VSN+ G    +  V +  PPS  F  K       L  +        G P   I W KD   +D      +   D    L + S     +GRY C A+N  G       V+  Y   L  +P    ++   V+ T    + LEC+V+G P   + WLKDG  I     +      N     I ++   D+G+Y+   +N FG          +D  I  PPS  +     + ++  G  + + C  +GS   +  +FKDG  +           S K RL+  +    L + + +  D+  Y C  SN  G D     + V+ PP F    V+P +     + T   +  L G   PP KI W +  V L SG    I  +G+   + + +V     G+Y CH  N+V   S    + V   P+F K    +KI    +++ ++ C+  G P   ++W+R E E+ A DK R    D +   +V+Q+ N+  +D+  + C A N  G+     ++ V  PP  +  S  P    +K N +++  C +   + T P  ++W K+   +         + N   S+ ILN  + + G Y C+A+N  G D+    + +  PP+F +  +    ++TV  G     Q   EG+    + W   K+  I   + +      N   L          G + C  +N+ G    +  L V+ PA++      +    G + ++ C   G P+  ++W +DGK +       F +  K  S    L I   + +D G YT    N + + S +  VV +S    PP      K+    +G   +L C V G+ P  + W+      +S     +YQ         L ++ +     G Y CVA N AG  E R  L V   P   +  E E   VL         ++ G P   + W R    L K      Y+  T + L +FN + I   G  TC+  N AG+   T ++ V+     L ++S     + + G S+ +     G    +VTWKKDG ++      N         + I +    D G Y C I   +G +   A   +S    P FV + + L+  V ++   S +C+    P+  + W + G   ++KL          +N   ++    V   ++GEY C A+N +G  S +  F ++    P     Q  D  +++   + L C++ G     + W ++GV++++   L      N   L I Q     +G Y C ASN  G A     L  + P   P F + P +I    GE     C   G     I+W K+ K I+   ++  + + N   LRI+ V K  SG Y C A+++ G+
Sbjct: 3752 GESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYF-VNSEAILDITDVKVEDSGSYSCEAVNDV-------GSDSCSTEIVIKEPPSFIKTLEPADIVRGTNALLQCEV-SGTGPFEISWFKD--KKQIRSSKKYRL---------FSQKSLVCLEIFSFNSADVGEYECVVANEVG---KCGCMATHLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTW-MKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKEPAKIIERAELIQV-TAGDPATLEYTVAGTPELKPKWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVDSVVNGTCRLDCKIAGSLPMRVSWFKD-----GKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPSFVTKP-----GSKDVLPGSA-----VCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKEPATFVEKLEPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSI----VIVKESPYFTKE-FKPIEVLKEYDVMLLAEV-AGTPPFEITWFKDNTILRS--GRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVT-LREPPSFIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEITEDDNIRMTFENNV--ASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATITEEAVSIDVTQGDPATLQVKFSGTKEITAKW-FKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINV----LDLIIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISAS---EKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEKPQSQ---DVNPNTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVG--TATSKATLFV---------KEPPQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSW-YLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVE---VVKYSDVELECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPS--FIKKIENTTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESG-------VERCYAFLLVQEPAQIVEKAKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNI--PPSFTKKLTKMDKVL--GSSIHMECKVSGSLPISAQWFKDGKEI---------STSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPSF---LVKPGRQQAIPDSTVEFKAILKGT--PPFKIKWFKDDVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPKFVKKLEASKIVKAGDSS-RLECKIAGSPEIRVVWFRNEHELPASDKYRMTFIDSV---AVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPP--VFSSFPPIVETLK-NAEVSLECEL---SGTPPFEVVWYKDKRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFVSKLN----SLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIVEKAGPMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISS----LRILSVERQDAGTYTFQVQNNVGKSSCTA-VVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSG---AKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPSFVK--EPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELFN-IDISQSGEYTCVVSNNAGQASCTTRLFVKEPAAFLKRLS---DHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGA--LVSTLEPPYFVTELEPLEAAVGDS--VSLQCQVAGTPEITVSW-YKG---DTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGK 6351          

HSP 8 Score: 506.138 bits (1302), Expect = 3.389e-142
Identity = 618/2592 (23.84%), Postives = 1028/2592 (39.66%), Query Frame = 1
Query: 1741 IEPFKDA-----ELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGV--SEAVGFIKTHTLPAASVDE-KEISFIDNDSITASCRALSTPPPTFSWFLNGREL-DPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLE---GDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIINETIGT--LDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGS----YGENITIRCQVEGQPPPRVKWLRGIAG-----GYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNR--IMAK--DNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIII---GDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKG-GRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPL-VEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEV--SSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFK--KKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISL--DGSTLTLFEVKHLDSGIYKCLAIN-IGESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGG--RVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLK----------GSTTNLWCNVSGFPTPQIRWTYMETIXXXXXXXXXXQ-------LHFMNVDKSHITRYTCIATNEAGSARKLFDPVLT---YPP----KIVSLDPDKKRWILKDGEL-RLSCNSDAAPVATIEWFKDGELIR--NNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLF-CVSEGRPKPKIEWRKDGSRIDFR---RVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRT-----DSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRIS----PDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEV---FLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPV-ILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKE-GGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFR----YGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIIS---PPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGY--QEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPV-ITWERNGITLSKVKNYYTTTDSGLFIFNSLKIE--DEGSLTCIAKNVAGEDRLTFQITVE--LLPKV---SLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRF-NSENEINIYDLKPEDTGNYIC-IGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIE-----SKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRV-----------RVYQSDDPSESIK-----RTILMCKVEGK-VDSIVWLKNG-VIVQNSSRLYI----NDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAA 9120
            +EP + A      L+C V  T   + + W+K        +TK      Y+       + L+    + +D+GEY C AE+  G   S+ V  I+   LP +   + K+I       +T +CR   + P    W+ +G  L D  + + S V++V  + +KI       SG+  C A N  G      +L+     K    D+ K + ++   G+     C  TG    +ITW  +   +   GN  I     T  L I ++ K   GQ+ C ATN  G    S  L +   P+   FV  ++ S     GE+I + C++ G P  +V W R  +       YN+        FIN    L I   S ED   YIC+A N  G    S  + +    AP + FTQ    V       VI+   +   PP  + W+K+ K++  S +  I +K  D +L I  ++A D   Y C A N+VG+      +  +  P  +    D  T I    GD + L+   +G     + W K  G  +      RI    + + L + S    ++G + C   ND         ++V  P +I  E      + +     L C++T G P    +W+K+G+ L  +    +    +   LK+      + G Y  +  N V  S+ +    ++  + P +   K+  +    G  + L C++ G    +  W    +  ++   P   ++   +   L ++ +     GIYTC   NV GS + S  + + E P   Q  D   V    ++T T +  G P  K+KW FK  ++L+P  +    +     E  + E    +  G+YSCL  N+ G     + + V  P     T  K +    +  G  I        TPP  + W K+E  I +S   +R  I++    + L + E    D   Y CL  N  G+ +   LV ++ P    +        I E   L   C  +G P  R  WYK++++L S    +++  N   +L+I KV  SD   Y C   N  G              ++  I  R+ P F            G      C ++G    Q+ W Y + +      +  +        L  +  D+SHI +Y C A+N  G+A      +L+    PP    K VS+D       L  GE     C+        I W KD   IR   N ++ +      L +L   + D G Y C  SN  G D  +  + +  PP  +F  K    ++        + C   G P+ K+ W KD + I      R+   D    L +++    D+G Y C A N  G    S  ++V   P      K+ + +E   G  V LEC + G P   ++W KD   +     Y+         + I+ + A+D G Y C A N  G       + + APP   +   L++    VG E++L     G+   ++ +FKD    ++   S N   SY + +   Q  ++    + K T     D+G+ +C A+      V+E +  V  P     +         T  T +LECT+ G   P     W + G  L+S    +IS      G +I   NV   D+G Y    QN V K S   +++V    + P F +    T    +  ++V M C+  G PP ++ W+ +  EI + ++   +  +      + +  ++  D+  Y C ATN  G+ E    ++V  PP  +++   P+   V     +TF   V     T P  + W K +S ++ GD       ++   L + +  + +SG YTC   N AG+ S T  L + +P KF    + +    +++ G  +  +    G+P  S+ W    + ++P    N   +  + +L IPS   E  G + C   N  G      ++ ++ P         V+   G S S+ C   G P+  + W + G    R    Y     +    L        D+G Y C   N + + S S  + +     PP      + +   VG  V+  C + G+ P  + WY  G     S  +      +   L I +  +  +G Y C A N  G      R+ L     P  F         V+      +C +     QP+ ++W ++   +     Y  +          LK++  D G  TC A N  G+D  T Q+ ++  L+P      L  +V   EG+S  +  +V G    TV W K+   +Q        F N+   + +      D G Y C +   +G+   T+S  +    +P    +      V E  +    C         I+W+  GR I+     S   ++G   + L+ V   ++G+Y C A N  GS      + +  KP V           R++   +P +SI+         + KV G  + ++ W K     +    R++I    ++  L I      D+G+Y+C+A N  GE +  V+L V        + G++ A L +  IL   A
Sbjct: 6085 LEPLEAAVGDSVSLQCQVAGTP-EITVSWYKG-------DTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNV--ATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDI-KPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPK---FVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNM-------SFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVK---APPV-FTQKPSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLSDTSTLI----GDAVELRAIVEGFQPISVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLEPARII-EKPEPMTVTTGNPFALECVVT-GTPELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGN--EIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPSFEQTPDSVEVLPGMSLTFTSVIRGTPPFKVKW-FKGSRELVPGESCNISLEDFVTELELFE-VQPLESGDYSCLVTNDAGSASCTTHLFVKEP----ATFVKRLADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQS---ERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPPYFIEPLEHVEAVIGEPATL--QCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVG---------AVASSAVLVIKARKLPPFFARKLKDVHETLGFPVAFECRINGSEPLQVSW-YKDGVLLKDDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSVD-------LALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGVQEPP--RFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFR---KKPHPIETLKGADVHLECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKK--LSDISTVVGKEVQLQTTIEGAEPISVVWFKDKG--EIVRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFAT----LSVLEPATIVEKPESIKVT---------TGDTCTLECTVAGT--PELSTKWFKDGKELTSDNKYKISFFNKVSGLKII--NVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETN--GLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRKY--QTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQK---PDPMDVLTGTNVTFTSIVKG---TPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDY----SIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYK-GDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAISGSEPISVSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSARLILTEGKNPPFFDIRLAPVDAVVGESADFECHVTGT--QPIKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTKRLSETVEETEGNSFKLEGRVAGSQPITVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVIKEPKKPPVFDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKDKPAVAPATKKAAVDGRLFFVSEP-QSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDERKKQEKIEGDLRAMLKKTPILKKGA 8571          

HSP 9 Score: 436.032 bits (1120), Expect = 4.902e-121
Identity = 620/2665 (23.26%), Postives = 1051/2665 (39.44%), Query Frame = 1
Query: 1729 KNASIEPFKDAELECNVFSTSSNVVLKWF-KSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGE--LICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSAT----GVPQPKITWEFNGSPV--TIDGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNL-DIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQD---NSLIIKGLSMEDQSAYICDAQNQHGKVQ---ESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNR------IMAKDNTLVIKTVKAEDEAIYTCIA-KNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITE--EHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEG------------ISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRV------EIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITI------------------LVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSP-IDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILES--PKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKD--QKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDG--STLTLFEVKHLDSGIYKCLAINIG--ESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGG--RVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRW-TYMETIXXXXXXXXXXQ-----LHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGE-LRLSCNSDAAPVATIEWFKDGELIRNN--LRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRI---DFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQE--RQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRIS--PDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRV-KENMQITFHCSVYNYNMTKPV-ILWTKENSPILIGDTDYYLTF-NNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNK-EGGIFKCIARNEVGSI---MKVYKLEVIMP-----ALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFR---PTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIF--NSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLP---KVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLK-----PEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLN-----SNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPR--VRVYQSDDPSESIKRTILMCKVEGKVD-SIVWLKNGVIVQNSSRLYI----NDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKS---PPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLI---KNGSLRIIGVQKEHSGVYFCVASSNQGEVHSQPIYLTVQIP 9321
            K   +   ++A +   V  +   V +KWF KS+   E+K + + R+   +K       KL++ + S SD GEY  V     G  E    +   TL       K I   +  + +  C       P+  W  NG E++ ++ +  IV   +  Q+ I N   +DS E   +C      G D+V   L+   +  I+   + K+I  E ++ T+    T    G+      W  NG  +  T    +   +   +L+I  +       +  VA  +  ++        I F   IKD    I     +     C+V  +P   V+W++      +  + + DR  I ++   + L+I    M D   Y   A       +   E   +RI  I          K+V V    + V+   V E    A   W K+G EI +  +      +  + + + I   +  D   YT +A +N+     +   ++    P ++ + +  +  + G          G P+PKI W K  + L+   G +     DG + T+  I    E A  +TC A ND+        +SV+ P  +S +             + D      +     C ++  +   K+ WY   + +   P R       E   Q  I + Y ++E   G+Y   A+N V   S    +++                  + A      K+  +    G      C+I   P    +W +K+     + +   I +S  I   ++L TQ+     G YTC  +N  GS   +  + + E+  P  +        F+       C  +G P  +  W      + P+        EN+  L +        G YSC A N+ G D  Q   I+     +I    P ++       +   +   C ++      + W K   D  K  P   +KI  +   +TL +   K  DSG Y C A N     S + T+ V   P+ + K     ++   E   L+  C  +G+P  +  W+K+N +L      R+   N    L I  V+  D   Y C   N+ G D  + ++ +  PPS   I   E  + ++G+   L C VSG    +I W    + I S       SQ     L   + + + +  Y C+  NE G    +   +L  PP  V    D    I   G+ + L      +   ++ W K  E+IR +  ++++ +N    L + + Q S  G Y CL  N+ G   Q    ++++    K   +A   QV  G    L     G P+ K +W KDG  +      R+   ++   L   S    D+G+Y     N  G +       V          K    V+  V GT  L+C ++G     ++W KDG  I     YR   +  +  LEII +  +DAG ++C A N+ G  +    + +  PPS         ++ K G +  LP    GS     + F+    L +     NK+        +++E     L LY  K +DSG Y C  SN  G      ++ V+ P  F    +EP           L C + G   PP KITW  +   +      R+S       + + +V   D+GEY C AQNE         V V   P F K   +  IE ++   V +  E  G PP  + W++ +  IL    +Y  F I      +QI      DA  Y C  TN  G+      +++  PP  +K+     + R      Q T   S+       P+ + W K++  I   D +  +TF NN  SL +   +    G+Y C+AKN AG    + +L+V  P    T+ ++   +I V  G     Q    G+   +  WF     ++        +++   +L I S  K + G +    +N+VG      ++  L++I+P      L ++D I+     G+   + C   G     I+W +D + I    +Y       T  LEI+  +  D+G YTC+ TNK   +  S  + +  PP      +S  V    +V L  +V GT P  I W+       S      ++  +   L +   +   SG Y C  +ND G    + TL V   P+  +   P      G   T    +C+I  G P+  ++W  +G  ++ ++ +  +   GL  F  +  ++E+ G+  C A+N AG    + ++ V+  P   +   P+ V   + S V + C+V G P   VTW K+ + ++    +  ++   + +++++L      P DTG Y CI    G   S  ST +++   P F+ K +    V ++   +F+      P   I W+ + + ++   N      +   ++ ++SV + ++G Y C AKN  G VE  +   ++ +P   V   +S D +E    T L C V G  +  + WLK+G  +  S    +    N  +  I     +D+G Y     N  G +    +L V     PP FT     +   LG  + + C   G    +  W+K+ K I       L+   ++ SL +  ++ E +  Y C  S+  G+     I LTV+ P
Sbjct: 2800 KPKDVTALENATVAFEVSVSHDTVPVKWFHKSV---EIKPSDKHRLVSERKV-----HKLMLQNISPSDAGEYTAVV----GQLECKAKLFVETLHITKT-MKNIEVPETKTASFECEVSHFNVPSM-WLKNGVEIEMSE-KFKIVVQGKLHQLIIMNTSTEDSAEYTFVC------GNDQVSATLT---VTPIMITSMLKDINAE-EKDTITFEVTVNYEGI---SYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKD----IKVLEKKRAMFECEV-SEPDITVQWMKD-----DQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSI---------KKEVQVIEKQRAVVEFEVNEDDVDA--HWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLY---VNAPEPPQVLQELQP-VTVQSGKPARFCAVISGRPQPKISWYKEEQLLST--GFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDL--KVSWYSKDKKIK--PSRFFRMTQFEDTYQLEIAEAYPEDE---GTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQW-FKAGREIYESDKCSIRSSKYISSLEILRTQVVD--CGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRPKSLTTFVGKAAKFICTVTGTPVIETIWQKDGAALSPSPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHFIKELEPVQSA------INKKVHLECQVDEDRKVTVTWSK---DGQKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVREPPSFVKKVDPSYLMLPGESARLH--CKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSF--IKTLEPADIVRGTNALLQCEVSGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMATHLLKEPPTFVKKVDD---LIALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAG--SQTSVGELIVKEPAKIIERAELIQVTAGDPATLEYTVAGTPELKPKWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPS---------FVTKPGSKDVLP----GSAVCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKEPATF-VEKLEPSQLLKKGDATQLACKVTGT--PPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPYFTKE--FKPIEVLKEYDVMLLAEVAGTPPFEITWFK-DNTILRSGRKYKTF-IQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPPSFIKKIESTSSLRGGTAAFQATLKGSL-------PITVTWLKDSDEI-TEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATI-TEEAV---SIDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKMDSIK-----GSFIDLECIVAGSHPISIQWFKDDQEISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEKPQSQDVNPNTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKEPPQFIKKPSPVLVLRNGQSTT---FECQIT-GTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVEVV--KYSDVELECEVTGTPPFEVTWLKNNREIR----SSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCS-CSTRVALKEPPSFIKKIENTTTVLKSS-ATFQSTVAGSPPISITWLKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESG-VERCYAFLLVQEPAQIVEKAKSVDVTEKDPMT-LECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGI-LTVKEP 5329          

HSP 10 Score: 268.47 bits (685), Expect = 1.803e-70
Identity = 534/2468 (21.64%), Postives = 928/2468 (37.60%), Query Frame = 1
Query: 2335 EGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNII---INETIGTLDINRIEKNMKGQWVCVATNSAG-SSRKSFNLD-----IGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNS------LIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQ-VVVESTLKKVIVCLV----VESKPPAVISWLKNGKEIE----YSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAK--DGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCT------ATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVE--IAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIP-PNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKH---LDSGIYKCLAINIGESLNF---TLVVLISPT-ILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRW------TYMETIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGT--QLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPP-SIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFR-RVLLSDDGY--HLTVNSTMETDAGRYQCIAENTHGQTDI---SFDVQVTYGPTLDPGGKRYYKVERTV--GGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSK--QLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTP---------PEFDTSNVEPKVNWFTN--QTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRIS--PDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNV-----EVFLKPRFYKN---------QLYTKIEAVQ---NTTVQMSCECTGYPPPTLLWYRQEQEILADKE---RYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVI--IPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVI--LWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVN-KEGGIFKCIARNEVGSIMKVYKLEVIM-PALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRYGTKTD---SRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPK-IESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHS---GVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITL---SKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITV----ELLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSEN---EINIYDLKPEDTGNYIC-IGERSGAEASTASTYLSIFTR--PKFVYKPKLKNVVQETRWK-SFRCEATSHPKPDIKWMFNGRAIESKLN-----SNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGKVD-SIVWLKNGVIVQNSSRLYIN----DFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFT--LLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIK------YDFVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQGEVHSQPIYLTVQIP 9321
            +G     R    G P P+  W  NG  +     I      + +  L I  +        +  A N AG +S  +F L      I F   ++D V     +     T  C+   +P  +VKW +       + +  GD+Y ++ D        L I     ED S  + + +N    V+ + ++ + G     + F +  Q + V  +    + C+V    +E K      W  N  E++    Y+         L +K V  ED+  Y+ +   +  T K    L ++ +PI I   +   D K  +GD++ L+ +   +    + W K G+ +     + IVI      L +  +T+E AG ++ T      +T+   +V   + V V  P       + D  +       L C ++  + +  ++WY N +  ++   RV+  + G K  L +   +  + G Y+      V ++       I +     D    +      E    +  ID        W++K   +          +  I K  L +  M  + +G YT        S K++     +  P      D++V      +    +A  NP  K +WL   K +P  N +  +  G ++  LI+        GEY+          + ++ + V A  + +K   KN+T   +    +  F+  +       ++W KN + +  +   +++ IS+ G+  +L  +K+   +D  +Y      +G S      T+ ++  P  +    ++     ++   D     W   +     +   D  +L+S  +V        L+++ +  SD   Y   V  +     K F   + +  ++  I + ET       T +  C VS F  P + W        M      ++     QL  MN        YT +  N+  SA     P++     I S+  D            ++ N +     + +W K+G  I++  +  +  +     L++ N    D   Y  +        K   T  + +    I+F       +V L     +F      P   ++W KD   +    R+ +  + Y   L + ST  +DAG+Y  +A        +     DV++           R  K E  V      V+E  V+     A  W KDGI IN     R++ +   +  ++ I   + SDAG Y+ VA      + ++++     PP + +   L    ++ G   R     +G P P I+++K+   L            +K + L   +   L L  A   D+ +Y C A N  G      S+ V  P         P +  + + P  +  T+  Q    +C + G      K++W      +      R++   D  ++ +      D G Y   A N V ++S   N+     E  L  R  +           +  KIE ++       + +CE    P     W++  +EI    +   R  K+      S ++I   Q  D   Y C A+N  G++     ++V    PP  + R   P++          F C+V       PVI  +W K+ + +            N   L + N    + G Y+C+A N  G D     L +   P F  +     E +   +   V+ +C  +     ++ W      + P         +    L IP    K+ G + C A NE GS      + V   P+ V+          G S  + C  +G P   + W ++ K +    T      +   IL+ITD K ED+G Y+C   N +  DS S ++VI  PP  I++ + + +VR G   LL C V GT PF I W+     QI S+   +Y+  S++ L+   +   +S   G Y CV  N+ G      T  +L +P  F     +   +    + +Q  +    P  V TW +    +    K+K  + +    + I   ++I   G  TC+A+N AG      ++ V    +++ +  L I VT   G   T+   V G P+    W KDG+ L  V   ++R + +N   ++  Y  +  D+G Y   I    G  +S+  T  ++  R    F  KP L+NV           C+        + W  +G+ I +          G  S+ +  V   +AG + C A N VGS + S  L V   P                  L    +G    +I W K    + +    YI     + +L +   K+ D+G Y C  SN AG  +   +L VK P  F   L P  +    G+   L C   G P   I+W+ N + IK        FV+S      LR+  V  E SG Y C A +  G  H   I +  + P
Sbjct: 2091 QGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMA---TFECET-SEPFVKVKWYKD-----GMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDEN----VKTTAKLIVEGAV---VEFVKELQDIEVPESYSGELECIVSPENIEGK------WYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCK----LKMKPRPIAI--LQGLSDQKVCEGDIVQLEVKVSLESVEGV-WMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSV---YSVDVITP-------LKDVNVIEGTKAVLECKVSVPDVT-SVKWYLNDE-QIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKL-IVGRVETNCNLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVL------WNFKDKEIKPSSKYKIEAHGKIYK--LTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAISKP----LTDQTVAESQEAVFECEVA--NPDSKGEWLRDGKHLPLTNNIRSESDG-HKRRLIIAATKLDDIGEYTYKV----ATSKTSAKLKVEA--VKIKKTLKNLT---VTETQDAVFTVELTHPNVKGVQWIKNGVVLESN---EKYAISVKGTIYSL-RIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVE---IKPSDKHRLVSERKVH------KLMLQNISPSDAGEYTA-VVGQLECKAKLFVETLHITKTMKNIEVPET------KTASFECEVSHFNVPSM-WLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVTPIM-----ITSMLKDINAEEKDTITFEVTVNYEG---ISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAG------KATSTATLYVEARHIEFRKHIKDIKV-LEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRI-----------RSIKKEVQVIEKQRAVVEFEVNEDDVDA-HWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAP--EPPQVLQE--LQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLL---------STGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTD---LKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKY-----ISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSR---PKSLTTFVGKAAKFICTVTG----TPVIETIWQKDGAALSPSPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHFIKEL----EPVQSAINKKVHLECQVDEDRKVTVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVREPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEPADIVR-GTNALLQCEVSGTGPFEISWFK-DKKQIRSS--KKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMAT-HLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISV-TWMKGQEVIREDGKIKMSF-SNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKEPAKIIERAEL-IQVTA--GDPATLEYTVAGTPELKPKWYKDGRPL--VASKKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVG--SSSCETTFTVLDRDIAPFFTKP-LRNVDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKEPATFVEKLEPSQLLKK-GDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVES---TAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESP 4393          

HSP 11 Score: 241.891 bits (616), Expect = 2.009e-62
Identity = 513/2379 (21.56%), Postives = 910/2379 (38.25%), Query Frame = 1
Query: 2566 GPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDR--YFINQDN--SLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAV-ISWLKNGKEIE-------YSNRIMAKDNTLVIKTVKAEDEAIYTCIA---KNQVGTAKFDIE----------LDVQTKPIIIGDFKTFIDAK--DGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIA--GQKNILKVYGKNEDETGSYECK-ATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPID--KNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVI-ILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQ-ETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLP-KDRFKISLDGST--LTLFEVKHLDSG--IYKCLAINIGESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGK--TLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMET------IXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLD-PDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGT--QLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVD---IMIPPSIK-FNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRI---DFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVL-------ECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFM---DVTIGAPPS----IDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTP-PEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGTRITVENVKQY--DAGEYKCHAQNE--VSKISLVFNVEV--FLKPR----FYKNQLYTKIEAV---QNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKI----------MKRSLGPENHRVKENMQIT------FHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVN-KEGGIFKCIARNEVGSIMKVYKLEVI-MPALVRLDKIE-VRERSGTSFSVLCTAEGYPKPVIKWTRDGKGI---FRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPK-IESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGL-----FIFNSLKIEDEGSLTCIAKNVAGE-DRLTFQITVE---LLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRF-NSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDI--KWMFNGRAIESKLN-----SNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTI-----LMCKVEGKVD-SIVWLKNGVIVQNSSRLYI----NDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYK-NKKLIKYD--FVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQGEVH 9288
             P+I + + +     G +   R +V G+P P  +W +       + I   DR  ++  +DN   L+I+ ++ ED ++ +  A N  G+      + +   A   I FTQ  Q VV +  K  +     E+  P V + W K+G E+        +S+R +   + L I T  AED   Y+C+    +N   TAK  +E           D++      G+ +  +  +  +G       + K + K  I  R+G +                  LTV  +T+E  G ++              K+ +K  P    +G+SD ++   + V+L   ++    S +  W K+GQ  V+   RV I    Q ++L +    +++ G+Y        +S+  R    ++ V     D  +I     EG K  L CK+      + KW     + D Q  P     + +   K  L+I +  +  +G Y      V  +  +S + I I+   + +   +   V  +  ++ + I        + W FK K I P++  YK+    +   L V        G+Y+  A    G++  +  +TV    I     +K +T   +       F C + + P ++ +W ++     K LP  +  +   DG    L +   K  D G   YK         L    V +       K + K+ + + E  D   T            W K+   L S  +  I+  G   +L IK     D+SVY   +       + + +       ++  I   +    L+ +T     +VS    P ++W +          +  +      +L   N+  S    YT +       A KLF   L     + +++ P+ K            C      V ++ W K+G  I  + +  I  +G   QL ++N    D   Y  +  N    D+ + T+    IMI   +K  N++          +   F V+        +W K+G  I   D  ++      + L + +    DA  Y  +A        +  +              R+ +  + +    VL       EC VS  P   + W+KD   +      + +      +L I + + SDAG+Y+ VA       ++F+   DV I +       I++ R + E+ +   D              +  ++KDG  +       N     + + +V +    + +   +++D+G Y   A    G +    ++ V  P P      ++P         R   C ++    P  KI+W +    LS+G   +   DG   T+  ++ +  DA  Y C A+N+  V+  S   +VEV   + P      Y   + T ++     +    +  C  +G     + WY ++++I     R+ +         ++I    P+D  TY   A+N  G +     +S+  P  I          M+    P   R  E +++       F C + +    +    W K    I   D     +     SL IL  +  + G YTC+A N  G  S T  LTVT    +P  F    +++T  +G +  F C   G+P    +W      +SP        + N  +L + ++  ++ G++ C A N+ G+ +   +L +I  P  ++  ++E V+        + C  +   K  + W++DG+ +     Y    + +   LEI  AK +D+G Y CT +N+    S S  V +  PP  ++    S ++  GE   L C ++G+   ++ W+        S  +  Y   SE  L I  V+ + SG Y C A ND G       + V+ +P  F  T      V  T   +QC++  G     I+W ++   +   K Y   +   L     F FNS    D G   C+  N  G+   +   +  E    + KV   I++    G +VT+   V G    +VTW K  + ++     +  F N    + I D++    G Y C+ E   A + T+   L +    K + + +L   +Q T       E T    P++  KW  +GR + +         N    +   S    ++G+Y     N VGS        V+ +     +    P  ++   +     L CK+ G +   + W K+G  +  S R  I       +L I +    D G + C A+NS G       L+V+ PP F   PG+     G  + L    +G    TI W+K NK+L+     ++       SL +  V+   SG Y C  S+  G V 
Sbjct: 2077 APKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKN-----GVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQ--AKQLITFTQELQDVV-AKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAED---YSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQ-----------------NLTVKDVTKEDQGEYSFVIDGKKTTC----KLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLE--SVEGVWMKDGQE-VQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVI-----EGTKAVLECKVSVPDVTSVKW----YLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGI-------DVLWNFKDKEIKPSS-KYKIEAHGKIYKLTVLNMMKDDEGKYTFYA----GENMTSGKLTVAGGAI-----SKPLTDQTVAESQEAVFECEV-ANPDSKGEWLRDG----KHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSAKLKVEAVKI-------KKTLKN-LTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVE-------TVKIIKKPKDVTALENATVAFEVSVSHDTVP-VKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKA-KLFVETLHITKTMKNIEVPETKT-------ASFECEVSHFNVPSM-WLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGN----DQVSATLTVTPIMITSMLKDINAEE--------KDTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEA-------------RHIEFRKHIKDIKVLEKKRAMFECEVSE-PDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDV-------------DAHWYKDGIEI-------NFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVA----GRNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARF--CAVIS-GRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGT-DLKVSWYSKDKKI--KPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVR--FQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTE--AYPPTFLSRPKSLTTFVGKAAKFICTVTGTPVIETIWQKDGAALSPSPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHFIK--ELEPVQSAINKKVHLECQVDEDRKVTVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVREPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEI-VIKEPPSFIKTLEPADIVRGTNALLQCEV-SGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSA---DVGEYECVVANEVGKCGCMATHLLKEPPTFVKKVDDLIALG---GQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENE-AGSQTSVGELIVKEPAKIIERAEL---IQVTAGDPATLEYTVAGTPELKPKWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTK--PLRNVDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVE 4288          

HSP 12 Score: 236.498 bits (602), Expect = 8.885e-61
Identity = 513/2324 (22.07%), Postives = 854/2324 (36.75%), Query Frame = 1
Query: 2851 IAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRIM---AKDNT--LVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIII--GDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIA---GQKNILKVYGKNEDETGSYEC-----KATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKND--LLITQMRSELQGIY--TCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNT-ITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPI-IVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSL------PKDRFKISLDGS--TLTLFEVKHLDSGIYKCLAINIGESLNFTLVVLISPTILGKHSSKSVIN--INEETDLYITCWSEGNPAPRYLWYKDNSQ--LISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNL-WCNVSGFPTPQIRWTYMETIXXXXXXXXXX------QLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIR--NNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFR---RVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVS--GIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYI--IKVGDELR--LPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAI--------GYDVMEYSV--------RVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQ------MSCECTGYPPPTLLWYRQEQ--------EILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGP----------ENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETI---------------------TVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVN-KEGGIFKCIARNEVGSIMKVYKL---EVIMPALVRLDKIEVRERSGTSF-----SVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQG---LIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSK---VKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLP---KVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENE---INIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKP-DIKWMFNGRAIES----KLN-SNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGKVDSI------------VWLKNGVIVQNSSRLYI----NDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKS---PPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLI------KYDFVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQGEVHSQPIYLTVQIP 9321
            + APKI      Q V + +     V +V   KP     W KNG +IE S+RI     +DN   LVI+ V AED A     A N  G       L VQ K +I    + +  +  +   +   +C+T  +P  K++W K G  +      R+        L++ +I    A  ++C    D         +   A  +  KE + D E+    + EL CI++  N   K  WY N   L +  G+  I    G++N L V    +++ G Y       K T ++    R     I +    SD K+      EG+ + L  K+      + +  W     ++Q  P    +  IDK    LLI  M  E  G Y  T     +  S ++S   + + +P       K V  I+ T   L C  S      +KW    + I P+     +V   ++ L++ R  +   G Y  +     G+ + N                 N++   I I+ G    +C        E++   + ID+  +       P  ++KI   G    LT+  +   D G Y   A   GE++    +     T+ G   SK + +  + E  +    C    NP  +  W +D     L +  R E     + L+I   +  D   Y   V       K   +  V +  ++  +++ ET + +   T  L   NV G     ++W     +         S       L   N      + Y         SAR   + V     KI+    D            +S + D  PV   +WF     I+  +  R+    +  +L L N   SD G Y  +V  +L    + +   + I  ++K          +    +  F V      P + W K+G  I+     ++++    + L + +T   D+  Y  +     G   +S  + VT  P +     +    E     T+  E  V+  GI   +  WLK+G+ I      + R    +  L I  +   DA  Y+ VA        ++++          R+    ++I  IKV ++ R    C  +  P+  + + KD   L + D    +   Y  RLL+          S + +D+G Y   A   +        G DV   S+        + R   EF+ +  +   +W+ +    +E               ERH   +      RI     R+ +   +Q DAGEY   A    S ++L  N            +    ++ +Q  TVQ           +G P P + WY++EQ        + L D + Y           + +    P+DA  Y C A N  G       +SV +P  +      P          ++    E     F C V   ++    + W  ++  I          F +   L I     ++ G YT  A N  GQ S T  L++ +P       SI  E I                      V LG    F C  + +P     WF     I   D  +   S     L I      + G + C A NE GS+     L   E   P  +       R +S T+F       +CT  G P     W +DG  +     +         ILE+++   +D G Y+C  +NK   D    +++II  P      + +   + ++V L C V+  R   + W   G          +Y+   E     L I   +   SG Y C A+N+AG      T+ V   P   +  +     +     ++ CK L+G P   +TW +N   LS+   V+ Y+  +++ L I + +K+ED GS +C A N  G D  + +I ++  P   K   P  +    G++  + C+V G     ++W KD + +++    ++R  S+     + I+     D G Y C+      +    +T+L +   P FV   K+ +++           A    +P  + WM     I      K++ SNG   + +  V+    G+Y C+A+N  GS   + + E+I K         +P++ I+R  L+    G   ++             W K+G  +  S +  I    N   L    A+  D+G Y    SN  G +  +    V      P FT    N+ + +     L C   G     +SW+K+ K I      +  FV+      SL II V    +G + C A+++ G   S    L VQ P
Sbjct: 2075 MEAPKIFERIQSQTVGQGSDAHFRVRVV--GKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECET-SEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKE-LQDIEVPESYSGELECIVSPENIEGK--WYHNDVEL-KSNGKYTITSRRGRQN-LTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPR----PIAILQGLSDQKVC-----EGDIVQLEVKVS---LESVEGVWMKDGQEVQ--PSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPL------KDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIV----GRVETNC----------------NLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYA---GENMTSGKL-----TVAGGAISKPLTDQTVAESQEAVFEC-EVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSAKLKVEA-VKIKKTLKNLTVTETQDAV--FTVELTHPNVKG-----VQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVETV-----KIIKKPKDVTALENATVAFEVSVSHDTVPV---KWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVV-GQLECKAKLFVETLHITKTMKNIEVPETKTASFECEVSHFNV------PSM-WLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVC----GNDQVSATLTVT--PIMITSMLKDINAEEK--DTITFEVTVNYEGI---SYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEA---------RHIEFRKHIKDIKVLEKKRAMFECEVS-EPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIP---------STRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKD---GIEINFQ---------VQERHKYVVER----RIH----RMFISETRQSDAGEYTFVAGRNRSSVTLYVNAP----------EPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEY----------TLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLK---VSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPE------SILHERIEQEIEMEMKAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLS------RPKSLTTFVGKAAKFICTVTGTPVIETIWQKDGAALSPSPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHFIKELEPVQSAINKKVHLECQVDEDRKVTVTWSKDGQKLPPGK---DYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVREPPSFVKKVDPSYLMLPGESARLHCK-LKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITD-VKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEPADIV--RGTNALLQCEVSGTGPFEISWFKDKKQIRS--SKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMATHL-LKEPPTFVK--KVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGS--QTSVGELIVK---------EPAKIIERAELIQVTAGDPATLEYTVAGTPELKPKWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEG---TASLEIIRVDMNDAGNFTCRATNSVGSKDSSGA-LIVQEP 4205          

HSP 13 Score: 132.88 bits (333), Expect = 1.855e-29
Identity = 320/1573 (20.34%), Postives = 610/1573 (38.78%), Query Frame = 1
Query: 2011 PAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSA---TGVPQPKI--TWEFNGSPVTI--DGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVT---NIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQD---NSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAF-TQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRIMAKD----NTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQ--LTVYSITEEHAGTFTCTATNDHAA---VVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPG-RVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITI--LVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFN---DKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQ-ETLIVERAASMHGGEYSCLAENEGGKDQKNSI-VTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHL--DSGIYKCLAINIGESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKT--LLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVS--GFPTPQIRWTY----METIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGT--QLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDF-RRVLLSDDGYH--LTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTV------VLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKD-----ASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKN 6558
            P  +V   + + ++ D IT  C      P    WF +G E+ P+ P+ SI  D     +KI     +D GE +C          V ++   I + K          PL G +  V  +A     + +P +   W+  G P+T   D  II +     L ++  +  M G+     +  A +++ + NL +   P I  F+T   ++     +     C+V  +P    +WL+G        I   DR+ + +D   +S++IK  + ED++ Y+ +A+++H     S ++ I GI   ++ F T  K V  +   K+  V  V  S     + W KN + +  +  +  +D    +++  K +  +D +     A      AK  +   ++  P   G  + +    + D ++LQC+      P ++W K G+   ++P    VI  DG +  L +    +   G +TC    D  +    +++ ++ +  P       +   E+   E       I+  +      W   G+ L++ P   ++  G+ + L ++    D+TG  + +A N  SS     +  +  L+ P      +  +    GE  T +C++     P + W  K   L+        +   +  + L +  ++ E  G       +     K   ++ + E P  ++F    +   V    T  L C  S     K+KW FK       +  Y++V + +   L++          Y+C A     KD K S  + V  P+++   P  ++      +     F C + S   A++KWFK+  +I K     ++ I   G+   L   K L  D   Y C       S    L VL    +  K+ +   I ++E   + + C     P    +WYK + ++I  GR EI   G+   L+I+     D   Y C + +   + K    V+     +   IS  +  E L+G      C++S   FP   ++W      +E+ +   ++++  +   +  D +     T +     G+AR      LT   K+  + P K   + +  E+  +C  +    A  +WF++ E I ++ +  I  +     L + +A   D   Y   ++N  G + ++    I+    ++        +     ++  +C    R    ++W K+G  + F  RV    D Y   LT+      D G Y   A    GQ     ++ +   PT          VE     TV      V  C +S      + W ++G  I     Y++   G+  +L I   +  D   Y+C  ++   +  +F++                E  +++   +R P     +P  ++ F  + N  D  ++   ++        K +++   +   L +   K  D G Y+  A +      +E +      P+  T++     +   +  + L   +   A P A+  W +   PLS+  +I  + + T   +   K+ D G YK   QN+  K     N++V   P   +N
Sbjct: 11663 PYFTVKLHDKTAVEKDEITLKCEVSKDVP--VKWFKDGEEIVPS-PKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEK----------PLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGE----VSFQAANAKSAANLKVKELPLI--FITPLSDVKVFEKDEAKFECEVSREPK-TFRWLKGTQE-----ITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHT----SGKLIIEGI---RLKFLTPLKDVTAKE--KESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMSSEAKLTV---LEGDPYFTGKLQDYTGV-EKDEVILQCEISKADAP-VKWFKDGK--EIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRP-------LHSVEVMETETARFETEISEDDIH--ANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRP------LKDVTVTAGETATFDCELSYEDIPVE-WYLKGKKLEPSDKVVPRSEGKV--HTLTLRDVKLEDAGEVQLTAKDF----KTHANLFVKEPP--VEFTKPLEDQTVEEGATAVLECEVSRE-NAKVKW-FKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDA-----KDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMA---RFECEL-SRENAKVKWFKDGAEIKKG---KKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTS--GMLTVLEEEAVFTKNLAN--IEVSETDTIKLVC-EVSKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGK--VKVHEL---AAEFISKPQNLEILEGEKAEFVCSISKESFP---VQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVM--VGAARAAAH--LTVIEKLRIVVPLKDTRVKEQQEVVFNCEVNTEG-AKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWC-KVNRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTA----GQDKSVAELLIIEAPT--------EFVEHLEDQTVTEFDDAVFSCQLSR-EKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKSRARLFVE----------------EIPVEI---IRPPQDILEAPGADVVFLAELNK-DKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAA----PKIKTAD----QDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLST-KTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRN 13095          

HSP 14 Score: 129.798 bits (325), Expect = 1.500e-28
Identity = 159/622 (25.56%), Postives = 250/622 (40.19%), Query Frame = 1
Query: 5425 LGGNLYLFCVSEGRPKPKIEWRKDGSR-IDFRRVLLSDDG--YHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLK--------DGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNS-LDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLY--QCNASNAIGY-DVMEYS--VRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGS-----------------IRISPDGTRITVENVKQYDAG-EY----KCH---AQNEVSKIS--LVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKI----MKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNP---KSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFP 7137
            LG    L C   GRP P I+W + G   I  R+  +S DG  + LTV +  + D G Y CIA N  G+ + S  + +   P   PG     K    VG T+ L  +  G P PA+TW          + I I     Y + ++ N         + + AG+Y     N FG ++  +DV I   P      I+ E ++K    +    PA+           DG S +  + +   +     +  LVS    + T      T++  Y  + +A N  G  D +E S  V +++P E   +  +P +   T  +    C           + W+    P S GG+                 I ++ +  R TV +VK    G EY    KC     ++E S+IS  +    +V ++   +K +L   +     +   + C+ TG+P P + WYRQ +EI+AD  +Y   +   G   + I ++  DDA  Y   ATN GG++     + V +P KI        +G  +    E + I    S        PVI W K     LI +  +Y         +++ P   +  ++G Y   AKN  G D  T  L V   P  P
Sbjct: 30546 LGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKN-------VQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPAD-----------DGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAVTKDS----CV----------VAWKP---PASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRN-LNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFS----GKPDPVITWQKGQD--LIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPP 31125          

HSP 15 Score: 124.79 bits (312), Expect = 4.903e-27
Identity = 211/989 (21.33%), Postives = 391/989 (39.53%), Query Frame = 1
Query: 1741 IEPFK-----DAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTL---PAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGREL-DPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGI--DEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIIN--ETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDI-------GFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNI---PIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNR----IMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIG-------DFKTFIDAKDGDVIVLQCQTK-------GDPKPKIEWRKGGRPLTMEPGLRIVISPDG--SQLTVYSITEEHAGTFTCTATNDHAAV-----------VKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQ-ITILVAPKASDSKMIKIYTKEGEKLT----------LNCKIDGFPTPTKKWSWKSSILDLQ-RNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGST--LTLFEVKHLDSGIYKCLA 4503
            +EP K      A L+C +  T   + + W+K     +L+ T  +++ H++ +     + L+      +D+GEY+C AE+  G   A  F+        P+ S   +++       +   C    + P + SW+ +G+ L D  + + S +++   + + I       +G+  C A N  G      R+ L+    P    + LA    + G+     C  TG    K++W  +   +   G   I+  E    L + +++K   GQ+ C A N  G    +  L+I        F  R+ + V   +G+   +  +  +V G  P  V W +      NI   P +  +  F N    L ++   M D   Y C   N  G    +  I I     P + F Q    V  S  + V +   V+   P  I WLK G+EI+ S+R      +    L ++ V   D   Y C A N  G+     ++ ++ KP +         D + F  ++   + V++  T        GDP P ++W KG +   +  G R+ I   G  ++L +   T+  +G + C A N+H  +            K+ K+       + K  I     G +E +++  ++ + +P  + E Y     + +  G ++      +LK     E+ET   E +       D + F+ +   +  + S ++ + +  K+ E  T          ++ KI+    P  K SW      L+  + F I+    D++ L +   + + QG Y      V G    S  + ++E        D ++     T T+TC  S  P  K +W    +++ P       V      L +    +   G+Y+C  E+     + ++ + + A  I      +NI    +    + TF C + S   A + W+K   ++ +S    ++    DG    +T+  V   D G+Y  +A
Sbjct: 7967 LEPVKVSVGDSASLQCQLAGTP-EIGVSWYKG--DTKLRPTTTYKM-HFRNN----VATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAISGSEPISVSWYKDGKPLKDSPNVQTSFLDNT--ATLNIFKTDRSLAGQYSCTATNPIGSASSSARLILTEGKNPPFFDIRLAPVDAVVGESADFECHVTGTQPIKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTKRLSETVEETEGN---SFKLEGRVAGSQPITVAWYKN-----NIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVIKEPKKPPV-FDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKDKPAVAPATKKAAVDGRLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKG-KWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDERKKQEKIEGDLRAMLKKTPILKKGAGEEEEIDIMELLKNVDPK-EYEKYARMYGITDFRGLLQAF---ELLK--QSQEEETHRLEIEEIERSERDEKEFEELVSFIQQRLSQTEPVTL-IKDIENQTVLKDNDAVFEIDIKIN---YPEIKLSWYKGTEKLEPSDKFEISIDG-DRHTLRVKNCQLKDQGNYRL----VCGPHIASAKLTVIEPAWERHLQDVTLKE-GQTCTMTCQFS-VPNVKSEWFRNGRILKPQGRHKTEVEHKVHKLTIADVRAEDQGQYTCKYEDL----ETSAELRIEAEPIQFTKRIQNIV---VSEHQSATFECEV-SFDDAIVTWYKGPTELTES---QKYNFRNDGRCHYMTIHNVTPDDEGVYSVIA 8907          

HSP 16 Score: 100.523 bits (249), Expect = 9.598e-20
Identity = 193/937 (20.60%), Postives = 328/937 (35.01%), Query Frame = 1
Query: 6670 LADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIP------PKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPV--ILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDF--------------SIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGI---FRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNK----------ISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSK---VKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQ------------------------------ITVELLPKVSLPIS-----VTGDEGSSVT------IICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENE---INIYDLKPEDTGNYICIGERSGAEASTA----------STYLSIFTRPKFVYKPKLKNVVQET-RWKSFRCE------ATSHPKPDIKWMFNGRAIESKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGKVDSIVWLKNGVIVQNSSRLYI----NDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVK----SPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKN 9159
            L+  ER  +FDI      M+               A     T E+K+E+    P      P+I  R     +HRV       F  +V     +KP   + W      +      +Y   +   +L IL+  +D+SG Y     N  G+ S    L VT       D+              S+F E    +     +F+  +E   + S+      M  +   + ++  S +A++ +     K           E  S  +  K  +    L +   + V E     FS  C  +G P P + W R G+ +    R+   T       EI+  +  D G Y+    N             Q ++  +  + SPP+++SP+    V+  E V  P  V+   P      +P   + + T   ++  +S    I   ++ + S             +EI   L  +V+  + R  E                         +TW ++G  L +    + +Y+   +     N+L   D+G   C      G  +   Q                              +T +  PK   PIS     VTG + ++V+         K  G+P+PT  W KDG+++    G +++ + +     + I+     D+G Y C  + S    S++          +    + T+      P+ K VVQE    K+ R E      A S  K  +K   +   I  ++  +   S+    V  E       I K    S E     E+      + + +       +R +L   + G  D + W+ NGV + NS         +D  L I QA  +D GI  CI+    G  + Q  L +       P F   P + + N G+ ++  C   G P P I W+KN
Sbjct: 32328 LSRFERSARFDIFSRYESMK--------------AALKTQKTSERKYEVLSQQPFTLDHAPRITLRM---RSHRVPCGQNTRFILNV----QSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDVTG-----GDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHSASAEMKSAALEEKS---------LEEKSTTRKIKTTLAARILTKPRSMTVYEGESARFS--CDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEPR--VKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPKITQFLKAEAS-------------KEI-AKLTCVVESSVLRAKE-------------------------VTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQ--GGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEE-------ITKTSQASEEVRTHAEI------KAFSTQMSINEGQRLVLKANIAGATD-VKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKN 33170          

HSP 17 Score: 99.7525 bits (247), Expect = 1.533e-19
Identity = 246/1207 (20.38%), Postives = 432/1207 (35.79%), Query Frame = 1
Query: 5968 LNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASN---AIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGT--RITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTI-PSVNKEGGIFKCIARN-EVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCV--ANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKI-LEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFN--SLKIEDEGSLTCIAKNVAGED---RLTFQITVELLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSE---NEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIES--KLNSNGRGSI---TLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIK-----------RTILMCKVEGKVDSIVWLKNG-VIVQNSSRLYIND---FNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQGEVHSQPIYLTVQIPGGWSAWQEWSKCSLSCGKGFISRKRLCNNPPPSEFGMTCIGEDFEKRD 9465
            L +Y     DE+ L C  + +  P + +FKDG      ++ P+K+A  K       +++ML L  A ++D G Y C+      +   D+ +  +++  P           V     +T   E     +++      W+  G  L       I  +G    + + N +    G     A N  S   L     V    R  K+   T  E     T    CE + Y    + WY + +++    +  P+ +       + + +++ +DA     TA +     +    + V  PP    + L  E+  V+E       C V   N     + W K  + IL       +     + L I +   ++   YTC+AK+     +   V     PP    +F      + V+      F+C         + WF     I      + +     ++L I   +  +   + C  R      ++ V + E +      L  IEV E    +  ++C     P   + W +  + I    RY   T+ R  IL I +A  ED G Y C   +  S+    V V  ++   I  P+ ++ +  GE+    C +     F + W        S           ++ L++        G Y  +  A   A +  +   L ++V  K  R  E +   V N      C++  EG       W RN   +     Y       ++        ++D+ +      N  GE+        +  E L  V     +   E  SVT  CKV  +   T+ W K+G+ +     NR  +  +   + + I D    D G YI     +G + S A   L I   P    +      V E     F C+  S  K ++KW  NGR I+   K      GSI    ++  R ++  EY C  ++R              K R R++  + P E I+             + + ++      + WL+N  V+VQ      +++     L I   K +D G Y+ IA +    A+    L + + P       ++  ++G+ L +    + YP     W+K  + +    + +  +  S RI+  +K   G Y  V  +  G+         + +PG           +L   + F     L    P ++ G   IG   E+RD
Sbjct: 12024 LQDYTGVEKDEVILQCEISKADAP-VKWFKDGK-----EIKPSKNAVIK----ADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRPLH--------SVEVMETETARFETE---ISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGE-----TATFDCELS-YEDIPVEWYLKGKKLEPSDKVVPRSE--GKVHTLTLRDVKLEDAGEVQLTAKD----FKTHANLFVKEPPVEFTKPL--EDQTVEEGATAVLECEVSRENAK---VKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVV-----PPHV--EFLRPLTDLQVREKEMARFECEL-SRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLTVLEEEAVFTK--NLANIEVSETD--TIKLVCEV-SKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPS--SRTDGKVKVHELAAEFISKPQ-NLEILEGEKAEFVCSI-SKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIEKLRIVVPLKDTRVKEQQEV-VFN------CEVNTEGAKA---KWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKV-NRLNVTLKWTKNGEEVP--FDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVT---AGQDKSVAE--LLIIEAPTEFVEHLEDQTVTEFDDAVFSCQL-SREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDR--------------KSRARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAK----LELAAAPKIKTADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVR--------NLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRD 13130          

HSP 18 Score: 92.0485 bits (227), Expect = 3.634e-17
Identity = 404/1998 (20.22%), Postives = 728/1998 (36.44%), Query Frame = 1
Query: 1729 KNASIEPFKDAELECNVFSTSSNVVLKWFK---SIPRYELKNTKRFRIEH--YKKSPNAFSSKLIILSASESDNGEY---VCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEG----DQQTVRCSATGVPQPKITWEFNGSPVTIDG----NIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSY---GENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVES---TLKKVIVCLVVESKPPAVISWLKNGKEI----EYSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPK-IEWYKNGQPLVEIPG--RVEIA--GQKNILKVYGKNEDETGSYECKATNEVSSDS--------RFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKII--QFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEI---DIYKS--------LPKDRFKISLDGS--TLTLFEVKHLDSGIYKCLAINIGESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGK--TLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVP-PSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXXXXXXX------XXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVD-----IMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRK-DGSRIDFRRVLLSDDGYH--LTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQAS--DAGRYSCV--AKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVM--------EYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHG--VPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQ--ITNIQPDDADTYACTATNGGGTIE---KKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKEGGIFKCIARNEVGSIMKVYKLEVI-MPALVRLDKIEVRE 7449
            ++  ++P   A   C++   + N+  KWFK    IP      T+  R  +  Y K  NA     I   A E +   Y   + + E E  + + +  +  +   +AS D  EIS  D                   W L G  L P+ P   I  +  +  + +  VK   +GE++ +A N+       I  + +++ K + LD A  +PL+     +++  R       +  + W  +  P  I      +II +     L IN  + + +G +         S+R         G R+K F++ ++      GE  T  C++  +    V W +  A  +     L       + + L +K ++++D    I   + Q  ++  + Q+++   A P        +  VE    TLK    C V +  P   + W K+G+EI    +YS +       L IK    +D+  Y C      GT K    + V+ + I +      ++   G+    + +   +P    +W+  G+PLT  P   I+       L +++      G  +  A N  +A      + VK  P I    +SD ++  K+  +  C ++     PK   W K  Q   EI G  R E+   G K+ + +     ++   Y  +A ++ +S          +F      V  K  +S +  +          N ++  F    +  + +S  +  +     IT   +  +D   +Q+R E  G+           AK++    +LE       +  D + V  D  I L C  S    P +KW    K I P+          +  LI+++A     G+Y+C    + G D+ +  + +    I +  P  ++               VM +    E   F+ EI   DI+ +        L     +I  +G   +L L   +   +G     A N+  S +      + P ++G       + +         C       P   WY    +L    +V   + GK  TL ++ V+  D    Q        +D K    N+FV  P +      E     +G+T  L C VS     +++W    T                 +L   +     I  YTC A +   S       +   PP +  L P     + +    R  C   +   A ++WFKDG  I+   + +I ++G    L+        I KCL+ ++     +  T        ++     F       +V+    + L C    +P  ++ W K D   I+  R  +  +G    L + +    DAG Y C   ++  +TD    V       +     +   +E   G      C +S    P + W +D   +      +Y +I + K+  ++   A+  D G Y  +  A      + +   + I  P        L +  +K   E+   C  N +      +F+  N   +FD       S K  +L       L +  A   D   Y  + +N  G +V         E  +R+  P + D   +E K   F  +   L  TL           W ++G  VP  +  S R+      +T+++    D GEY   A  + S   L+    +   P  +   L  +     +  V  SC+ +      + WYR  +EI   K    K+   +  S+ +  I + + DD   YAC   +         ++  + +I PP+ +  + G +         + F   +   N  K  + W + N  ++ GD    ++      L I + K  + G Y   AK+   +      L + + PK  T      + + V +G  +    P +  P     WF ++ P+S   +       + ++L     +K  G +K + +N+ G       L+VI +P  VR   +EV E
Sbjct: 11313 RDQHVKPKGTAIFACDIAKDTPNI--KWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPED-IAEYAVEIEGKRYPAKLTLGEREVELLKPIEDVTIYEKESASFD-AEISEADIPG---------------QWKLKGELLRPS-PTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNA-------ITTAILTV-KEIELDFA--VPLKDVTVPERRQARFECVLTREANVIW--SKGPDIIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAEVEGKKTSARLFVT-----GIRLK-FMSPLEDQTVKEGETATFVCELSHEKM-HVVWFKNDAKLHTSRTVLISSE--GKTHKLEMKEVTLDD----ISQIKAQVKELSSTAQLKVLE-ADPYFTVKLHDKTAVEKDEITLK----CEVSKDVP---VKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVC----DCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHFEIEL-SEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAA----NLKVKELPLIFITPLSDVKVFEKDEAKFECEVSR---EPKTFRWLKGTQ---EITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLKFLTPLKDVTAKEKESAVFTVELSHD-----NIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDD--TSQIRVEAMGM--------SSEAKLT----VLEGDPYFTGKLQDYTGVEKDEVI-LQCEISKADAP-VKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTC----DCGTDKTSGKLDIEDREIKLVRPLHSVE--------------VMET----ETARFETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLR----VKPRVIGLLRPLKDVTVTAGETATFDCELSYEDIP-VEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQL-----TAKDFKTH-ANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSR-ENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCN-----LNVVPPHVEFLRPLTDLQVREKEMARFECEL-SRENAKVKWFKDGAEIKKGKKYDIISKGAVRILV--------INKCLLDDEAEYSCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVC-EVSKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSS--RTDGKVKVHELAAEFIS----KPQNLEILEGEKAEFVCSISKESFP-VQWKRDDKTLES--GDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIEKLRIVVP--------LKDTRVKEQQEVVFNCEVN-TEGAKAKWFR--NEEAIFD-------SSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLK-DIETMEKKSVTFWCKVNRLNVTL----------KWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELL----IIEAPTEFVEHLEDQTVTEFDDAV-FSCQLS-REKANVKWYRNGREIKEGK----KYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGAD---------VVF---LAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAK----LELAAAPKIKT----ADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKTIDTTAEQTSFRILEAKKGDK--GRYKIVLQNKHGKAEGFINLKVIDVPGPVR--NLEVTE 13100          

HSP 19 Score: 90.1225 bits (222), Expect = 1.396e-16
Identity = 147/596 (24.66%), Postives = 230/596 (38.59%), Query Frame = 1
Query: 3304 QLTVYSITEEHAGTFTCTATND-------HAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPG-RVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMI--KIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSV--VFIDNTITLTCIASGNPTPKI--KWLFKKKLIPPNAVGYKM-VGENQETLIVERAASMHGGEYSCLAENEG--------------GKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFK-NEIDIYKSLPKDRFKISLDGSTL--TLFEVKHLDSGI-----YKCLAINIGESLNFTLVVLISPT----ILGKHSSKSVININ--EETDLYITCWSEGNPAPRYLWYKDNSQLISGG---RVEITNGG-KTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRE---TPEFLKGSTTNLWCNVSGFPTPQIRW 4941
            Q T+  + E     F   A N+         A+  + K++    P I KE + D      E  +L+C I  G P P I+WY+ G+ L++    ++   G+ + L V  + +++ G Y C ATNEV       ++ +   P+      +  K Y   G  L L+    G P P   W     +L    N   I N+    + ++    R    G Y    +NV G+     DV I + P      DK    + I+  +  + + S  P       W+        N V  K    E  E  +V  A S+       L EN G                 + +S+V + +P+     P K     P I       SCV+   PPA     K     + K   K    IS+    +  T+F VK+L  G+      KC  +  GES    +   I+P     I   H  + + N+N   +++  + C   G+P P   WY+   ++I+ G   R++   GG   L+I  V   D +VYQ   TN+ G       + V VP  I+     E       L+G   ++    SG P P I W
Sbjct: 30489 QFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIRKE-MKDVTTKLGEAAQLSCQIV-GRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSEN-ITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKP------DKPTGPIVIEALLKNSAVISWKPPADDGGSWIT-------NYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGK-----PTITAVT-KDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLG-GESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITW 31061          

HSP 20 Score: 88.5817 bits (218), Expect = 4.353e-16
Identity = 272/1239 (21.95%), Postives = 465/1239 (37.53%), Query Frame = 1
Query: 5704 VGGTVVLECLVSGIPTPAIT-WLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVA--------DPPAKITWER--HGVPLSSGGSIRISPDGTR--ITVENVKQYDAGEYKCHAQNEV--SKISLVFNVEVFLKP----RFYKNQLYTKIEAVQNTTVQMSCECTG---YPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGT---IEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQS--LTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKV--LTIPSVNKEGGIFKCIAR-NEVGSIMKVYKLEVIMPALVRL-DKIEVRERSGTSFSVLC-TAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCT-GTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRP-FRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQP-VITWERNGITLSKVKNYYTTTD--SGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQ-ITVELLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSE-NEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFT-RPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLNS-----NGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGKVDSIV--WLKNGVIVQNSSRLYIND----FNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLP-GNISANLGEVLILPCAAEGYPIPTISWY-KNKKLIKYDFV--KSLIKNGSLRIIGVQKEHSG 9246
            VG + + ECLVS  P+ AIT W+KDG  I   P +R+   G  ++L II +Q SDAG Y+CV +    +      + +   P      +  E  +  G  L L C  N     ++ + KDG    +    P +       L+     + LT+  A  TD+G Y     NA   + +E S  V+         VE   +W     R       G A        D P  I W +    +P        I  DG    + ++N    D  EY    + +   +K++L       LKP      Y+ +  +    +    +    +  G    P PT        EI A+           G   + +  ++ D A      A N   T     K+ E+   +P K         +  V E  Q  F C +      +  ++W+K   P +I  +D +    +G+   L I + + D+ G YT E   + G+ +   +       KF +      E  TV+ G +  F C         ++WF  D  +  +     +IS+  K   L +  V  +  I +  A+  E+ S  ++  LE      V+L DK  V +      ++ C  ++  P   +KW +DG+ I    +Y  K D    IL+I  A  +D G Y C  GT+K ++ + +V+  +I   K+E P   + V VGE       +E + P     W   G    +S      +   +  LI+   +   +G     A N          L+V   P IF    ++         + +C++     +P    W +    ++    +    D      +  S   EDE      A++     +L  + I ++ L  +     VT  E  S     ++       V W K+ Q L        +   + + I   DL  +DT        R  A   ++   L++    P F  K +    V++      +CE +    P +KW  +G+ I+   N+       +  + L+     + G+Y C      G+ + S  L++  +  +++ +     E ++      + E   D I   W   G  +  +    I +     +L+++  +   TG     A+N    A    HL VK   +  L P  +++   GE     C      IP + WY K KKL   D V  +S  K  +L +  V+ E +G
Sbjct: 11132 VGSSAIFECLVS--PSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLYLSCELNK--ERDVVWRKDGK---IVVEKPGRIVPGVIGLM-----RALTINDADDTDAGTYTVTVENA---NNLECSSCVKV--------VEVIRDWLVKPIRDQHVKPKGTAIFACDIAKDTP-NIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRYPAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWKLKGELLRPSPTC-------EIKAEG----------GKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEIELDFAVPLK---------DVTVPERRQARFECVLTR----EANVIWSK--GPDIIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAE---VEGKKTSARLFVTGIRLKFMSPL----EDQTVKEGETATFVCELSHEKM-HVVWFKNDAKL--HTSRTVLISSEGKTHKLEMKEVTLD-DISQIKAQVKELSSTAQLKVLEADPYFTVKLHDKTAVEK---DEITLKCEVSKDVP---VKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDK-TKANVTVEARLI---KVEKPLYGVEVFVGETAHFE--IELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAA----NLKVKELPLIFITPLSDVKVFEKDEAKFECEVSR---EPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLKFLTPLK---DVTAKEKESAVFTVEL-SHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQI-----RVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDEV-ILQCEISKADAP-VKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTC----DCGTDKTSGKLDIEDR-EIKLVRPLHSVEVMETETARFETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSA----HLRVKPRVIGLLRPLKDVTVTAGETATFDCELSYEDIP-VEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAG 12263          

HSP 21 Score: 84.7297 bits (208), Expect = 5.128e-15
Identity = 148/625 (23.68%), Postives = 232/625 (37.12%), Query Frame = 1
Query: 7624 TGTNKISQDSKSVDVVIIS--PPKIESPKKSIMVRVGEQVLLPCIVEGTRPF-RIHWYTPGNNQISSTILGEYQFLSE---QGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIF--RPTETETTGVLNTVLQMQCKILEGIPQPVITW--------ERNGITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGE-------------DRLTFQITVELLPKVSLPIS---VTGDEGSSVTIICKVEGKPKPTVTWKKDGQS----------LQNVLGNRFRFNSENEINIYDLKPEDTGNYICIG---ERSGA------EASTASTYLSIFTRPKFVYKPKLKNVVQETR------WKSFRCEATSHPKPDIKWMFNGRAIESKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGKVDSIV-WLKNGV-IVQNSSRLYINDF-----NLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLP-----GNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNGSLRII----GVQKEHSGVYFCVASSNQG 9279
            TG ++  + + S+   + S   P I    K +  ++GE   L C + G RP   I WY  G   I S    +Y+  S+     L +    ++  GVY C+A N+ G  E    L +   P+     P + +  G + + L++    + G P P +TW            IT+   ++Y     + L + N  +    G       NV G              D+ T  I +E L K S  IS      D GS +T     + + K    W+    +          L    G  FR +++N   I D  P +  + + I    E+ GA       A T  + +  +  P      K++N   E R      W S   E        +K +  G   E ++     G  +  S  SE       I       ++     E +    VR YQS+          L+CKV G    IV W + G  I+ +  +  I +F      LII      D  +YQ  A+N  G   G   L V+ P    L       G + A  GEV+ +     G P P I+W K + LI  +    +I   S   +    GV+++ +G Y   A +  G
Sbjct: 30511 TGLSRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVG-RPLPDIKWYRFGKELIQSR---KYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYI-GRPVPAMTWFHGQKLLQNSENITIENTEHY-----THLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISD--PLEVSSVVIIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEP------ITPKSDVPIQAPHFKEELRNLNVR-YQSN--------ATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFG 31108          

HSP 22 Score: 81.6481 bits (200), Expect = 5.197e-14
Identity = 192/985 (19.49%), Postives = 355/985 (36.04%), Query Frame = 1
Query: 2107 SWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDE------VRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIINETI--GTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIA-FTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRIM---AKDNT--LVIKTVKAEDEAIYTCIAKNQVGTAKFDIEL----------------------------------------DVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDS----KMIKIYT-----KEGEKLTLNCKIDGFPTPTKKWSWKS-SILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIIL----ESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNI---TYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAINIGESLNFTLVVLISPTILGK----HSSKSVININEETDLYITCWSEGNPAPRYLW----YKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNV 4824
            S F    E++ +     + + + E++  +S+ +   S E+   A     ++E      ++  L+   L K  S+ +      EG+     C   G P P +TW   G  ++      +  T    T +I+ ++ + +G +  V  NS G     F L I      +  VT+                   PPRVK           P A+     +        K +S  +      + + QH  V           A PKI  F +++     + L  V+   V+ +K    ++W K+GK+++ +       + D T  L I  +   D+  Y C    + GT+K +++                                          + +KP+I+   +    + D  V     +  G+P+P   W K G+ +T     ++     G  L ++      +G +TCT  N   +V    K+++KA        I D E       + + I        + E  +      EI  ++  A  +  L +  +      S E K +   S +       I    +AS+       IK ++      EG++L L   I G      KW      + + +   +G++ S      L I Q     +GI TC      G  K  YD+ +     ++P  I       +     +  TC  SG P+P+I+W      I  ++        N  +L +  A+    G+Y+  A+N  G+    + + V  P ++   P++ +   T     + G+ +   V  S    E  +         S+ + +F      S  ++ E   ++      + I+    L  +   ++   I G      +  S I+I+E   L + C   G P P   W     K +SQ      +E T+   TL+I  V++ D  +Y   + NE G D    ++++
Sbjct: 32497 SSFKKTSEMEASSSVREVKSQMTETRESLSSYEHSASAEMKSAALEEKSLEEKSTTRKIKTTLAARILTKPRSMTV-----YEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTS-------------------PPRVK---SPEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTE-KVQHLPVS----------APPKITQFLKAEASKEIAKLTCVVESSVLRAKE---VTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDS-VAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKA--------IKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEI--KMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAG--ATDVKWVLNGVELTNSEEYRYGVSGS---DQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVL-PLVE--EPSREVVLRTSGDTSLQGSFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQE-SFVEMSSSSFMGISNMTQLESSTSKMLKAGIRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 33420          

HSP 23 Score: 78.5666 bits (192), Expect = 3.616e-13
Identity = 100/382 (26.18%), Postives = 159/382 (41.62%), Query Frame = 1
Query: 7609 GRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQ---VLLPCIVEG-TRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVR---KDHSGVYRCVANNDAG----YQEIRI-----------------------TLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITL---SKVKNYYTTTDSGLF--IFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVS----------LPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSEN----EINIYDLKPEDTGNYICIGERSGAEASTASTYLSI----FTRPKFVYKPKLKNVVQETRWKSFR 8583
             R +C G  + SQ   SV  V ++  +I      IM  VGE+   V   C +E   +  ++ WY  G  Q+ ++   +Y+   E G+ I  V+   K   G YRC   ND G    Y E+ +                       T+ +L +P  F       T  +   ++    I    P+P +TW ++G  +      K Y   +D GL+    NS+  +D+   T +A+N  GED    ++TV L P  +          L  +    EG SV    +V G P PT+ W+KDGQ L   LG       E      ++I D  PEDTG Y      + A +++   +L +    + + +F  K + +  VQ+   K+ R
Sbjct: 31541 ARISCGGAIR-SQKGVSVAKVKVASIEIGPVSGQIMHAVGEEGGHVKYVCKIENYDQSTQVTWYF-GVRQLENS--EKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVH-PEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLS--LGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNT-AGSTSCQAHLQVERLRYKKQEFKSKEEHERHVQKQIDKTLR 31914          

HSP 24 Score: 78.1814 bits (191), Expect = 5.679e-13
Identity = 53/182 (29.12%), Postives = 82/182 (45.05%), Query Frame = 1
Query: 5707 GGTVVLECLVSGIPTPAITWLKDG--IPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQ----MEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDG----NSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKR--TDSGLYQCNASNAIG 6216
            G T   E  +SG P P ++W +DG  I  + LP  +        +L I A+  +++GRYS  A N  GQ     E+ +      P  + R   L    ++ G ++RL     G P P + F++DG    +SLD                 +SQE  + +L  A+    DSG Y  NA+N++G
Sbjct:   20 GSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQR---LQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLD---------------FQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVG 183          

HSP 25 Score: 77.0258 bits (188), Expect = 1.205e-12
Identity = 139/605 (22.98%), Postives = 234/605 (38.68%), Query Frame = 1
Query: 3715 KMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKI---IQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAAS--MHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNK-NITYNPIIVGGNITFSCVMNSTPPAEI--KWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHL----DSGIYKCLA----INIGESLNFTLVVLI-----SPTILGKHSSKSVININEETDLYITCW----SEGNPAPR--YLWYKDNSQ--LISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKG------STTNLWCNVSGFPTPQIRWTYM--ETIXXXXXXXXX------XQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKI---VSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNN--LRVNITNRGTQLHLLNAQE-SDIGIYKCLVSNKLGLDKQAWTVDIMIPP 5382
            +M  + TK GE   L+C+I G P P  KW      L +Q   + ++ S    + L +     E +G+YTC  TN  G  + S  +++  +P+        +K    + +T+ L  +  G P P + W   +KL+  N+    +      T +V +      H G+Y         K Q +++       +D++  +K +    PI++   +  S V++  PPA+    W  N + + K   K+  +  L  S +++   + +    ++G Y  ++      I + L  + VV+I      P   GK +  +V       D  +  W    S+G    R  YL  ++  Q   IS    EI        +K +    +  ++    N  GE + +       P S   I      E L+       S   L C V+G P P ++W     E I   L            QL   +V     T Y   ATN+ GS        +  P KI    +L+       L+   + +       P   I W K  +LI NN   +V +T   T L   N  E  D G Y     N+ G+D++   +D+   P
Sbjct: 30538 EMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKEL-IQSRKYKMS-SDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLL-QNSENITIENTEHYTHLVMKNVQRKTHAGKY---------KVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYV-VEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAVTK-----DSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRE--TVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVP 31122          

HSP 26 Score: 75.0998 bits (183), Expect = 4.331e-12
Identity = 176/919 (19.15%), Postives = 325/919 (35.36%), Query Frame = 1
Query: 5161 RLSCNSDAAPVATIEWFKDGELIRNNLR--VNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLV--SGIPTPAITWLKDGIPINRLPSYRYRIIGN-SKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDR-----------NRILNEYIIKVGDELRLPCP---------------------------ANGSPNPNIAFFKDGNSLDM---FDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEP-KVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGS---IRISPDGTRITV-ENVKQYDAGEY-KCHAQNEVSKISLVFN-VEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVII----PPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSP----------------TPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNK-EGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF-----RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIIS 7680
            R SC++D  PV T+ W + G+++  + R  V  T   +   + + Q SD G Y  +V N  G  +  +T+ I          KA   + A+     +       P+P++   K    +   + + S +  H    S  ET     +                +V + P   P     +           L C+V  S +    +TW KDG  +     +++    + + +L+I  +  SD G Y C      G  +  +     A  SI             ++   E  +    E + P P                           A G P P   + KDG ++     + LS +K   +            L ++    +DSGLY C   N+ G       + ++   + +   V   K +  T Q +++      V +  ++       + +S   S   + +  + +++ + E VK+  A    K     E++K S     V    + + +  Q+   I   Q   ++ +          + W     E L + E Y ++ +   +  + I      D     C +    G ++ ++++++       P  + +   P +  + E   + F C +       P I W K N PI I          N  SL I N    +SG+YT +AKN  GQ S T  L V    + P+   + R +    L  S + Q     +                    + +             +FV  +++  + I ++ + E    K +     G   K+  L    P+ + +D+       G   +V C   G P P + W+  G+ I      R+  +       L I D +++D G YT +  N+   DS +V++ I S
Sbjct: 32579 RFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQ---------KARVTEKAVTSPPRV-----KSPEPRV---KSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTE----------------KVQHLPVSAPPKITQFLKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFF------------LEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITPQKKAV------VQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQM--SINEGQRLVLKANIAGAT----DVKWVLNGVE-LTNSEEY-RYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQ---PRSQNINEGQNVLFTCEISG--EPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSLQGSFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMTQLESSTSKMLKAGIRGIPPKIEAL----PSDISIDE-------GKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHIRS 33422          

HSP 27 Score: 73.1738 bits (178), Expect = 1.918e-11
Identity = 147/730 (20.14%), Postives = 263/730 (36.03%), Query Frame = 1
Query: 2947 PPAVISWLKNGKEIEYSNRIMAKDNT----LVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKP-------IIIGDFKT----FIDAKD----------------------------------GDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPD---GSQLTVYSIT-EEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVEL--NCIITSGNPSPKIEWYKNG-------------QPLVEIPGRVEIAGQKNILKVYGKNED-ETGSYECKATNEVSSDSRFFQITIL-------------------VAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPT--PKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGS-TLTLFEVKHLDSGIYKCLAINIGESLNFTLVVLISPTILGKHSSKSV-------ININEETDLYITCWSEGNPAPRYLWYKDNSQLISGG----RVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFV 4830
            P   ++W +   +IE S        +    L+I+   AED   +TC A N+ GT      L VQ           +   F T    F++++D                                  G  +V  CQ  G+PKP + W+K G PLT   G R  +S +   G    V S+T  + AG +T    N H            A   + +E  +DYE+  K   E+     +T+    PK+     G             Q L+    R ++A    +++ Y ++++    S+E +   E+  + R  + T+                          DS++      EG  +T +CK+ G+P P   W +K          + +      +  L I  +  E +GIYT   +N+ G+A  S                   ++++    L     G PT  P ++ + + + + P +V    +  +   +   R +                +  ++ +  ++ P   +K     +++   + G    F   +   P  E  WF +   I       +  I  DG+ +L +      DSG +  +A N     + ++++ +      +H  K +       +NI E + L +   + GNP P  +W K++  ++       R+E T G   L I      D + Y     N+AG D     VNV V
Sbjct:  970 PSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTT--GYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHG--------ETSASASLLEE--ADYELLMKSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALI----RKKMAKDTVVVRTYVEDQEFHISSFEERLIKEI--EYRIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAW-YKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICS-----------------GKLYVEPAAPL-----GAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKP----VSFK-CLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDY-THKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAV---EHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEV 1649          

HSP 28 Score: 72.4034 bits (176), Expect = 2.592e-11
Identity = 56/173 (32.37%), Postives = 73/173 (42.20%), Query Frame = 1
Query: 5425 LGGNLYLFCVSEGRPKPKIEWRKDGSRI-----DFRRVLLSDDG-YHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGP-----TLDPGGKRYYK-VERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIG-NSKQLEIIAMQASDAGRYSCVAKNTFG 5904
            +G N+         P+P + W K G +I     D +    SD G Y LT+NS    D   Y  +A N +G+      + VT  P     TL P  KR     E   G +V  E  VSGIP P + W KDG P++  P+      G +   L I      D G Y   A NT G
Sbjct: 31703 VGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAG 31875          

HSP 29 Score: 69.707 bits (169), Expect = 1.758e-10
Identity = 101/478 (21.13%), Postives = 169/478 (35.36%), Query Frame = 1
Query: 5707 GGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRII---GNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGA------PPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKK-RLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVR---TPPEFDTSNVEPKVNWFTNQTRS-----------------------------------------------LECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGTRITVENVKQY--DAGEYKCHAQNEV----SKISLVFNVEVFL---------------------------------------KPRFYKNQLYTK-IEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISV 6822
            G T   +  V G P P   W  DG  I  +  Y ++++     ++ L I+    SD+G ++ VA+N  G+  I + +T+ A      P  +++ + +N   IK G  L +   A G+PNP+I + K+ +      + P+K   Y K R+  ++    L + S    DS  Y   A N  G D     V V      PE +   + P+  +   +  +                                                EC L  + DP   + W   G PL +   +R+  +    +++    Y  D+G   C A N+     +  +L+   E  L                                       KP      LY + +  ++  T +  C  TGYP P + WY   Q I   K    ++D   G   + I + +  D      TA N  G IE K ++ +
Sbjct: 1471 GQTARFDLKVVGRPMPETFWFHDGQQI--VNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVN---IKEGSRLEMKVRATGNPNPDIVWLKNSDI-----IVPHK---YPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIV---LYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYD---GIHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEI 1929          

HSP 30 Score: 68.9366 bits (167), Expect = 3.003e-10
Identity = 169/841 (20.10%), Postives = 281/841 (33.41%), Query Frame = 1
Query: 1447 GHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNV-TLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKNASIEPFKDAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLI-------------ILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASV--DEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEV---------------------------------------RIKLSYISLPKILSLDLAKEIPLEGDQQ------------------------TVRCSATGVPQPKITWEFNGSPVTIDGNIIINETI-GT--LDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNI------DGSYGENITIR----------------------------------CQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNS---LIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIA---APKIAFT-------QSKQVVVESTLKKVIVCLVV---ESKPPAVISWLKNGKEIEYSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVK-----APPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQP 3540
            G   +    VQS+    + WY N  ++   ++  + +  TS V TLEI   +    G Y A            KG   D   + V       +  +       +D E+  +VF                 EL  T+ + +  +KK+    +S  +             + S   S + E    A  E  + E     K  T  AA +    + ++  + +S   SC     P PT +W   G+ L  T  R  +     +S  +IS+V+  D G      +NS G  E                                        R+K    S PK +S    K  P E  Q                         T    ++ +   ++TW  +G  +  +G+   + +  GT  L IN + ++ +G++VC  +   G+S+ +          I + V+ I      D    E+   R                                   +  G+P P   W +         I  G +Y +++D     L I      D   Y C  +N  G V  S ++ I  I    A K++         Q K VV E   +K +    +   E+K    ++  +   ++  S  +     T + K++   +E   T  A  +V T               I  F T +   +G  +VL+    G     ++W   G  LT     R  +S     LT+   +    G  TC +      V  ++ +++      AP  IS+       I   +NV   C I SG PSP+IEW+KN  P
Sbjct: 32388 GQNTRFILNVQSKPTAEVKWYHNGVEL--QESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCT-------NYKGEASDYATLDVTGGDYTTYASQR------RDEEVPRSVFP----------------ELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHSASAEMKSAALEEKSLEEKSTTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLS-TSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPKITQFLKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKA-----ITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSI-VHEEITKTSQASEEVRTHAE------------IKAFSTQMSINEGQRLVLKANIAG--ATDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQP--RSQNINEGQNVLFTCEI-SGEPSPEIEWFKNNLP 33173          

HSP 31 Score: 68.9366 bits (167), Expect = 3.701e-10
Identity = 152/684 (22.22%), Postives = 257/684 (37.57%), Query Frame = 1
Query: 2995 SNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAK-FDIELDVQTK------PIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHA--GTFTCTATNDHAAVVKEFKVSVKAPPQISK-EGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKN---EDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKK-WSWKSSILDLQRNPFGITNSPIDK---NDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQ-FNDKSVVFIDN-----------TITL----TCIASGNPT-----PKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYS--CLAENEGGKDQKNSI---------VTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDG-STLTLFEVKHLDSGIYKCLAINIGESLNFT--LVVLISPTILGKHSSKSVININEETDLY-----ITCWSEGNPAPRYLWYKDNSQLISGG--RVEITNGGKTLLIKK-VRRSDDSVYQCHVTNEAGEDKKNFDVNVF-VPPSINGISMRE 4863
            SN+   KD    I  +    E  +   A+N+ G ++     + ++TK      P I  + K  +  K G+   L CQ  G P P I+W + G+ L      +  +S DG   T+  +TEE    G +TC ATN+   V    K+ ++A PQ      + +   G+  +     ++  G P P + W+ +GQ L++    + I   ++   +  KN   +   G Y+ + +N   +      + I   P      ++       E L  N  +  +  P     SW             ITN  ++K    +    Q+ S    + TC   N+  +A   + V    +  I       SVV I +           TIT     +C+ +  P       KI+  + +K          +  E     +      + G EY      EN GG+ + + I         V + AP+   +  N N+ Y       N T  C +   P   +KW++   +I     K R +    G   L +  V   D+ +Y+  A N G S++ T  L V +   I   H  K++  +     L      I     G P P   W K    + + G  +V +T    +L+    V R D   Y     N  G D+K  +++V  VP    G+ + +
Sbjct: 30480 SNKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIRKEMKD-VTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQ--SRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWF-HGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVI------EALLKNSAVISWKPPADDGGSW-------------ITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQ-----SNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKI---HLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSD 31132          

HSP 32 Score: 68.5514 bits (166), Expect = 4.374e-10
Identity = 56/231 (24.24%), Postives = 95/231 (41.13%), Query Frame = 1
Query: 5545 HLTVNSTMETDAGRYQCIAENTHG-----QTDISFDVQVTYGPTLDPGGKRYYK-VERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNE-YIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIG 6216
              T+   +E     ++  AEN  G     +T +S   ++T G    PG ++  K V   +G    L C + G P P I W + G  + +   Y+    G +  L ++  +  D G Y+C+A N  G++E    + + A P       L E Y   VG  LRL     G P P + +F     L   +    ++  +   L++   +        ++T +G Y+   SN  G
Sbjct: 30489 QFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEA--PGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQ--------RKTHAGKYKVQLSNVFG 30709          

HSP 33 Score: 66.6254 bits (161), Expect = 1.827e-9
Identity = 57/200 (28.50%), Postives = 91/200 (45.50%), Query Frame = 1
Query: 2566 GPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQ----DNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVI-VCLVVESKPPAVISWLKNGKEIE---YSNRIMAKDNTLVI--KTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKP 3135
             P  K+ + N++  Y  N T+ C+V G P P VKW R    G  I IA G +Y I +     + LII  ++ +D + Y   A NQ G V  +  + +   A   +  T      V +   +V+ + +    KP  VI+W K    I+   +   I+ +  T ++    V+ +D   Y   AKN+ G  +  +ELDV   P
Sbjct: 30927 APHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYR---QGKEI-IADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVP 31122          

HSP 34 Score: 65.4698 bits (158), Expect = 3.943e-9
Identity = 279/1501 (18.59%), Postives = 533/1501 (35.51%), Query Frame = 1
Query: 4990 QLHFMNVDKSHITRYTCI---ATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELI---RNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRI-----DFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLE-------CLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQM-----EIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPN------PNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNAS-NAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGT--RITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTA----TNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVI--LWTKENSPILIGDTDYYLTFNNGQSLTILN----PKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKEGG---IFKCIARNEVGS-IMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPC-IVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNT-VLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGL--FIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEIN---IYDLKPEDTGNYICIGERSGAEASTASTYLSIFTR--PKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAI----ESKLNSNGR-GSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQ--SDDPSESIKRTILMCKVEGKVDSIVWLKNGVIVQNSSRLYINDFN----LIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNGSLRIIGVQKEH---SGVYFCVASSNQ 9276
            +LH ++V  S    YTC+      E  S  KL   V   P + V    +++  ++K   L LSC  +      + W KDG+++      +   +      L + +A ++D G Y   V N   L+  +    + +            H    G    +F     +  P I+W K    I     D   +L   +  +L + + M  D   Y    E       ++              G+R  ++ + +    + E         +S    P   W   G  +   P+   +  G  + L +  ++   AG     A N          EI +D  +           L +  +    + R  C      N      P+I       S D FD+     A  KK +LV  + Q          D G+Y            +    +R++     +   V+        +T +  C L   +     + W ++   L +  ++ IS +G   ++ ++ V   D  + K     +V ++S    ++V     ++  +L+ K  AV+   + + CE +   P  + W++  +EI+   +   K D LR   +++I      D   Y C      T    T+E +  I V  P   ++  +G   H              +   +++P +   W  +  P L    D  +  +  + + IL+      + E       AK+ A        L   +P    +D  +F +           F+C     P  +  W      I+  D    +       + I S   E     +F+   ++  G  I++  +L+ + P    L  +  +E+    F+V  + +      +KW ++ + +        + + +T  +   D   +DT +        +   S++   V+   P      +       ++V+L C I +   P  + W+  G     S          ++ LI+ +  K   G Y C    D    ++ I    +   K+ RP  +    V+ T   + + +I E        W+  G  L +  +     +  +   + ++ +++  G +   A NV     L  +  V  L +    ++VT   G + T  C++  +  P V W   G+ L+    ++    SE +++   + D+K ED G            A    T+ ++F +  P    KP     V+E       CE  S     +KW  NG  I    + ++ ++GR   + +     E+   Y C AK+     + S  L V+  P V   +  +D      +     C++  +   + W K+G  ++   +  I        L+IN+    D   Y C    +     G + +L +   VFT    NI  +  + + L C     P   + WYK  + I       ++  G  RI+ +Q  H   +G Y C   S++
Sbjct: 11174 KLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLV--VEELPVRFVKT-LEEEVTVVKGQPLYLSCELNKE--RDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIRDQHVKPKG--TAIFACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRYPAKLTL-------------GEREVELLKPIEDVTIYEKESASFDAEISEADIPG-QWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEIELDFAVP----------LKDVTVPERRQARFECVLTREANVIWSKGPDII-----KSSDKFDII----ADGKKHILVINDSQF--------DDEGVYTAEVEGKKTSARLFVTGIRLKFMSPLEDQTVK------EGETATFVCEL---SHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKA----QVKELSSTAQLKVLEADPYFTVKLHDKT-AVEKDEITLKCEVSKDVP--VKWFKDGEEIVPSPKYSIKADGLR--RILKIKKADLKDKGEYVCDCGTDKTKANVTVEARL-IKVEKPLYGVEVFVGETAH--------------FEIELSEPDVHGQWKLKGQP-LTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKELPLIFITPL---SDVKVFEKD-------EAKFECEVSREPK-TFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLKFLTP----LKDVTAKEKESAVFTVELSHDNI---RVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEA---MGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDEVILQCEISKADAP--VKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREI---KLVRPLHS--VEVMETETARFETEISEDDIH--ANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTA--GETATFDCELSYEDIP-VEWYLKGKKLEP--SDKVVPRSEGKVHTLTLRDVKLEDAGEVQLT-------AKDFKTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEV-SRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKD----FKTSCNLNVVP-PHVEFLRPLTDLQVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTA--RTSGMLTVL-EEEAVFTKNLANIEVSETDTIKLVCEV-SKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSR 12540          

HSP 35 Score: 62.7734 bits (151), Expect = 2.244e-8
Identity = 55/209 (26.32%), Postives = 92/209 (44.02%), Query Frame = 1
Query: 7144 FSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDM--MNFVISNNAKVLTIPSVNK-EGGIFKCIARNEVGSIMKVYKL----EVIMPALV-RLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGI-----FRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGE 7731
            F+   +++ V  G++  F+    G P P + WF     IS   +  +    S+    LTIP+V K   G +   A N  G      +L    E   P  V RL  + VR+ S     V  T  G P PV+K+ RDG  I     F+   + D  +  L I +A  ED+G Y+   TN + + + + ++++    ++ + K   +V   +
Sbjct:    8 FTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVT--GIPTPVVKFYRDGAEIQSSLDFQISQEGDLYS--LLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKTIVSTAQ 212          

HSP 36 Score: 62.003 bits (149), Expect = 4.272e-8
Identity = 50/171 (29.24%), Postives = 74/171 (43.27%), Query Frame = 1
Query: 7894 YRCVANNDAGYQEIRITLEVLVQPKI-------FRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSL--KIEDEGSLTCIAKNVAGE----DRLTFQITVELLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQN 8367
            +R  A N+ G    R T  + ++ K+        R    + T  L    Q+ C+I+ G P P I W R G  L + + Y  ++D        +  + EDEG  TCIA N  GE     +L  Q T +  P   L     G  GS++ +     G+P P +TW    + LQN
Sbjct: 30503 FRVFAENETGLSRPRRTA-MSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIV-GRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQN 30671          

HSP 37 Score: 61.6178 bits (148), Expect = 5.919e-8
Identity = 88/370 (23.78%), Postives = 155/370 (41.89%), Query Frame = 1
Query: 8248 VSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENE-----INIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGR--------AIESKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSD-DPSESIKRTILMCKVEGKVD------SIVWLKNGVIVQNSSRLYINDFNLI-INQAKSKDTGIYQCIASNSAGEAQG------QVHLLVKSPPV-FTLLPG-NISANLGEVLILPCAAEGYPIPTISWYKNK-KLIKYDFVK-SLIKNG-SLRIIGVQKEHSGVYFCV 9261
            V+L  SV    G  V ++   +G+P PTVTW+KD ++    LG+  R++ EN      + I  +   DTG YI   E    E  +++  + +   P    K ++K+V + T    +         P I ++   R         +  K +S    S  L  +  +    ++ +A+N +G  E     E +    V     D    +S K ++++   +   D        V  + G   Q  S   I+    I ++Q K +    ++  A N  G +         V  L+ +P V  + +PG  ++  +G  + L    +G P P+ISW K+   L + +FV+ S  +N  +L I   +KEH G Y  +
Sbjct: 27275 VALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKN----LGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSST---SFKLIDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIGPITVKELIITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVI 27637          

HSP 38 Score: 61.2326 bits (147), Expect = 7.295e-8
Identity = 56/202 (27.72%), Postives = 85/202 (42.08%), Query Frame = 1
Query: 7669 VIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQG----LIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKI---LEGIPQPVITWERNGITLSKVKNY---YTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLP 8244
            V I  P  +   +++ VR      L C V G     + WY  G   I+  +  +Y+    +G    LII  V  D + VY+  A N  G      +LEV V  KI  P   E  G ++ +      I     G P PVITW++    +    +Y    T + + L   N ++ +D G     AKN  G D+ T ++ V  +P
Sbjct: 30923 VPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGL--KYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVP 31122          

HSP 39 Score: 60.8474 bits (146), Expect = 8.695e-8
Identity = 46/169 (27.22%), Postives = 73/169 (43.20%), Query Frame = 1
Query: 5419 VALGGNLYLFCVS-EGRPKPKIEWRKDGSRIDFR-----RVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQ 5907
            V L G+   F     G P P++ W +DG  I        ++  SD    LT+ +  + ++GRY   A N  GQ   + ++ V          +R   +    G  V L+  V+GIPTP + + +DG  I     ++    G+   L I      D+G YS  A N+ G+
Sbjct:   16 VVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGR 184          

HSP 40 Score: 60.8474 bits (146), Expect = 9.533e-8
Identity = 82/303 (27.06%), Postives = 127/303 (41.91%), Query Frame = 1
Query: 5194 ATIEWFKDGELIRNNLRVNITNRGT--QLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIP--PSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFR--RVLLSDDGYH--LTVNSTMETDAGRYQCIAENTHGQ--TDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRII--GNSKQLEIIAMQASDAGRYSCV-------AKNTFGQMEIFM-----DVTIGAPPSIDRNRILNEYII----KVGDELRLPCP 6018
            A   W KDG  IR + +      G   +LH+++ Q SD G Y C++  +LG  ++  T  +++   P     +      V  G  LYL C  E   +  + WRKDG  +  +  R++    G    LT+N   +TDAG Y    EN +    +     V+V     + P   ++ K +    GT +  C ++   TP I W K    I   P+ +  I+  GN   L+I      D   Y+         AK T G+ E+ +     DVTI    S   +  ++E  I    K+  EL  P P
Sbjct: 11147 AITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVL--RLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLYLSC--ELNKERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIRDQHVKPK----GTAIFACDIAK-DTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRYPAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWKLKGELLRPSP 11440          

HSP 41 Score: 58.9214 bits (141), Expect = 3.693e-7
Identity = 53/230 (23.04%), Postives = 98/230 (42.61%), Query Frame = 1
Query: 2497 QWVCVATNSAGSSRK-------SFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQD---NSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAA--PKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRIMAKDNT----LVIKTVKAEDEA-IYTCIAKNQVGTAKFDIELDVQTKP 3135
            ++   A N  G SR           L  G  P I+  + ++    GE   + CQ+ G+P P +KW R     +   +    +Y ++ D   ++L +     ED+  Y C A N+ G+V+ S ++ +       P     +     V STL+  ++ +    +P   ++W    K ++ S  I  ++      LV+K V+ +  A  Y     N  GT    +++++Q KP
Sbjct: 30502 EFRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYR-----FGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYI---GRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKP 30723          

HSP 42 Score: 58.5362 bits (140), Expect = 4.990e-7
Identity = 119/568 (20.95%), Postives = 211/568 (37.15%), Query Frame = 1
Query: 6931 KPVILWTKENSPILIGDTDYYLTFNNGQS-LTILNPKSDESGRYTCEAKNLAGQDSHTFVLTV-----TSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKEGG--IFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGI-----FRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKIS----QDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPT---------ETETTGVLNT-VLQMQCKILEGIPQPVITWERNGITLSKV------------KNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKV-SLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEIN---IYDLKPEDTGNY-ICIGERSGAEASTASTYL 8502
            +P  +WTK+   I  G   Y L+ + G   L I    + +SG YTC  KN AG  S +  LT+     T   K  T  +     IT Q    V  +   +   +  I      M  +       +    +KVL    V K     + K I   E+    +  + EV   A ++    ++    G    +     G     +KW  +G  +     +RYG     +T  L I  A   D G  TC    K      Q   ++   +   P   S  +S  +  G+ VL  C + G     I W+        S+ +   +  +   L I       SG Y   A N  G  +   T  ++V P +  P+         +T   G  ++  +QM     E       +   + +T  K             +++   + S     +++   +  +   +   + G           + PK+ +LP  ++ DEG  +T+ C   G+P P VTW   G+ + +    RF   + +++    I D++ +D G Y + +G   G++++T + ++
Sbjct: 32880 RPTAIWTKDGKAITQGG-KYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKT---SEITPQKKAVVQEEISQKALRSEEI-----KMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASE-EVRTHAEIKAFSTQMSINEGQRLVLKANIAGATD--VKWVLNGVELTNSEEYRYGVSGSDQT--LTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRG--QCSATASLMVLPLVEEPSREVVLRTSGDTSLQGSFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMTQLESSTSKMLKAGIRG-----------IPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 33420          

HSP 43 Score: 58.151 bits (139), Expect = 6.099e-7
Identity = 75/350 (21.43%), Postives = 137/350 (39.14%), Query Frame = 1
Query: 2557 IGFGPRIKDFVTNIDGSYGENITIRCQVEG-QPPPRVKWLRGIAGGYNIPIALGDRYFINQDNS---LIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGI----------AAPKIAFTQSKQVVVES----TL----------KKVIVCLVVESKPPAVISWLKNGKEIE-------YSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKP-----IIIGDFKTFI---DAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISP-DGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVE 3474
            I  GP +   + +  G  G ++   C++E      +V W  G+    N      ++Y I  ++    L +K ++  D   Y C   N +G+     ++ + G+             KI        ++E     TL          + V   + +   P   ++W K+G++I+       Y+         L I +V  +D+A YT +A+N+ G      +L V   P      +   FK  +   + ++G  +  + +  G P P ++W K G+PL++ P + I+    D   L +     E  G +  TATN   +       S +A  Q+ +      E  SKE  E
Sbjct: 31565 IEIGP-VSGQIMHAVGEEGGHVKYVCKIENYDQSTQVTWYFGVRQLEN-----SEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGS------TSCQAHLQVERLRYKKQEFKSKEEHE 31902          

HSP 44 Score: 58.151 bits (139), Expect = 6.099e-7
Identity = 48/176 (27.27%), Postives = 72/176 (40.91%), Query Frame = 1
Query: 3463 ENVELNCIITSGNPSPKIEWYKNGQPLVEIPG----RVEIAGQKNI--LKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTK--------EGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGS 3948
            ENV     IT  +P P + WYK+GQ +   PG    +      K +  L +     D+   Y   A N+   DS   ++T+ + P  +DS +  ++ +        EG+ +    ++ G P PT KW      L L  N   I +  +D   L I     E  G Y    TN  GS
Sbjct: 31705 ENVRFGVTITV-HPEPHVTWYKSGQKIK--PGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPN-IEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGS 31876          

HSP 45 Score: 57.7658 bits (138), Expect = 6.800e-7
Identity = 61/228 (26.75%), Postives = 98/228 (42.98%), Query Frame = 1
Query: 7345 FKCIARNEVG------SIMKV-YKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIF---RYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESP---KKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNN--QISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPT 7983
            F+  A NE G      + M +  KL       +R +  +V  + G +  + C   G P P IKW R GK +    +Y   +D RT  L +   ++ED G YTC  TN++ +   S  +++ + P+       K+     VG  + L  +  G RP     +  G    Q S  I  E        ++ +  RK H+G Y+   +N  G   +   L+V +Q K  +PT
Sbjct: 30503 FRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIG-RPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGT--VDAILDVEIQDKPDKPT 30727          

HSP 46 Score: 57.7658 bits (138), Expect = 8.665e-7
Identity = 45/169 (26.63%), Postives = 76/169 (44.97%), Query Frame = 1
Query: 2092 PPPTFSWFLNGRELDP--TDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYI--------SLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNI-IINETIG--TLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDI 2559
            P P  +W+ +G+++ P   D + +  +D    Q+ I++V   D  E    A+N  G D  + KL+          +L  +    LA     EG         +G+P P + WE +G P+++  NI II+E +    L I        G +   ATN+AGS+    +L +
Sbjct: 31717 PEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 31885          

HSP 47 Score: 56.9954 bits (136), Expect = 1.419e-6
Identity = 43/175 (24.57%), Postives = 76/175 (43.43%), Query Frame = 1
Query: 8257 PISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNR--FRFNSENEINIYDLKPEDTGNYICIGERSGAEASTAS--TYLSIFTRPKFVYKPKLKNV-VQETRWKSFRCEATSHPKPDIKWMFNGRAIESKL-------NSNGRGSITLQSVRSENAGEYKCIAKNRVG 8745
            P+S    EG +     KV G+P P   W  DGQ + N   ++   + +    + I    P D+G +  + +     +S +   T  ++  + K ++  KLKNV ++E      +  AT +P PDI W+ N   I            + G  ++ + S  S+++  Y   A N+ G
Sbjct: 1463 PVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAG 1637          

HSP 48 Score: 56.6102 bits (135), Expect = 1.691e-6
Identity = 49/190 (25.79%), Postives = 85/190 (44.74%), Query Frame = 1
Query: 8518 PKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKL-------NSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKR---TILMCKVEGKVDSIV-WLKNGVIVQNSSRLYIND----FNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVK 9042
            P F  +P    VV E    +F    +  P P++ W  +G+ I +          S+GR  +T+ +V   N+G Y   A N  G    +  L V A+     +     S ++++     L  +V G    +V + ++G  +Q+S    I+     ++L+I +A  +D+G Y   A+NS G A     LLV+
Sbjct:    6 PTFT-QPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194          

HSP 49 Score: 56.6102 bits (135), Expect = 1.933e-6
Identity = 38/117 (32.48%), Postives = 54/117 (46.15%), Query Frame = 1
Query: 5362 VDIMIPPSIKFNSK-AGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRRVLLSDDGYH-LTVNSTMETDAGRYQCIAENTHGQTDISFDVQV--TYGPTLDPGGKRYYKVER 5700
            VD +  P +  ++     H V  G ++ LF   +GRP P   W K  S +  R  + + D +  LTV +    DAG+Y    EN  G   I+F V+V  T GP   PG   +  V R
Sbjct: 28349 VDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGP---PGPITFKDVTR 28462          

HSP 50 Score: 56.225 bits (134), Expect = 2.102e-6
Identity = 43/169 (25.44%), Postives = 74/169 (43.79%), Query Frame = 1
Query: 4876 LKGSTTNLWCNVSGFPTPQIRWTYMETIXXXXXXXXXXQLHFMN---------VDKSHITRYTCIATNEAGSA---RKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQE--SDIGIYKCLVSNKLG 5340
            L+GST     ++SGFP P++ W + +            Q+ F +         V K++  RY+  ATN +G A    +L     T PP  V     +   + +  ++RL       P   +++++DG  I+++L   I+  G    LL A+    D G Y    +N +G
Sbjct:   18 LEGSTATFEAHISGFPVPEVSW-FRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQR--LQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVG 183          

HSP 51 Score: 56.225 bits (134), Expect = 2.266e-6
Identity = 95/487 (19.51%), Postives = 185/487 (37.99%), Query Frame = 1
Query: 1435 QVKRGHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNVTLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKNASIEPFKDAE--------LECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGN---IIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAP 2862
            +VK    +  NC V +E      W++N+  I ++ +  +  ++    TL I  A+   Q  Y   +            N R + + +      +    +   +EP KD E          C V     NV LKW K+       N   +R++ YK         L I      D GEY+  A  +  V+E +  I+  T     ++++ ++  D+     SC+ LS       W+ NGRE+     +     D    ++ I + +  D  E  C  ++       R +L    +P +  +   ++I        V  +     + ++ W  N   V + G+   ++    I  L I  I+   +G++  +A +    ++    L++   P+IK    ++    G+ +T+    +  P    +W +      N P++        +  S  I      D+  Y    QN+HGK +  + +++  +  P
Sbjct: 12650 RVKEQQEVVFNCEVNTE-GAKAKWFRNEEAIFDS-SKYIILQKDLVYTLRIRDAHLDDQANYNVSLT-----------NHRGENVKSAANLIVEEEDLR--IVEPLKDIETMEKKSVTFWCKV--NRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHM-------LTIKDCGFPDEGEYIVTAGQDKSVAELL-IIEAPTEFVEHLEDQTVTEFDDAVF--SCQ-LSREKANVKWYRNGREIK-EGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKS----RARLFVEEIP-VEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNM-VVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAK----LELAAAPKIKTADQDLVVDVGKPLTMVVPYDAYPKAEAEWFK-----ENEPLSTKTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGP 13092          

HSP 52 Score: 55.0694 bits (131), Expect = 5.407e-6
Identity = 78/332 (23.49%), Postives = 122/332 (36.75%), Query Frame = 1
Query: 6787 GGTIEKKFEISVIIPPKIMKRSLGPENHRV-----KENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQS-LTILNPKSDESGRYTCEAKNLAGQDS---HTFVLTVTSPPKF---------------------PTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYD---MMNFVISNNAKVLTIPSVNKEGGI-FKCIARNEVGSIMKVYKLEVIM----------PALVR-LDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRYGTKTDSRTGI----LEITDAKEEDTGRYTCTGTN 7635
            GG I  +  +SV    K+    +GP + ++     +E   + + C + NY+ +  V  +       L     Y +T+ +G + L + +    + G Y C+  N  G+DS     FV  V     +                     P +F++     T  +G +V F       P P + W+     I P D      F        LTI SV  +    +  +ARN+ G      KL V +          P   R L   E +E     F +  +  G P P +KW +DG+ +           G+    L I D   EDTG Y  T TN
Sbjct: 31546 GGAIRSQKGVSVA-KVKVASIEIGPVSGQIMHAVGEEGGHVKYVCKIENYDQSTQVTWYFGVRQ--LENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVS--GIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATN 31872          
BLAST of Hemicentin-1 vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 949.888 bits (2454), Expect = 0.000e+0
Identity = 849/3136 (27.07%), Postives = 1379/3136 (43.97%), Query Frame = 1
Query:  205 SDPSTGISLAIVFDSTGSMGNDLKQVKRGSRRILNNHLQKGYKKFIKDFVLVQVHDPDVGPXXXXXXXXXXXXYLDYVFTQGGGDCPEMTISGIEMALEASRPHSLIYVFTDSSAKDYEITPRVLNLIQKKQSQVVFVLTGFCNSTEEIGFQVYKQIATISSGQIYILGKGDVKEFMKIIERAVETVKVHILQEESSNFGSKTYSFPIDSHITQFTIQVTNFKAN-ESIKVAIRDPEGR----ELTESNGLIRLLKSVKTVYFASKENPAPGMWTLEVTTKSSNHSVRITGASEVDFLPGFSTIPEPSNDRTSRQPIKGAKNYLMANVTGNFLPGTIEWLYIMSVNGSSIIQLPA--NQTENQIYISQYPFEIPVDGHFYIKLSGKDSRGNEMQRYSRIAIFSRDPLPVSVSCPAKI-----QVKRGHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNVTLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKNASIEPFKDAELECNVFSTSSNVVLKWFK-SIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRC-SATGVPQPKITWEFNGSP-VTIDGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRG--IAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEY--SNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGD------FKTFI---------------DAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDN-TITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAINIG--ESLNFTLVVLISPTILGKHSSKSVI---NINEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRV-EITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXX-------XXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFD-----PVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGN-LYLFCVSEGRPKPKIEWRKDGSRIDFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINR------LPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTL---MGVADPPAKITWERHGVP-LSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFY-KNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVK-ENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLT-FNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISN--NAKVLTIPSVNKEG--GIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKP--VIKWTRDGKGIFRYG-TKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPK--KSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFL-SEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPV----------ITWERNGITLS----KVKNYYTTTDSGLFI-FNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISVTGDEG----SSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEA-TSHPKPDIKWMFNGRAIE-----SKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGK-VDSIVWLKNGVIVQNSSRLYINDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKN-KKLIKYDF-VKSLIKNGSLRIIGVQKEHSGVYFCVASSNQG 9279
            +DP+   SLA VFD TGSM +DL QV+ G+ +I    + +  +K I ++++V  HDP +G    TT +  F + L  V+  GGGDCPE T++GI  AL+ S P S IYVFTD+ +KDY +   VLN IQ+KQS VVFV+TG C +    GF+ Y++IA  S GQ++ L K DV   ++ +  AV+  KVH++ E     G+ + + P+D H+++ TI ++  K + +++ + +RDPEGR     L    G    LK+VK +     ++P+PG+WT+   ++   H++R+ G   VDF  GF++ P    +    +P+     YL+ N+TG   PGT+  + ++  +G S+ +  A  ++T   +Y +  PF +P  G F++++ G D    E  R +  AI S     V V  P        Q   G  + ++C V+S   Y I W K    II      + +  T      I   +    G Y   ++       +  GN   +  V     PP++F  +N S+   + A L C+  S +  V ++W +     +   NT+R          N  +  L I   + +D G Y C+A + GG+S     +     P+  V  +++ F   + +  SC A+  P P   W+  GR L   D +  +  D +   + I +    D G   C+A + AG       L   + PK+  +   K +   GD+ +  C +  G P PKI W  NG   +  D  I INE  G L I   +    G + CV  N AG   +  NL +G  P I +    +  +    +T++C   G PPP ++W +G  +    N P     RY    D +L+I    +EDQ  + C A+N +G+  +S  + ++G+ +P +     ++ ++E      + C+VV   P   I W+K+ K +E   + +I    + L ++    +DE  YTCIA +  G +   I + +  KP  +        FK  I               D  DG+   + C   G P P I W   GRP+T  P  R       + L V    + ++G +TC ATN      ++  + +   P IS  G S + +   +   + C +  G+P P I W  + +P  E  G V   G   I  V   NE   G++ C A N   +D+R   +T+   P  +     KI   + + + L C     P P + W+++   +D Q  P  I     +   L++  ++ E  G++ C  +N+ G   +SY + + E PKII      V  +   TI + C A+G   P++   + K  I       K   +N  TL +  A     G Y+C+  NE G  Q  + V V  P I + +   N   N  +VG  +   C + ++PPA + WF+  I I        + +  DG TL +      D+ IY C A N       N  + V+ SP I        V+   +I E     + C    NP P+  WY ++  LI      + ++  + L + K + +D  VY+C   N AGE  K+F V V VP +++    ++     +G    L C VSGFP PQI W    T+           L ++   LHF +V       Y C+A ++      + D      VL  P  IV  D + + ++ KD  L     +++    T  W  +G        V I + G +L++ +A+  + G Y C V+N  G  ++  T+D++ PP +       A+Q  +G N + L C   G PKP + W+ DG+ +D  +  L D+   L     +   + +  C AEN  G     F +Q    PT    G +      +   T+ L+C VS +    ITW+K G+P+        L + R  I+  ++  E I         Y+CVA NT GQ+    DV +   P I    +  E  I  G+E+ L C A G+P P   +  D N  D+            K  +       + + +  +  +G+Y+C A+N +G  V   +V VRT P F++   E ++     ++ +LEC +   +GV      I+W  +G P L+    ++    G  + + + K  D G Y C   NE    +  FN+ V + P    +   YT IE   N ++ + CE TG P P + W +  + +   K       +L      +I + +     +Y C A N  GT E  F++ +I  P I K   G +N     +   + F C + +    K  I+W +   PI +   D  +T  +N + LTILN   ++ G+Y+C  KN AG++S  F  TV  PP         +    V+  T V   CPA G P P I WF     I   ++ + + +   N   L I  + KEG  G + C A N  GS+ +   + VI    +  D I     S  +  V+ +   Y +P   I W + GK +      KT +    L +   +E D+ +YTC  TN+   D +   V ++  P  + P   + I V  G    L C  +G+    I W   GN    +     Y F  + + L I +      G Y C+A N  G  ++  TLEV++ P            V++   +    ++EG    +          + W+++G+T++    +  ++     SG  + F S +  D G  TCI +N AGE R  F   V   P +S  +S    +       V I C V G P P V W  D + L+         N+   + I   + E  G Y C  + +  +A     +L   T P    K + + V +        C A +S P   + W  +  +++     SK  +N + ++ + +++ ++ G Y C A N  G  +  F L VI  P     Q   P    KR  L C   G    +I+++K+G  +  S  + I    L+I+  + +  G Y CIA N AG ++  + + V  PP  +    N+    G+ L L C  E      I+W +   K  + D   +S      L I+    E +  Y C+A ++ G
Sbjct:   29 NDPTGKSSLAFVFDITGSMFDDLVQVREGAAKIFKTVMAQ-REKLIYNYIMVPFHDPYLGEIINTTDSTYFMRQLSKVYVHGGGDCPEKTLTGILKALQISLPSSFIYVFTDARSKDYHLEDEVLNTIQEKQSSVVFVMTGDCGNRTHPGFRTYEKIAAASFGQVFHLEKSDVSTVLEYVRHAVKQKKVHLMYEARERGGTVSRNIPVDKHLSELTISLSGDKDDSDNLDIVLRDPEGRTVDKRLYSKEGGTIDLKNVKLIRL---KDPSPGVWTVNTNSRLK-HTIRVFGHGAVDFKYGFASRPLDRIELARPRPVLNQDTYLLINMTGLIPPGTVGEIDLVDYHGHSLYKAVASPHRTNPNMYFAG-PF-VPPKGLFFVRVQGYDEDNYEFMRIAPTAIGS-----VIVGGPRAFMSPIHQEFVGRDLNLSCTVESASAYTIYWVKTGEDIIGGP---LFYHNTDTSVWTIPELSLKDAGEYECRVI-------SNNGNYSVKTRVETRESPPEIFGVRNVSVPLGEAAFLHCSTRS-AGEVEIRWTRYGATVFNGPNTER----------NPTNGTLKIHHVTRADAGVYECMARNAGGMSTRKMRLDIMEPPSVKVTPQDVYFNMREGVNLSCEAMGDPKPEVHWYFKGRHL-LNDYKYQVGQDSK--FLYIRDATHHDEGTYECRAMSQAGQARDTTDLMLATPPKV-EIIQNKMMVGRGDRVSFECKTIRGKPHPKIRWFKNGKDLIKPDDYIKINE--GQLHIMGAKDEDAGAYSCVGENMAGKDVQVANLSVGRVPTIIESPHTVRVNIERQVTLQCLAVGIPPPEIEWQKGNVLLATLNNP-----RYTQLADGNLLITDAQIEDQGQFTCIARNTYGQQSQSTTLMVTGLVSPVLGHVPPEEQLIEGQ-DLTLSCVVVLGTPKPSIVWIKDDKPVEEGPTIKIEGGGSLLRLRGGNPKDEGKYTCIAVSPAGNSTLHINVQLIKKPEFVYKPEGGIVFKPTISGMDEKHVAVVNSTHDVLDGEGFAIPCVVSGTPPPIITWYLDGRPIT--PNSRDFTVTADNTLIVRKADKSYSGVYTCQATNSAGDNEQKTTIRIMNTPMISP-GQSSFNMVVDDLFTIPCDV-YGDPKPVITWLLDDKPFTE--GVVNEDGSLTIPNV---NEAHRGTFTCHAQNAAGNDTRTVTLTVHTTPTINAENQEKI-ALQNDDIVLECPAKALPPPVRLWTYEGEKIDSQLIPHTIR----EDGALVLQNVKLENTGVFVCQVSNLAGEDSLSYTLTVHEKPKIISEVPGVVDVVKGFTIEIPCRATG--VPEVIRTWNKNGIDLKMDEKKFSVDNLGTLRIYEADKNDIGNYNCVVTNEAGTSQMTTHVDVQEPPIILPSTQTN---NTAVVGDRVELKCYVEASPPASVTWFRRGIAI--GTDTKGYVVESDG-TLVIQSASVEDATIYTCKASNPAGKAEANLQVTVIASPDI----KDPDVVTQESIKESHPFSLYCPVFSNPLPQISWYLNDKPLIDDKTSWKTSDDKRKLHVFKAKITDSGVYKCVARNAAGEGSKSFQVEVIVPLNLDESKYKKKVFAKEGEEVTLGCPVSGFPVPQINWVVDGTVVEPGKKYKGATLSNDGLTLHFDSVSVKQEGNYHCVAQSKG----NILDIDVELSVLAVP--IVGEDDNLEVFLGKDISLSCDLQTESDDKTTFVWSINGSESDRPDNVQIPSDGHRLYITDAKPENNGKYMCRVTNSAGKAERTLTLDVLEPP-VFVEPVFEANQKLIGNNPIILQCQVTGNPKPTVIWKIDGNDVD--KSWLFDESLSLLRIEKLTGKSAQISCTAENKAGTASRDFFIQNIAAPTFKNEGDQETIFRES--ETITLDCPVS-LGDFQITWMKQGLPLTENDAIFTLDNTRLTILNANRDHEDI---------YTCVANNTAGQVSKDFDVVVQVLPKIKNAVVTLE--INEGEEIILTCDAEGNPTPTAKW--DFNQGDL-----------PKEAVFVNNNHTVVVNNVTKYHTGVYKCYATNKVGQAVKTINVHVRTKPRFESGLTESELTVNLTRSITLECDVDDAIGVG-----ISWTVNGKPFLAETDGVQTLAGGRFLHIVSAKTDDHGSYACTVTNEAGVATKTFNLFVQVPPTIVNEGGEYTVIE---NNSLVLPCEVTGKPNPVVTWTKDGRPVGDLK----SVQVLSEGQQFKIVHAEIAHKGSYICMAKNDVGTAEISFDVDIITRPMIQK---GIKNIVTAIKGGALPFKCPIDDDKNFKGQIIWLRNYQPIDLEAEDARITRLSNDRRLTILNVTENDEGQYSCRVKNDAGENSFDFKATVLVPPTIIM-LDKDKNKTAVEHST-VTLSCPATGKPEPDITWFKDGEAIHIENIADIIPNGELNGNQLKITRI-KEGDAGKYTCEADNSAGSVEQDVNVNVITIPKIEKDGIPSDYESQQNERVVISCPVYARPPAKITWLKAGKPLQSDKFVKTSANGQKLYLFKLRETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKGSPSPTITWLKDGNAIEPN---DRYVFFDAGRQLQISKTEGSDQGRYTCIATNSVGSDDLENTLEVIIPP------------VIDGERREAVAVIEGFSSELFCDSNSTGVDVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSISDELSSANIQTIVPYYPVEINCVVSGSPHPKVYWLFDDKPLEPDSAAYELTNNGETLKIVRSQVEHAGTYTCEAQNNVGKAR--KDFLVRVTAPPHFEKEREEVVARVGDTMLLTCNAESSVPLSSVYWHAHDESVQNGVITSKYAANEK-TLNVTNIQLDDEGFYYCTAVNEAGITKKFFKLIVIETPYFLDQQKLYPIILGKRLTLDCSATGTPPPTILFMKDGKRLNESDEVDIIGSTLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPPKLSKEWINVEVQAGDPLTLECPIEDTSGVHITWSRQFGKDGQLDMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAG 3021          

HSP 2 Score: 744.577 bits (1921), Expect = 0.000e+0
Identity = 710/2709 (26.21%), Postives = 1167/2709 (43.08%), Query Frame = 1
Query: 1438 VKRGHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNVTLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKNASIEPFKDA-ELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILS-----LDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRI-KDFVTNIDGSYGENITIRCQVEGQPPPRVKWLR-GIAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKV----IVCLVVESKPPAVISWLKNGKEI---EYSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVG--TAKFDIELDVQTKPIIIGD--FKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLR---IVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNC-IITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPK------ASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKN---DLLITQMRSE-LQGI---YTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDN-TITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAIN-IGESLNFTLVVLISPTILGKHSSKSVININEETDLYITC-----------WS-EGNPAPRYLWYKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEF--LKGSTTNLWCNVSGFPTPQIRWTY----METIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFD-PVLTYPPKIVSLDPDKKRWILKDGELRLSC--NSDAAPVATIEWFKDGE---LIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRRV--LLSD---DGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRY-RIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSS----GGS-IRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEA-VQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPV--ILWTKENSPILIGD-TDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKE-GGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTR----DGKGIFRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVL-LPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQG---LIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISV-TGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESK---LNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSE-SIKRTILMCKVEGK-VDSIVWLKNGVIVQNSSRLYI-NDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANL-GEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNGSLRIIGVQK-EHSGVYFCVASSNQG 9279
            V  G G  + C+V    P +I WY +   I     D   F  T++ TL + +A++   GVY          Q T      +Q     +   P +   +++      D   + C+V+     V+       P              + +        L I + +E+  G + C A++  G       +  HT P  + + +E   + ND I   C A + PPP   W   G ++D      +I  D     + + NVK +++G  +C+  N AG D +   L+    PKI+S     +D+ K   +E     + C ATGVP+   TW  NG  + +D      + +GTL I   +KN  G + CV TN AG+S+ + ++D+   P I     TN     G+ + ++C VE  PP  V W R GIA G +        Y +  D +L+I+  S+ED + Y C A N  GK + ++Q+ +  IA+P I   +   VV + ++K+     + C V  S P   ISW  N K +   + S +       L +   K  D  +Y C+A+N  G  +  F +E+ V   P+ + +  +K  + AK+G+ + L C   G P P+I W   G    +EPG +     +S DG  L   S++ +  G + C A +    +  + ++SV A P + ++   + E+   +++ L+C + T  +      W  NG    + P  V+I    + L +     +  G Y C+ TN      R   + +L  P        ++ K+I         + L C++ G P PT  W               I  + +DK+   D  ++ +R E L G     +C   N  G+A   + +  + +P      D+  +F ++ TITL C  S     +I W+ +   +  N   + +   +   L +  A   H   Y+C+A N  G+  K+  V V    +  K  N  +T   I  G  I  +C     P    KW  N+ D    LPK+   ++ + + +     K+  +G+YKC A N +G+++    V + +        ++S + +N    + + C           W+  G P   +L   D  Q ++GGR         L I   +  D   Y C VTNEAG   K F++ V VPP+I    + E  E+  ++ ++  L C V+G P P + WT     +  + S  +LS   Q   ++ + +H   Y C+A N+ G+A   FD  ++T P  ++          +K G L   C  + D      I W ++ +   L   + R+   +   +L +LN  E+D G Y C V N  G +   +   +++PP+I    K           + L C + G+P+P I W KDG  I    +  ++ +   +G  L +    E DAG+Y C A+N+ G  +   +V V   P ++  G      E      VV+ C V   P   ITWLK G P   L S ++ +   N ++L +  ++ +D+ +Y+C+A N  G  +    V++   PS D   I+    +  G+   L CPA GSP+P I + KDGN+++     PN       R +     + L +   + +D G Y C A+N++G D +E ++ V  PP  D    E  V      +  L C           + W++ G+ ++     G S I+I   G +++  + ++ D+G Y C  +N   +   +F+  V   P          I+  V    V+++C  +G P P + W   ++ +  D   Y   ++      ++I   Q + A TY C A N  G   K F + V  PP   K        RV + M +T  C   N   + P+  + W   +  +  G  T  Y    N ++L + N + D+ G Y C A N AG     F L V   P F     ++     + LG  +   C A G+P P+I++      ++  D ++ + S     L I +  KE  G + CIA N+ G   K   +EV++P  +  + I V  ++G   ++ C  E      I W+R    DG+   R  + +D     L I  A  ED   Y+C   N          V + +PPKI     S    V +  L +PC  EG  P  I W+  G       IL       +QG   L ID ++ +  G Y CVA N AG  E    +E+   P++   +E     V      ++C++  G P+PV+ W ++G   +     ++T  S L +  +  + D G+ TCIA N AGE + T  + V + P++     V  G EG++  + C+V G+P P VTWK++G+ ++       +FN    ++I +    D G Y CI       A  A   + +FT+P F       N+V+    K   C+   HPKP I W+  GR        L+  G   + L++ R +  G Y C+A N  G  E  F + V  KP +       P   +    IL C V G    ++ W +    V N SR  I N+++L IN   ++D G Y CIA N AG         V   P F    GN+   +  + + + C     P+P+ISW++  K +      S+  +GS   I   K    G Y C AS+  G
Sbjct: 1012 VLDGEGFAIPCVVSGTPPPIITWYLDGRPITPNSRD---FTVTADNTLIVRKADKSYSGVYTC--------QATNSAGDNEQKTTIRIMNTPMISPGQSSFNMVVDDLFTIPCDVYGDPKPVITWLLDDKP--------------FTEGVVNEDGSLTIPNVNEAHRGTFTCHAQNAAGNDTRTVTLTVHTTPTINAENQEKIALQNDDIVLECPAKALPPPVRLWTYEGEKIDSQLIPHTIRED---GALVLQNVKLENTGVFVCQVSNLAGEDSLSYTLTVHEKPKIISEVPGVVDVVKGFTIE-----IPCRATGVPEVIRTWNKNGIDLKMDEKKFSVDNLGTLRIYEADKNDIGNYNCVVTNEAGTSQMTTHVDVQEPPIILPSTQTNNTAVVGDRVELKCYVEASPPASVTWFRRGIAIGTDT-----KGYVVESDGTLVIQSASVEDATIYTCKASNPAGKAEANLQVTV--IASPDI---KDPDVVTQESIKESHPFSLYCPVF-SNPLPQISWYLNDKPLIDDKTSWKTSDDKRKLHVFKAKITDSGVYKCVARNAAGEGSKSFQVEVIV---PLNLDESKYKKKVFAKEGEEVTLGCPVSGFPVPQINWVVDG--TVVEPGKKYKGATLSNDGLTLHFDSVSVKQEGNYHCVAQSKGNILDIDVELSVLAVPIVGED--DNLEVFLGKDISLSCDLQTESDDKTTFVWSINGSE-SDRPDNVQIPSDGHRLYITDAKPENNGKYMCRVTNSAGKAERTLTLDVLEPPVFVEPVFEANQKLIG-----NNPIILQCQVTGNPKPTVIWK--------------IDGNDVDKSWLFDESLSLLRIEKLTGKSAQISCTAENKAGTASRDFFIQNIAAPTFKNEGDQETIFRESETITLDCPVSLGDF-QITWMKQGLPLTENDAIFTL---DNTRLTILNANRDHEDIYTCVANNTAGQVSKDFDVVV---QVLPKIKNAVVTLE-INEGEEIILTCDAEGNPTPTAKWDFNQGD----LPKEAVFVNNNHTVVVNNVTKY-HTGVYKCYATNKVGQAVKTINVHVRTKPRFESGLTESELTVNLTRSITLECDVDDAIGVGISWTVNGKP---FLAETDGVQTLAGGRF--------LHIVSAKTDDHGSYACTVTNEAGVATKTFNLFVQVPPTI----VNEGGEYTVIENNSLVLPCEVTGKPNPVVTWTKDGRPVGDLKSVQVLSEGQQFKIVHAEIAHKGSYICMAKNDVGTAEISFDVDIITRP--MIQKGIKNIVTAIKGGALPFKCPIDDDKNFKGQIIWLRNYQPIDLEAEDARITRLSNDRRLTILNVTENDEGQYSCRVKNDAGENSFDFKATVLVPPTIIMLDKDKNKTAVEHSTVTLSCPATGKPEPDITWFKDGEAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSAGSVEQDVNVNVITIPKIEKDGIPS-DYESQQNERVVISCPVYARPPAKITWLKAGKP---LQSDKFVKTSANGQKLYLFKLRETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKGSPSPTITWLKDGNAIE-----PND------RYVFFDAGRQLQISKTEGSDQGRYTCIATNSVGSDDLENTLEVIIPPVIDGERRE-AVAVIEGFSSELFCDSNSTG---VDVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSISDELSSANIQTIVPYYPVEINCVVSGSPHPKVYWLFDDKPLEPDSAAY---ELTNNGETLKIVRSQVEHAGTYTCEAQNNVGKARKDFLVRVTAPPHFEKER-EEVVARVGDTMLLT--C---NAESSVPLSSVYWHAHDESVQNGVITSKYAA--NEKTLNVTNIQLDDEGFYYCTAVNEAGITKKFFKLIVIETPYFLDQQKLY----PIILGKRLTLDCSATGTPPPTILFMKDGKRLNESDEVDIIGS----TLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPPKLSKEWINVEVQAGDPLTLECPIEDTSGVHITWSRQFGKDGQLDMRAQSSSDKSK--LYIMQATPEDADSYSCIAVNDAGGAEAVFQVTVNTPPKIFGDSFSTTEIVADTTLEIPCRTEGIPPPEISWFLDG-----KPILEMPGVTYKQGDLSLRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEPPRVVMASEVMRV-VEGRQTTIRCEVF-GNPEPVVNWLKDGEPYTSDLLQFSTKLSYLHLRET-TLADGGTYTCIATNKAGESQTTTDVEVLVPPRIEDEERVLQGKEGNTYMVHCQVTGRPVPYVTWKRNGKEIE-------QFNPV--LHIRNATRADEGKYSCIASNEAGTA-VADFLIDVFTKPTFETHETTFNIVEGESAK-IECKIDGHPKPTISWLKGGRPFNMDNIILSPRGDTLMILKAQRFD-GGLYTCVATNSYGDSEQDFKVNVYTKPYIDETIDQTPKAVAGGEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNNYDLKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIGKPTFVRKGGNLYEVIENDTITMDCGVTSRPLPSISWFRGDKPVYLYDRYSISPDGSHITINKAKLSDGGKYICRASNEAG 3559          

HSP 3 Score: 738.413 bits (1905), Expect = 0.000e+0
Identity = 662/2512 (26.35%), Postives = 1096/2512 (43.63%), Query Frame = 1
Query: 1900 KLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASV---DEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVN-DVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTV-RCSATGVPQPKITWEFNGSPVTIDGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKD--FVTNIDGSYGENITIRCQVEGQPPPRVKWLR-GIAGGYNIPIALGDRY-FINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAV-ISWLKNGKEIEYSN-------RIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIV------LQCQTKGDPKPKIEWRKGGRPLTMEP-GLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSK--ENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIY-TKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQET-LIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAIN-IGESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLF-DPVLTYPPKIVSLDPDKKRWILKDGE-LRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRI--DFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPT-LDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLM---GVADPPAKITWERHGVPLSSG--GSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKE-NMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVN-KEGGIFKCIARNEVGSIMKVYKLEVIM-PALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGK----GIFRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDV-VIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKV-SLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSF-RCEATSHPKPDIKWMFNGR-AIESKLNSNGRGS-ITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGKVDSIVWL-KNGVIVQNSSRLYINDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQG 9279
            +L IL+ +E+D G+Y C  +++ G   +  F  T  +P   +    +K  + +++ ++T SC A   P P  +WF +G  +   +    I N ++  +Q+KI+ +K  D+G+  C+A NSAG  E  + ++ I++PKI    +  +   + +++ V  C     P  KITW   G P+  D  +  +     L + ++ +    ++ C+ATN AG+ ++ F + +   P   +   V  I  + G   T+ C  +G P P + WL+ G A      I   DRY F +    L I      DQ  Y C A N  G   + ++  +  I  P I   + + V V       + C   +S    V + W K+G  I           +I +    +   + +  D   YTCI +N  G A+   +  V   P I  +    + + +   IV      + C   G P PK+ W    +PL  EP      ++ +G  L +     EHAGT+TC A N+     K+F V V APP   KE     E+ ++  + + L C   S  P   + W+ + + +       + A  +  L V     D+ G Y C A NE     +FF++ ++  P   D +  K+Y    G++LTL+C   G P PT  +      L+ + +   I  S      L+I   + E++G YTC   N  G ++    V +L  PK+ +      V   + +TL C         I W   ++      +  +    + ++ L + +A       YSC+A N+ G  +    VTV  P    K    + +   I+    +   C     PP EI WF +   I + +P   +K      +L +  +K    G Y C+A N  G +   T V +  P  +   S   V+ + E     I C   GNP P   W KD     S   ++ +     L +++   +D   Y C  TN+AGE +   DV V VPP I         +  +G+T  + C V+G P P + W      N   +   N  LH  N  ++   +Y+CIA+NEAG+A   F   V T P    + +  +  + + +GE  ++ C  D  P  TI W K G    N   + ++ RG  L +L AQ  D G+Y C+ +N  G  +Q + V++   P I          VA GG + L C   G P P + W++    +  D R  ++++  Y L +NS    DAG+Y CIA N  G     +  +V   PT +  GG  Y  +E     T+ ++C V+  P P+I+W +   P+      RY I  +   + I   + SD G+Y C A N  G  +I + + I  PP ID++ I+   +  V   + L CP +G P P++ + K+G  ++M D           R++++Q  +   + + + TD G Y C A+N  G    ++S+ V +PPEFD    +P +      T +L C +     +AD    ++W +    L      ++ IS DG ++T+      +AG Y C A N   + SL F VE+   P    ++   + +   N    M C  TG+P P++ W +  +E+  D+       I+    V+QI     D A  ++C A N  G  E +  + V  PP +  +S  P    +K     IT  C+        P + W K  S I        ++   G  L I + K  + G YTC+A N AG    +  + V  PP+   D       +  Q   S+  QC A+G P P + W      ++ +      +++++  + I +V+  + G++ C A N  GS   +Y ++V+  P +      +V E  G    + C  EGYP P + W R+G     G+      TD R  +L I +A+  D+G Y C+ TN+     ++  + V++SP  I S    +    G +  LPC V G     I W   GN+ I     G +   ++  L I++  + H  +Y C A NDAG   +   ++ +V PKI         G   T   ++C+I         +W +NG+ L    N   + D  L    S ++ D+G  +C A N AG       + V + PK+   P +    +G  VT+ C+  G P+P +TW KD + L N   +      +  +    + P   G Y C  E   A ++     L +   P+ V  P+  NV    R   F  C AT  P+P I WM +   AI++       G+ + +++V  ++ G Y CIAK+  G        + IA  ++ V   + PS+      + C  +GK     ++   G    ++ +L        +     +D+ +   IA       +    +L+ + P F + P N +A +G ++ L C+A G P PTI+W K+ KLI+    K  I    L++       SG Y C+A ++ G
Sbjct: 2250 RLTILNVTENDEGQYSCRVKNDAG-ENSFDFKATVLVPPTIIMLDKDKNKTAVEHSTVTLSCPATGKPEPDITWFKDGEAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSAGSVEQDVNVNVITIPKIEKDGIPSDYESQQNERVVISCPVYARPPAKITWLKAGKPLQSDKFVKTSANGQKLYLFKLRETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKGSPSPTITWLKDGNA------IEPNDRYVFFDAGRQLQISKTEGSDQGRYTCIATNSVG--SDDLENTLEVIIPPVIDGERREAVAVIEGFSSELFC---DSNSTGVDVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSISDE----LSSANIQTIVPYYPVEINCVVSGSPHPKVYWLFDDKPL--EPDSAAYELTNNGETLKIVRSQVEHAGTYTCEAQNNVGKARKDFLVRVTAPPHFEKE---REEVVARVGDTMLLTCNAESSVPLSSVYWHAHDESVQNGVITSKYAANEKTLNVTNIQLDDEGFYYCTAVNEAGITKKFFKLIVIETPYFLDQQ--KLYPIILGKRLTLDCSATGTPPPTILFMKDGKRLN-ESDEVDIIGS-----TLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPPKLSKEWINVEVQAGDPLTLECPIEDTSGVHITW--SRQFGKDGQLDMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGGAEAVFQVTVNTP---PKIFGDSFSTTEIVADTTLEIPCRTEGIPPPEISWFLDGKPILE-MPGVTYKQG--DLSLRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEPPRVVMASE--VMRVVEGRQTTIRCEVFGNPEPVVNWLKDGEPYTSD-LLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQTTTDVEVLVPPRIE--DEERVLQGKEGNTYMVHCQVTGRPVPYVTWKR----NGKEIEQFNPVLHIRNATRADEGKYSCIASNEAGTAVADFLIDVFTKP----TFETHETTFNIVEGESAKIECKIDGHPKPTISWLKGGRPF-NMDNIILSPRGDTLMILKAQRFDGGLYTCVATNSYGDSEQDFKVNVYTKPYIDETIDQTPKAVA-GGEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNN--YDLKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIGKPTFVRKGGNLYEVIEN---DTITMDCGVTSRPLPSISWFRGDKPVYLYD--RYSISPDGSHITINKAKLSDGGKYICRASNEAGTSDIDLILKILVPPKIDKSNIIGNPLAIVARTIYLECPISGIPQPDVIWTKNGMDINMTD----------SRVILAQNNETFGIENVQVTDQGRYTCTATNRGGKASHDFSLDVLSPPEFDIHGTQPTIKR-EGDTITLTCPIKLAEDIADQVMDVSWTKDSRALDGDLTDNVDISDDGRKLTISQASLENAGLYTCIALNRAGEASLEFKVEILSPPVIDISRNDVQPQVAVNQPTIMRCAVTGHPFPSIKWLKNGKEVTDDE----NIRIVEQGQVLQILRTDSDHAGKWSCVAENDAGVKELEMVLDVFTPPVVSVKSDNP----IKALGETITLFCNASGNPY--PQLKWAKGGSLIFDSPDGARISLK-GARLDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVLVPPEINRDGIDMSPRLPAQ--QSLTLQCLAQGKPVPQMRWTLNGTALT-HSTPGITVASDSTFIQINNVSLSDKGVYTCYAENVAGSDNLMYNVDVVQAPVISNGGTKQVIE--GELAVIECLVEGYPAPQVSWLRNGNRVETGVQGVRYVTDGR--MLTIIEARSLDSGIYLCSATNEAGSAQQAYTLEVLVSPKIITSTPGVLTPSSGSKFSLPCAVRGYPDPIISWTLNGND-IKDGENG-HTIGADGTLHIEKAEERHL-IYECTAKNDAGADTLEFPVQTIVAPKISTSGNRYINGSEGTETVIKCEIESE--SSEFSWSKNGVPLLPSNNLIFSEDYKLIKILSTRLSDQGEYSCTAANKAGNATQKTNLNVGVAPKIMERPRTQVVHKGDQVTLWCEASGVPQPAITWYKDNELLTNTGVDETATTKKKSVIFSSISPSQAGVYTCKAENWVA-STEEDIDLIVMIPPEVV--PERMNVSTNPRQTVFLSCNATGIPEPVISWMRDSNIAIQNNEKYQILGTTLAIRNVLPDDDGFYHCIAKSDAG--------QKIATRKLIV---NKPSDRPAPIWVECDEKGKPKKTEYMIDRGDTPDDNPQL--------LPWKDVEDSSLNGSIAYRCMPGPRSSRTVLLHAAPQFIVKPKNTTAAIGAIVELRCSAAGPPHPTITWAKDGKLIEDS--KFEIAYSHLKVTLNSTSDSGEYTCMAQNSVG 4644          

HSP 4 Score: 723.391 bits (1866), Expect = 0.000e+0
Identity = 662/2523 (26.24%), Postives = 1089/2523 (43.16%), Query Frame = 1
Query: 1903 LIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNII---INETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNI-DGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYF-INQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNR--IMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIG-DFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSK-ENVELNCIITSGNPSPKIEWYKNGQPLVEIPGR----VEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQ--FNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIV-TVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAINIGE--SLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSI-NGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWT-----YMETIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCV--SEGRPKPKIEWRKDGSRIDF-----RRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPT---LDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDG--IPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCEC--TGYPPPTLLWYRQEQEILADKERYPKF-DILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGS-PTPSIMWFYKDMPISPYDMMNFVISN----NAKVLTIPSVN-KEGGIFKCIARNEVGSIMKVYKLEVI-MPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQG-----LIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNY-YTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISVTGD-EGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSE-NEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSF--RCEATSHPKPDIKWMFNGRAIESKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGKVD-SIVWLKNGV-IVQNSSRLYINDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPP-VFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQGEVHSQ 9294
            LI+  A +S +G Y C A +  G +E    I+    P  S  +   + + +D  T  C     P P  +W L+ +          +VN  ++  + I NV     G   C A+N+AG D   + L+  + P I + +  K I L+ D   + C A  +P P   W + G    ID  +I   I E  G L +  ++    G +VC  +N AG    S+ L +   P+I   V  + D   G  I I C+  G P     W +       I + + ++ F ++   +L I      D   Y C   N+ G  Q +  + +     P I    ++         +V +   VE+ PPA ++W + G  I    +  ++  D TLVI++   ED  IYTC A N  G A+ ++++ V   P I   D  T    K+     L C    +P P+I W    +PL ++       S D  +L V+      +G + C A N      K F+V V  P  + +          + E V L C + SG P P+I W  +G  +VE PG+      ++     L     +  + G+Y C A ++ +      ++++L  P   +   ++++  +   L+ + + +     T  WS   S  D   N       P D + L IT  + E  G Y C  TN  G A+ +  + +LE P  ++  F     +  +N I L C  +GNP P + W      I  N V    + +   +L+     +    + SC AEN+ G   ++  +  + AP    +   + I          IT  C + S    +I W K  +     L ++    +LD + LT+         IY C+A N     S +F +VV + P I    ++   + INE  ++ +TC +EGNP P   W  D +Q          N   T+++  V +    VY+C+ TN+ G+  K  +V+V   P   +G++  E    L  S T L C+V       I WT     ++   +    L+    LH ++        Y C  TNEAG A K F+  +  PP IV  +   +  ++++  L L C     P   + W KDG  + +   V + + G Q  +++A+ +  G Y C+  N +G  + ++ VDI+  P I+   K     +  GG L   C    +   K +I W ++   ID      R   LS+D   LT+ +  E D G+Y C  +N  G+    F   V   PT   LD   K    VE +   TV L C  +G P P ITW KDG  I I  +         N  QL+I  ++  DAG+Y+C A N+ G +E  ++V +   P I+++ I ++Y  +  + + + CP    P   I + K G  L              K +  S   Q L L+  + TDS  Y C A+N  G D  ++ V +   P FD  N+  ++   +    +L C   G   P   ITW + G  +           G ++ +   +  D G Y C A N V    L   +EV + P     +    +  ++  + ++ C+   TG     + W +    I  D  R   F  I      M   + +  D+  Y C   N  G   K F+ +V  PP I           +     +  +C V       P + W  ++ P+      Y LT NNG++L I+  + + +G YTCEA+N  G+    F++ VT+PP F  +    RE +  ++G ++   C AE S P  S+ W   D  +      N VI++    N K L + ++   + G + C A NE G   K +KL VI  P  +   K+      G   ++ C+A G P P I + +DGK +     + D     L I + ++E  GRYTC   NK  +  K + V ++ PPK+     ++ V+ G+ + L C +E T    I W    + Q      G+    ++       L I +   + +  Y C+A NDAG  E    + V   PKIF  + + T  V +T L++ C+  EGIP P I+W  +G  + ++    Y   D  L I N +K   EG  TC+A+N AG       + +   P+V +   V    EG   TI C+V G P+P V W KDG+   + L    +F+++ + +++ +    D G Y CI      E+ T +T + +   P+   + +   V+Q     ++   C+ T  P P + W  NG+ IE + N      + +++    + G+Y CIA N  G+    F+++V  KP    +++       +   + CK++G    +I WLK G     ++  L      L+I +A+  D G+Y C+A+NS G+++    + V + P +   +     A  G  +IL C   G P PT++W +    +  D   +++ N  L+I  V  E +G Y C+A +  G + + 
Sbjct: 1056 LIVRKADKSYSGVYTCQATNSAGDNEQKTTIRIMNTPMISPGQSSFNMVVDDLFTIPCDVYGDPKPVITWLLDDKPFTE-----GVVN--EDGSLTIPNVNEAHRGTFTCHAQNAAGNDTRTVTLTVHTTPTINAENQEK-IALQNDDIVLECPAKALPPPVRLWTYEGE--KIDSQLIPHTIRED-GALVLQNVKLENTGVFVCQVSNLAGEDSLSYTLTVHEKPKIISEVPGVVDVVKGFTIEIPCRATGVPEVIRTWNKN-----GIDLKMDEKKFSVDNLGTLRIYEADKNDIGNYNCVVTNEAGTSQMTTHVDVQ---EPPIILPSTQTNNTAVVGDRVELKCYVEASPPASVTWFRRGIAIGTDTKGYVVESDGTLVIQSASVEDATIYTCKASNPAGKAEANLQVTVIASPDIKDPDVVTQESIKESHPFSLYCPVFSNPLPQISWYLNDKPL-IDDKTSWKTSDDKRKLHVFKAKITDSGVYKCVARNAAGEGSKSFQVEVIVPLNLDESKYKKKVFAKEGEEVTLGCPV-SGFPVPQINWVVDGT-VVE-PGKKYKGATLSNDGLTLHFDSVSVKQEGNYHCVAQSKGNILDIDVELSVLAVPIVGEDDNLEVFLGKDISLSCDLQTESDDKTTFVWSINGSESDRPDN----VQIPSDGHRLYITDAKPENNGKYMCRVTNSAGKAERTLTLDVLEPPVFVEPVFEANQKLIGNNPIILQCQVTGNPKPTVIWK-----IDGNDVDKSWLFDESLSLLRIEKLTGKSAQISCTAENKAGTASRDFFIQNIAAPTFKNEGDQETIFRE----SETITLDCPV-SLGDFQITWMKQGL----PLTENDAIFTLDNTRLTILNANRDHEDIYTCVANNTAGQVSKDFDVVVQVLPKI---KNAVVTLEINEGEEIILTCDAEGNPTPTAKW--DFNQGDLPKEAVFVNNNHTVVVNNVTKYHTGVYKCYATNKVGQAVKTINVHVRTKPRFESGLTESELTVNLTRSIT-LECDVDDAIGVGISWTVNGKPFLAETDGVQTLAGGRFLHIVSAKTDDHGSYACTVTNEAGVATKTFNLFVQVPPTIV--NEGGEYTVIENNSLVLPCEVTGKPNPVVTWTKDGRPVGDLKSVQVLSEGQQFKIVHAEIAHKGSYICMAKNDVGTAEISFDVDIITRPMIQKGIKNIVTAIK-GGALPFKCPIDDDKNFKGQIIWLRNYQPIDLEAEDARITRLSND-RRLTILNVTENDEGQYSCRVKNDAGENSFDFKATVLVPPTIIMLDKD-KNKTAVEHS---TVTLSCPATGKPEPDITWFKDGEAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSAGSVEQDVNVNVITIPKIEKDGIPSDYESQQNERVVISCPVYARPPAKITWLKAGKPL-----------QSDKFVKTSANGQKLYLFKLRETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKG--SPSPTITWLKDGNAIEPNDRYVFFDAGRQLQISKTEGSDQGRYTCIATNSVGSDDLENTLEVIIPP-VIDGERREAVAVIEGFSSELFCDSNSTGV---DVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSISDELSSANIQTIVPYYPVEINCVVSG--SPHPKVYWLFDDKPLEPDSAAYELT-NNGETLKIVRSQVEHAGTYTCEAQNNVGKARKDFLVRVTAPPHFEKE----REEVVARVGDTMLLTCNAESSVPLSSVYWHAHDESV-----QNGVITSKYAANEKTLNVTNIQLDDEGFYYCTAVNEAGITKKFFKLIVIETPYFLDQQKL-YPIILGKRLTLDCSATGTPPPTILFMKDGKRL-NESDEVDIIGSTLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPPKLSKEWINVEVQAGDPLTLECPIEDTSGVHITW----SRQFGKD--GQLDMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGGAEAVFQVTVNTPPKIFGDSFSTTEIVADTTLEIPCRT-EGIPPPEISWFLDGKPILEMPGVTYKQGDLSLRIDN-IKPNQEGRYTCVAENKAGRAEQDTYVEISEPPRVVMASEVMRVVEGRQTTIRCEVFGNPEPVVNWLKDGEPYTSDL---LQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQT-TTDVEVLVPPRIEDEER---VLQGKEGNTYMVHCQVTGRPVPYVTWKRNGKEIE-QFNP----VLHIRNATRADEGKYSCIASNEAGTAVADFLIDVFTKPTFETHETTFNIVEGESAKIECKIDGHPKPTISWLKGGRPFNMDNIILSPRGDTLMILKAQRFDGGLYTCVATNSYGDSEQDFKVNVYTKPYIDETIDQTPKAVAGGEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNNYDLKINSVTTEDAGQYSCIAVNEAGNLTTH 3472          

HSP 5 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 664/2533 (26.21%), Postives = 1034/2533 (40.82%), Query Frame = 1
Query: 1903 LIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPK--ITWEFNGSPVTI---DGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRI--KDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQD---NSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSN--RIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIG-DFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNG----QPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDS-------KMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIA-SGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTP---NKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAIN-IGESLNFTLVVLISPTILGKHSSKSVININEETD--LYITCWSEGNPAPRYLW---YKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTY----METIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRID-FRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFT---NQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVIL---WTKENSPILIGD-TDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTS--VNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKE-GGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRY--GTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQ--VLLPCIVEGTRPFRIHWYTPGNNQISST----ILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITL-SKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKV--SLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLN---SNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEV------IAKPRVRVYQSDDPSESIKRTILMCKVEGKVD-SIVWLKNGVIVQNSS---RLYINDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQGE 9282
            L I+SA   D+G Y C   +E GV+     +     P    +  E + I+N+S+   C     P P  +W  +GR   P     S+    +  Q KI + +    G  IC AKN  G  E+   +  I+ P I          ++G     +C        K  I W  N  P+ +   D  I        L I  + +N +GQ+ C   N AG +   F   +   P I   D   N        +T+ C   G+P P + W +    G  I I        N +   N L I  +   D   Y C+A N  G V++ V + +  I  PKI              ++V++   V ++PPA I+WLK GK ++     +  A    L +  ++  D + YTCIA N+ GT K D ++ +   P     +    I    G+   L C  KG P P I W K G    +EP  R V    G QL +        G +TC ATN   +   E  + V  PP I  E      +    + EL C   S +    +EW K+G    Q  +     ++I      +      + ++G Y C   N      + F   +   P  SD         ++  Y  E     +NC + G P P   W +    L+     + +TN   +   L I + + E  G YTC+  N  G A+  + V +   P   +  ++ V  + +T+ LTC A S  P   + W    + +  N V       N++TL V        G Y C A NE G  +K      F   I ++TP   ++   Y PII+G  +T  C    TPP  I + K+   + +S      ++ + GSTL +   +    G Y C+A N  G S    +V ++ P  L    SK  IN+  +    L + C  E        W   +  + QL    R + ++    L I +    D   Y C   N+AG  +  F V V  PP I G S   T E +  +T  + C   G P P+I W      +  +        +  L   N+  +   RYTC+A N+AG A +     ++ PP++V      +  +++  +  + C     P   + W KDGE   ++L +  + + + LHL     +D G Y C+ +NK G  +    V++++PP I+   +    Q   G    + C   GRP P + W+++G  I+ F  VL         + +    D G+Y CIA N  G     F + V   PT +     +  VE   G +  +EC + G P P I+WLK G P N + +      G++  L I+  Q  D G Y+CVA N++G  E    V +   P ID   I        G E+ L CP  G+P P + + K G+     D  PN      +  +V+     L + S    D+G Y C A N  G     Y+  V   P F    V    N +    N T +++C +   + P   I+W R   P+       ISPDG+ IT+   K  D G+Y C A NE     +   +++ + P+  K+ +     A+   T+ + C  +G P P ++W +   +I     R     + + N    I N+Q  D   Y CTATN GG     F + V+ PP+       P   R  E   IT  C +         ++   WTK+ S  L GD TD     ++G+ LTI     + +G YTC A N AG+ S  F + + SPP       I R  +  Q+  +     +C   G P PSI W      ++  D  N  I    +VL I   + +  G + C+A N+ G       L+V  P +V +      +  G + ++ C A G P P +KW + G  IF    G +   +   L+I   K+ D G YTC   N       SV V ++ PP+I      +  R+  Q  + L C+ +G    ++ W   G     ST    +  +  F+      I+ V     GVY C A N AG   +   ++V+  P I   +   T  V+   L +   ++EG P P ++W RNG  + + V+     TD  +      +  D G   C A N AG  +  + + V + PK+  S P  +T   GS  ++ C V G P P ++W  +G  +++   N     ++  ++I   + E    Y C   ++ A A T    +     PK            E      +CE  S          NG  +    N   S     I + S R  + GEY C A N+ G+      L V      + +PR +V    D      +  L C+  G    +I W K+  ++ N+           ++I +       G+Y C A N     +  + L+V  PP       N+S N  + + L C A G P P ISW ++  +   +  K  I   +L I  V  +  G Y C+A S+ G+
Sbjct: 2063 LHIVSAKTDDHGSYACTVTNEAGVATKTFNLFVQVPPTIVNEGGEYTVIENNSLVLPCEVTGKPNPVVTWTKDGR---PVGDLKSVQVLSEGQQFKIVHAEIAHKGSYICMAKNDVGTAEISFDVDIITRPMIQKGIKNIVTAIKGGALPFKCPIDDDKNFKGQIIWLRNYQPIDLEAEDARITRLSNDRRLTILNVTENDEGQYSCRVKNDAGENSFDFKATVLVPPTIIMLDKDKNKTAVEHSTVTLSCPATGKPEPDITWFKD---GEAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSAGSVEQDVNVNV--ITIPKIEKDGIPSDYESQQNERVVISCPVYARPPAKITWLKAGKPLQSDKFVKTSANGQKLYLFKLRETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKGSPSPTITWLKDGN--AIEPNDRYVFFDAGRQLQISKTEGSDQGRYTCIATNSVGSDDLENTLEVIIPPVIDGERREAVAVIEGFSSELFC--DSNSTGVDVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSISDELSSANIQTIVPYYPVE-----INCVVSGSPHPKVYWLFDDKPLEPDSAAYELTN---NGETLKIVRSQVEHAGTYTCEAQNNVGKARKDFLVRVTAPPHFEKEREEVVARVGDTMLLTCNAESSVPLSSVYWHAHDESVQ-NGVITSKYAANEKTLNVTNIQLDDEGFYYCTAVNEAGITKK------FFKLIVIETPYFLDQQKLY-PIILGKRLTLDCSATGTPPPTILFMKDGKRLNES-----DEVDIIGSTLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPPKL----SKEWINVEVQAGDPLTLECPIEDTSGVHITWSRQFGKDGQL--DMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGGAEAVFQVTVNTPPKIFGDSFSTT-EIVADTTLEIPCRTEGIPPPEISWFLDGKPILEMPGVTYKQGDLSLRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEPPRVVMASEVMR--VVEGRQTTIRCEVFGNPEPVVNWLKDGEPYTSDL-LQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQTTTDVEVLVPPRIEDEERV--LQGKEGNTYMVHCQVTGRPVPYVTWKRNGKEIEQFNPVL--------HIRNATRADEGKYSCIASNEAGTAVADFLIDVFTKPTFETHETTFNIVE---GESAKIECKIDGHPKPTISWLKGGRPFN-MDNIILSPRGDT--LMILKAQRFDGGLYTCVATNSYGDSEQDFKVNVYTKPYIDET-IDQTPKAVAGGEIILKCPVLGNPTPTVTW-KRGD-----DAVPND----SRHTIVNNYD--LKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIGKPTF----VRKGGNLYEVIENDTITMDCGV--TSRPLPSISWFRGDKPVYLYDRYSISPDGSHITINKAKLSDGGKYICRASNEAGTSDIDLILKILVPPKIDKSNIIGNPLAIVARTIYLECPISGIPQPDVIWTKNGMDINMTDSR---VILAQNNETFGIENVQVTDQGRYTCTATNRGGKASHDFSLDVLSPPEFDIHGTQPTIKR--EGDTITLTCPIKLAEDIADQVMDVSWTKD-SRALDGDLTDNVDISDDGRKLTISQASLENAGLYTCIALNRAGEASLEFKVEILSPPVI----DISRNDVQPQVAVNQPTIMRCAVTGHPFPSIKWLKNGKEVT--DDENIRIVEQGQVLQILRTDSDHAGKWSCVAENDAGVKELEMVLDVFTPPVVSVKSDNPIKALGETITLFCNASGNPYPQLKWAKGGSLIFDSPDGARISLKGARLDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVLVPPEINRDGIDMSPRLPAQQSLTLQCLAQGKPVPQMRWTLNGTALTHSTPGITVASDSTFIQ-----INNVSLSDKGVYTCYAENVAGSDNLMYNVDVVQAPVI---SNGGTKQVIEGELAVIECLVEGYPAPQVSWLRNGNRVETGVQGVRYVTDGRMLTIIEARSLDSGIYLCSATNEAGSAQQAYTLEVLVSPKIITSTPGVLTPSSGSKFSLPCAVRGYPDPIISWTLNGNDIKDG-ENGHTIGADGTLHIEKAE-ERHLIYECTA-KNDAGADTLEFPVQTIVAPKISTSGNRYINGSEGTETVIKCEIESESSEFSWSK-NGVPLLPSNNLIFSEDYKLIKILSTRLSDQGEYSCTAANKAGNATQKTNLNVGVAPKIMERPRTQVVHKGD------QVTLWCEASGVPQPAITWYKDNELLTNTGVDETATTKKKSVIFSSISPSQAGVYTCKAENWVASTEEDIDLIVMIPPEVVPERMNVSTNPRQTVFLSCNATGIPEPVISWMRDSNIAIQNNEKYQILGTTLAIRNVLPDDDGFYHCIAKSDAGQ 4487          

HSP 6 Score: 691.419 bits (1783), Expect = 0.000e+0
Identity = 653/2557 (25.54%), Postives = 1106/2557 (43.25%), Query Frame = 1
Query: 1840 KNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTH----TLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPL-EGDQQTVRCSATGVPQPKITWEFNGSPVTIDG-NIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKD--FVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRY----FINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVC-LVVESKPPAVISWLKNGKEIEYSN--RIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGD-FKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKS--VVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKN--EIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAIN-IGES-LNFTLVVLISPTILGKHSSKSVININEETDLYITCW--SEGNPAPRYLWYKDNSQLIS----GGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRW------TYMETIXXX--XXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELR------LSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFR-RVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPIN----RLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSI-DRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGG-SIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQS-LTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPK-FPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSV--NKEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISVT--GDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLS--IFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAI--ESKLNSNGRGS-ITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRV-RVYQSDDPSESIKRTI-LMCKVEG-KVDSIVWLKNGV-IVQNSSRLYI--NDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANL-GEVLILPCA---AEGYP--IPTISWYKNKKLIKYDFVKSLIKNGSLRIIGVQK---EHSGVYFCVASSNQGEV 9285
            KN    +++  K S +   + L I  A ++D G Y CV  +E G S+    +        LP+   +   +     D +   C   ++PP + +WF  G  +  TD +  +V    +  + I +   +D+    CKA N AG  E  ++++ I+ P I   D+  +  + E    ++ C     P P+I+W  N  P+  D  +   ++    L + + +    G + CVA N+AG   KSF +++     + +  +   +    GE +T+ C V G P P++ W+  + G    P   G +Y      N   +L    +S++ +  Y C AQ++ G + + + + +S +A P +    + +V +   +   + C L  ES       W  NG E +  +  +I +  + L I   K E+   Y C   N  G A+  + LDV   P+ +   F+        + I+LQCQ  G+PKP + W+  G  +        +     S L +  +T + A   +CTA N      ++F +   A P    EG  +      E + L+C ++ G+   +I W K G PL E      +   +  L +   N D    Y C A N     S+ F + + V PK  ++ ++ +   EGE++ L C  +G PTPT KW +     DL +    + N+    + +++  +     G+Y C  TN  G A  + +V +   P+      +S   V +  +ITL C         I W    K       G + +   +   IV      HG  Y+C   NE G   K   + V  P   +   N+   Y  +I   ++   C +   P   + W K+   +   KS+     ++  +G    +   +    G Y C+A N +G + ++F + ++  P I  +   K+++   +   L   C    + N   + +W + N Q I       R+   +  + L I  V  +D+  Y C V N+AGE+  +F   V VPP+I  +   +    ++ ST  L C  +G P P I W       ++E I         N +QL    + +    +YTC A N AGS  +  +  +   PKI      +K  I  D E +      +SC   A P A I W K G+ ++++  V  +  G +L+L   +E+D   Y C+ +N+ G DK+ + V +++ PS    +      V  G    L C ++G P P I W KDG+ I+   R +  D G  L ++ T  +D GRY CIA N+ G  D+   ++V   P +D  G+R   V    G +  L C  +      + W KDG+ IN    R  S+  +I  + K++  ++ + SD+GRY+C+ +N  G+     D  +  PPSI D     N   I     + + C  +GSP+P + +  D   L+     P+  A+Y+    ++   + L +  ++   +G Y C A N +G    ++ VRV  PP F+    E  V      T  L C       P + + W  H   + +G  + + + +   + V N++  D G Y C A NE       F + V   P F   Q    I  +    + + C  TG PPPT+L+ +  + +    E     DI+   S + I N Q +    Y C A N  G  EK   + V++PPK+ K  +   N  V+    +T  C + + +     I W+++      G  D     ++ +S L I+    +++  Y+C A N AG     F +TV +PPK F   FS    T  +   T++   C  EG P P I WF    PI   +M           L I ++  N+EG  + C+A N+ G   +   +E+  P  V +    +R   G   ++ C   G P+PV+ W +DG+       +  ++   L + +    D G YTC  TNK  +   + DV ++ PP+IE  ++ +  + G   ++ C V G     + W   G          E +  +    I +  R D  G Y C+A+N+AG       ++V  +P  F   ET    V     +++CKI +G P+P I+W + G   +      +     L I  + +  D G  TC+A N  G+    F++ V   P +   I  T     G  + + C V G P PTVTWK+   ++ N   +R    +  ++ I  +  ED G Y CI      EA   +T+ +  +  +P FV K      V E    +  C  TS P P I W    + +    + + +  GS IT+   +  + G+Y C A N  G+ +   +L+++  P++ +     +P   + RTI L C + G     ++W KNG+ I    SR+ +  N+    I   +  D G Y C A+N  G+A     L V SPP F +     +    G+ + L C    AE     +  +SW K+ + +  D   ++  +   R + + +   E++G+Y C+A +  GE 
Sbjct: 1306 KNGIDLKMDEKKFSVDNLGT-LRIYEADKNDIGNYNCVVTNEAGTSQMTTHVDVQEPPIILPSTQTNNTAVV---GDRVELKCYVEASPPASVTWFRRGIAIG-TDTKGYVVE--SDGTLVIQSASVEDATIYTCKASNPAGKAEANLQVTVIASPDIKDPDVVTQESIKESHPFSLYCPVFSNPLPQISWYLNDKPLIDDKTSWKTSDDKRKLHVFKAKITDSGVYKCVARNAAGEGSKSFQVEVIVPLNLDESKYKKKVFAKEGEEVTLGCPVSGFPVPQINWV--VDGTVVEP---GKKYKGATLSNDGLTLHFDSVSVKQEGNYHCVAQSK-GNILD-IDVELSVLAVPIVGEDDNLEVFLGKDIS--LSCDLQTESDDKTTFVWSINGSESDRPDNVQIPSDGHRLYITDAKPENNGKYMCRVTNSAGKAERTLTLDVLEPPVFVEPVFEANQKLIGNNPIILQCQVTGNPKPTVIWKIDGNDVDKS----WLFDESLSLLRIEKLTGKSA-QISCTAENKAGTASRDFFIQNIAAPTFKNEGDQETIFRESETITLDCPVSLGDF--QITWMKQGLPLTENDAIFTLDNTR--LTILNANRDHEDIYTCVANNTAGQVSKDFDVVVQVLPKIKNA-VVTLEINEGEEIILTCDAEGNPTPTAKWDFNQG--DLPKEAVFVNNN----HTVVVNNVTKYHTGVYKCYATNKVGQAVKTINVHVRTKPRFESGLTESELTVNLTRSITLECDVDDAIGVGISWTVNGKPFLAETDGVQTLAGGRFLHIVSAKTDDHGS-YACTVTNEAGVATKTFNLFVQVPPTIV---NEGGEYT-VIENNSLVLPCEVTGKPNPVVTWTKDGRPVGDLKSV-----QVLSEGQQFKIVHAEIAHKGSYICMAKNDVGTAEISFDVDIITRPMI--QKGIKNIVTAIKGGALPFKCPIDDDKNFKGQIIWLR-NYQPIDLEAEDARITRLSNDRRLTILNVTENDEGQYSCRVKNDAGENSFDFKATVLVPPTIIMLDKDKNKTAVEHSTVTLSCPATGKPEPDITWFKDGEAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSAGSVEQDVNVNVITIPKI------EKDGIPSDYESQQNERVVISCPVYARPPAKITWLKAGKPLQSDKFVKTSANGQKLYLFKLRETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKGSPSPTITWLKDGNAIEPNDRYVFFDAGRQLQISKTEGSDQGRYTCIATNSVGSDDLENTLEVIIPPVID--GERREAVAVIEGFSSELFCDSNSTGV-DVEWQKDGLTINQDTLRGDSF-IQIPSSGKKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSISDELSSANIQTIVPYYPVEINCVVSGSPHPKVYWLFDDKPLE-----PDS-AAYE----LTNNGETLKIVRSQVEHAGTYTCEAQNNVGKARKDFLVRVTAPPHFEKEREE--VVARVGDTMLLTCNAESSV-PLSSVYWHAHDESVQNGVITSKYAANEKTLNVTNIQLDDEGFYYCTAVNEAGITKKFFKLIVIETPYFLDQQKLYPI--ILGKRLTLDCSATGTPPPTILFMKDGKRLNESDE----VDII--GSTLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPPKLSKEWI---NVEVQAGDPLTLECPIEDTSGVH--ITWSRQFGKD--GQLDMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGGAEAVFQVTVNTPPKIFGDSFS----TTEIVADTTLEIPCRTEGIPPPEISWFLDGKPI--LEMPGVTYKQGDLSLRIDNIKPNQEGR-YTCVAENKAGRAEQDTYVEISEPPRVVMASEVMRVVEGRQTTIRCEVFGNPEPVVNWLKDGEPYTSDLLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQTTTDVEVLVPPRIEDEERVLQGKEGNTYMVHCQVTGRPVPYVTWKRNGK---------EIEQFNPVLHIRNATRADE-GKYSCIASNEAGTAVADFLIDVFTKP-TFETHETTFNIVEGESAKIECKI-DGHPKPTISWLKGGRPFNMDNIILSPRGDTLMILKAQRF-DGGLYTCVATNSYGDSEQDFKVNVYTKPYIDETIDQTPKAVAGGEIILKCPVLGNPTPTVTWKRGDDAVPN--DSRHTIVNNYDLKINSVTTEDAGQYSCIAVN---EAGNLTTHYAAEVIGKPTFVRKGGNLYEVIENDTITMDCGVTSRPLPSISWFRGDKPVYLYDRYSISPDGSHITINKAKLSDGGKYICRASNEAGTSDIDLILKILVPPKIDKSNIIGNPLAIVARTIYLECPISGIPQPDVIWTKNGMDINMTDSRVILAQNNETFGIENVQVTDQGRYTCTATNRGGKASHDFSLDVLSPPEFDIHGTQPTIKREGDTITLTCPIKLAEDIADQVMDVSWTKDSRALDGDLTDNVDISDDGRKLTISQASLENAGLYTCIALNRAGEA 3754          

HSP 7 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 641/2572 (24.92%), Postives = 1066/2572 (41.45%), Query Frame = 1
Query: 1837 LKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDE----KEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRC--SATGVPQPKITWEFNGSPV---TIDGN--IIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTN-----IDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYF--INQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIE---YSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCII--TSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSS-ILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIV----GGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAIN-IGESL-NFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGR------VEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIX---XXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDF--RRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPA-----ITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHG-VPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKN--QLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDY-YLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKEGGIFKCIARNEVGSIMKVYKLEVIM-PALVRLDKIEVRERSGTSFSVLCTAEGYP------KPVIKWTRDGKGIFRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKR-TILMCKVEGKVDS--IVWLKNGV-IVQNSSRL-YINDFNLII---NQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPT-ISWYKNKKLIKYDFVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQGEVHSQPIYLTVQIPGGWSAWQEWSK 9354
            LK  K  + + + K+ +A   KL +    E+D+ +Y C+A +E G  +     K   L A S DE    + I+    +  T  C A  +P PT +W  +G  ++P D  +         Q++IS  +  D G   C A NS G D++   L  I  P I          +EG    + C  ++TGV    + W+ +G  +   T+ G+  I I  +   +      K+  G++ C+  N AG +RK F+  +   P I D +++     I   Y   + I C V G P P+V WL       + P+      +   N   +L I    +E    Y C+AQN  GK ++   +R++   AP     + ++VV       ++ C    S P + + W  + + ++    +++  A + TL +  ++ +DE  Y C A N+ G  K   +L V   P  + D +       G  + L C   G P P I + K G+ L     + I+    GS L + +  +E  G +TC A N      K+  V V  PP++SKE I + E+ + + + L C I  TSG     I W +      ++  R + +  K+ L +     ++  SY C A N+       FQ+T+   PK                L + C+ +G P P   W      IL++     G+T    D + L I  ++   +G YTC   N  G A+    V I E P+++  ++   V      T+ C   GNP P + WL   +   P              L +       GG Y+C+A N+ G+ Q  + V V  P          I     ++    G      C +   P   + W +N  +I +  P            L +      D G Y C+A N  G ++ +F + V   PT     + ++  NI E     I C  +G+P P   W K       GGR      + ++  G TL+I K +R D  +Y C  TN  G+ +++F VNV+  P I+  ++ +TP+ + G    L C V G PTP + W   +      S   + NN  L   +V      +Y+CIA NEAG+    +   +   P  V    +    ++++  + + C   + P+ +I WF+  + +    R +I+  G+ + +  A+ SD G Y C  SN+ G       + I++PP I  ++  G     +   +YL C   G P+P + W K+G  I+    RV+L+ +     + +   TD GRY C A N  G+    F + V   P  D  G +     +  G T+ L C +      A     ++W KD   ++   +    I  + ++L I      +AG Y+C+A N  G+  +   V I +PP ID +R   +  + V     + C   G P P+I + K+G           K+ +  + + + ++ Q+L +       +G + C A N  G   +E  + V TPP     +  P       +T +L C   G  +P  ++ W + G +   S    RIS  G R+ + ++K+ D G+Y C A N         +V+V + P   ++   +  ++ A Q+ T+Q  C   G P P + W      +       P   +   ++ +QI N+   D   Y C A N  G+    + + V+  P I          +V E       C V  Y    P + W +  + +  G     Y+T  +G+ LTI+  +S +SG Y C A N AG     + L V   PK  T        +T   G+  +  C   G P P I W      I   D  N         L I    +   I++C A+N+ G+    + ++ I+ P +       +    GT   + C  E         K  +        IF    K      +++I   +  D G Y+CT  NK    ++  ++ +   PKI    ++ +V  G+QV L C   G     I WY   N  +++T + E     ++ +I   +    +GVY C A N     E  I L V++ P++       +T    TV  + C    GIP+PVI+W R+     +    Y    + L I N L  +D+G   CIAK+ AG+   T ++ V        PI V  DE          +GKPK T             + +R     +N   +     ED+     I  R      ++ T L +   P+F+ KPK             RC A   P P I W  +G+ IE          + +    + ++GEY C+A+N VGS   S  + V       +  +  PS + K   ++ C    +  S  + W  NGV + +N + + ++N+ +L+I   +  K  D  +Y C   N    +   +    +  P    +   +  N G+ ++L C     P+ T + W KN + +  D    ++ N SL ++ V+K   GVY CVAS++ G+         + + GG S  + + K
Sbjct: 2420 LKAGKPLQSDKFVKT-SANGQKLYLFKLRETDSSKYTCIATNEAGTDKR--DFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKGSPSPTITWLKDGNAIEPNDRYVFFD---AGRQLQISKTEGSDQGRYTCIATNSVGSDDLENTLEVIIPPVIDGERREAVAVIEGFSSELFCDSNSTGV---DVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSISDELSSANIQTIVPYYP--VEINCVVSGSPHPKVYWLFD-----DKPLEPDSAAYELTNNGETLKIVRSQVEHAGTYTCEAQNNVGKARKDFLVRVT---APPHFEKEREEVVARVGDTMLLTCNAESSVPLSSVYWHAHDESVQNGVITSKYAANEKTLNVTNIQLDDEGFYYCTAVNEAGITKKFFKLIVIETPYFL-DQQKLYPIILGKRLTLDCSATGTPPPTILFMKDGKRLNESDEVDII----GSTLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPPKLSKEWI-NVEVQAGDPLTLECPIEDTSG---VHITWSRQFGKDGQLDMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGGAEAVFQVTVNTPPKIFGDSFSTTEIVADTTLEIPCRTEGIPPPEISWFLDGKPILEMP----GVTYKQGDLS-LRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEPPRVVMASEVMRVVEGRQTTIRCEVFGNPEPVVNWLKDGE---PYTSDLLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQTTTDVEVLVP--------PRIEDEERVLQGKEGNTYMVHCQVTGRPVPYVTWKRNGKEIEQFNP-----------VLHIRNATRADEGKYSCIASNEAGTAVADFLIDVFTKPTF---ETHETTFNIVEGESAKIECKIDGHPKPTISWLK-------GGRPFNMDNIILSPRGDTLMILKAQRFDGGLYTCVATNSYGDSEQDFKVNVYTKPYIDE-TIDQTPKAVAGGEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNNYDLKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIGKPTFVRKGGNLYE-VIENDTITMDCGVTSRPLPSISWFRGDKPVYLYDRYSISPDGSHITINKAKLSDGGKYICRASNEAGTSDIDLILKILVPPKIDKSNIIGNPLAIVARTIYLECPISGIPQPDVIWTKNGMDINMTDSRVILAQNNETFGIENVQVTDQGRYTCTATNRGGKASHDFSLDVLSPPEFDIHGTQ--PTIKREGDTITLTCPIKLAEDIADQVMDVSWTKDSRALDGDLTDNVDISDDGRKLTISQASLENAGLYTCIALNRAGEASLEFKVEILSPPVIDISRNDVQPQVAVNQPTIMRCAVTGHPFPSIKWLKNG-----------KEVTDDENIRIVEQGQVLQILRTDSDHAGKWSCVAENDAGVKELEMVLDVFTPPVVSVKSDNPIKAL--GETITLFCNASG--NPYPQLKWAKGGSLIFDSPDGARISLKGARLDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVLVPPEINRDGIDMSPRLPAQQSLTLQ--CLAQGKPVPQMRWTLNGTAL---THSTPGITVASDSTFIQINNVSLSDKGVYTCYAENVAGSDNLMYNVDVVQAPVISNGG----TKQVIEGELAVIECLVEGY--PAPQVSWLRNGNRVETGVQGVRYVT--DGRMLTIIEARSLDSGIYLCSATNEAGSAQQAYTLEVLVSPKIITSTP---GVLTPSSGSKFSLPCAVRGYPDPIISWTLNGNDIK--DGENGHTIGADGTLHIEKAEERHLIYECTAKNDAGADTLEFPVQTIVAPKISTSGNRYINGSEGTETVIKCEIESESSEFSWSKNGVPLLPSNNLIFSEDYK------LIKILSTRLSDQGEYSCTAANKAGNATQKTNLNVGVAPKIMERPRTQVVHKGDQVTLWCEASGVPQPAITWYK-DNELLTNTGVDETATTKKKSVIFSSISPSQAGVYTCKAENWVASTEEDIDLIVMIPPEVVPERMNVSTNPRQTVF-LSCNAT-GIPEPVISWMRDSNIAIQNNEKYQILGTTLAIRNVLP-DDDGFYHCIAKSDAGQKIATRKLIVNKPSDRPAPIWVECDE----------KGKPKKT-----------EYMIDRGDTPDDNPQLLPWKDVEDSSLNGSIAYRCMPGPRSSRTVL-LHAAPQFIVKPK-NTTAAIGAIVELRCSAAGPPHPTITWAKDGKLIEDSKFEIAYSHLKVTLNSTSDSGEYTCMAQNSVGSSTVSAFINV----DNNILPTPKPSSNQKNVAVITCYERNQAYSRGLTWEYNGVPMPKNLAGIHFMNNGSLVILDTSSLKEGDLELYTCKVRNRRRHSIPHLTSAFEGVPEVKTI-DKVEVNNGDSVVLDCEVTSDPLTTHVVWTKNDQKMLDDDAIYVLPNNSLVLLNVEKYDEGVYKCVASNSIGKAFDD---TQLNVYGGSSRREAYKK 4848          

HSP 8 Score: 563.148 bits (1450), Expect = 3.692e-160
Identity = 573/2397 (23.90%), Postives = 983/2397 (41.01%), Query Frame = 1
Query: 1735 ASIEPFKDAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITA------SCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSA-TGVPQPKITWEFNGSPV---TIDGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDN-------SLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKN-GKEIEYSNRIMAKDNT--LVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFA-PYIDMKTPNKNITYNP-IIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAINIGESL--NFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTY--ME---TIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPK--IVSLDPDKKRWILKDGELRLSC-----NSDAAPVATIEWFKDGELIRNNL--RVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRI-DFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSG-GSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPIL-----IGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFR-ETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVN-KEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNG--ITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISVTGDEGSSVTIICKVEGKPKPT--VTWKKDGQSL-QNVLGNRFRFNSENEI-NIYDLKPEDTGNYIC-IGERSGAEASTASTYLSIFTRPKFVYKPKLKN---VVQETRWKSFRCEATSHP-KPDIKWMFNGRAI--ESKLNSNGRGSITLQSVRSENAGEYKCIAKNRVG 8745
            A IE F  +EL C+  S S+ V ++W K        N    R + + + P++   K+  LSA +SD+G Y C+  +  G +  +     +  P+ S    E+S  +  +I        +C    +P P   W  + + L+P      + N+ +   +KI   + + +G   C+A+N+ G    +  L  ++ P     +  + +   GD   + C+A + VP   + W  +   V    I      NE   TL++  I+ + +G + C A N AG ++K F L +   P   D         G+ +T+ C   G PPP + +++             D   +N+ +       +L+I     E +  Y C A+N+ G+ ++ + + +  +  PK++  +   V V++     + C  +E      I+W +  GK+ +   R  +  +   L I     ED   Y+CIA N  G A+   ++ V T P I GD  +  +      + + C+T+G P P+I W   G+P+   PG  +        L + +I     G +TC A N      ++  V +  PP++         +       + C +  GNP P + W K+G+P       ++ + + + L +      + G+Y C ATN+         + +LV P+  D + + +  KEG    ++C++ G P P   W      ++ Q NP            L I       +G Y+C  +N  G+A   + + +   P          +    +  + C   G+P P I WL   +   P  +   ++    +TL++ +A    GG Y+C+A N  G  +++  V V+  PYID     + I   P  + GG I   C +   P   + W + +     ++P D     ++   L +  V   D+G Y C+A+N   +L  ++   V+  PT + K    ++  + E   + + C     P P   W++ +  +    R  I+  G  + I K + SD   Y C  +NEAG    +  + + VPP I+  ++   P  +   T  L C +SG P P + WT   M+   T +  +L  NN      NV  +   RYTC ATN  G A   F   +  PP+  I    P  KR   +   + L+C        A  V  + W KD   +  +L   V+I++ G +L +  A   + G+Y C+  N+ G     + V+I+ PP I  +      QVA+     + C   G P P I+W K+G  + D   + + + G  L +  T    AG++ C+AEN  G  ++   + V   P +        K    +G T+ L C  SG P P + W K G  I   P    RI     +L+I  ++ +D G Y+C A N  G  E  + V +  PP I+R+ I     +     L L C A G P P + +  +G +L                + V+ +   + + +   +D G+Y C A N  G D + Y+V V   P       +  +     +   +EC + G   P  +++W R+G  + +G   +R   DG  +T+   +  D+G Y C A NE       + +EV + P+   +     +     +   + C   GYP P + W     +I   +  +     +  +  + I   + +    Y CTA N  G    +F +  I+ PKI   + G       E  +    C + + +        +K   P+L     I   DY L       + IL+ +  + G Y+C A N AG  +    L V   PK      + R  T  V  G  V   C A G P P+I W YKD  +     ++   +   K +   S++  + G++ C A N V S  +   L V++P  V  +++ V      +  + C A G P+PVI W RD     +   K       L I +   +D G Y C   +   Q   +  +++  P    +P           + + C  +G      +    G+    +  L  ++ + +  L       + S  YRC+     G +  R  L       I +P    TT  +  +++++C    G P P ITW ++G  I  SK +  Y+     L   NS    D G  TC+A+N  G   ++  I V+      LP         +V +I   E     +  +TW+ +G  + +N+ G  F  N    I +   LK  D   Y C +  R        ++        K + K ++ N   VV         CE TS P    + W  N + +  +  +      S+ L +V   + G YKC+A N +G
Sbjct: 2581 AVIEGFS-SELFCD--SNSTGVDVEWQKDGLTI---NQDTLRGDSFIQIPSS-GKKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSIS---DELSSANIQTIVPYYPVEINCVVSGSPHPKVYWLFDDKPLEPDSAAYELTNNGE--TLKIVRSQVEHAGTYTCEAQNNVG-KARKDFLVRVTAPPHFEKEREEVVARVGDTMLLTCNAESSVPLSSVYWHAHDESVQNGVITSKYAANEK--TLNVTNIQLDDEGFYYCTAVNEAGITKKFFKLIVIETPYFLDQQKLYPIILGKRLTLDCSATGTPPPTILFMK-------------DGKRLNESDEVDIIGSTLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEV--LLPPKLS-KEWINVEVQAGDPLTLEC-PIEDTSGVHITWSRQFGKDGQLDMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGGAEAVFQVTVNTPPKIFGDSFSTTEIVADTTLEIPCRTEGIPPPEISWFLDGKPILEMPG--VTYKQGDLSLRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEPPRVVMAS-EVMRVVEGRQTTIRCEVF-GNPEPVVNWLKDGEPYTS--DLLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQTTTDVEVLVPPRIEDEERV-LQGKEGNTYMVHCQVTGRPVPYVTWKRNGKEIE-QFNPV-----------LHIRNATRADEGKYSCIASNEAGTAVADFLIDVFTKPTFETHETTFNIVEGESAKIECKIDGHPKPTISWLKGGR---PFNMDNIILSPRGDTLMILKAQRFDGGLYTCVATNSYGDSEQDFKVNVYTKPYID-----ETIDQTPKAVAGGEIILKCPVLGNPTPTVTWKRGD----DAVPNDSRHTIVNNYDLKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIGKPTFVRK--GGNLYEVIENDTITMDCGVTSRPLPSISWFRGDKPVYLYDRYSISPDGSHITINKAKLSDGGKYICRASNEAGTSDIDLILKILVPPKIDKSNIIGNPLAIVARTIYLECPISGIPQPDVIWTKNGMDINMTDSRVILAQNNETFGIENVQVTDQGRYTCTATNRGGKASHDFSLDVLSPPEFDIHGTQPTIKR---EGDTITLTCPIKLAEDIADQVMDVSWTKDSRALDGDLTDNVDISDDGRKLTISQASLENAGLYTCIALNRAGEASLEFKVEILSPPVIDISRNDVQPQVAVNQPTIMRCAVTGHPFPSIKWLKNGKEVTDDENIRIVEQGQVLQILRTDSDHAGKWSCVAENDAGVKELEMVLDVFTPPVVSVKSDNPIKA---LGETITLFCNASGNPYPQLKWAKGGSLIFDSPD-GARISLKGARLDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVLVPPEINRDGIDMSPRLPAQQSLTLQCLAQGKPVPQMRWTLNGTAL----------THSTPGITVASDSTFIQINNVSLSDKGVYTCYAENVAGSDNLMYNVDVVQAPVISNGGTKQVIE---GELAVIECLVEGY--PAPQVSWLRNGNRVETGVQGVRYVTDGRMLTIIEARSLDSGIYLCSATNEAGSAQQAYTLEVLVSPKIITSTPGV-LTPSSGSKFSLPCAVRGYPDPIISWTLNGNDIKDGENGH----TIGADGTLHIEKAE-ERHLIYECTAKNDAGADTLEFPVQTIVAPKI--STSGNRYINGSEGTETVIKCEIESESSEFSW---SKNGVPLLPSNNLIFSEDYKL-------IKILSTRLSDQGEYSCTAANKAGNATQKTNLNVGVAPKI-----MERPRTQVVHKGDQVTLWCEASGVPQPAITW-YKDNELLTNTGVDETATTKKKSVIFSSISPSQAGVYTCKAENWVASTEEDIDLIVMIPPEVVPERMNVSTNPRQTVFLSCNATGIPEPVISWMRDSNIAIQNNEKYQILGTTLAIRNVLPDDDGFYHCIAKSDAGQKIATRKLIVNKPSDRPAP-----------IWVECDEKGKPKKTEYMIDRGDTPDDNPQLLPWKDVEDSSL-------NGSIAYRCM----PGPRSSRTVLLHAAPQFIVKP--KNTTAAIGAIVELRCS-AAGPPHPTITWAKDGKLIEDSKFEIAYSHLKVTL---NS--TSDSGEYTCMAQNSVGSSTVSAFINVD---NNILPTPKPSSNQKNVAVITCYERNQAYSRGLTWEYNGVPMPKNLAGIHFMNNGSLVILDTSSLKEGDLELYTCKVRNRRRHSIPHLTSAFEGVPEVKTIDKVEVNNGDSVV-------LDCEVTSDPLTTHVVWTKNDQKMLDDDAIYVLPNNSLVLLNVEKYDEGVYKCVASNSIG 4826          

HSP 9 Score: 256.144 bits (653), Expect = 3.198e-67
Identity = 276/1092 (25.27%), Postives = 455/1092 (41.67%), Query Frame = 1
Query: 6199 ASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMS------CECTGYPPPTLLWYRQEQEIL--ADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDY-YLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPA-EGSPTPSIMWFY--KDMPISPYDMMNFVISNNAKVLTIPSVNKEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRYGTKTDSR-----TGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVI---ISPPKIESPKKSIMVRVGEQVLLPCIVE-GTRPFRIHWYT---PGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPK---------IFRPT----ETETTGVLNTV--------LQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPIS----VTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLNSNG---RGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILM--CKVEGKVDSI-VWLKNGVIVQNSSRLYIND--FNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPG---NISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIK-NGSLRIIGVQKEHSGVYFCVASSNQGEVHS 9291
            A  AIG      SV V  P  F    + P    F  +  +L CT+   +     I W + G  +  G     + D +  T+  +   DAGEY+C   +     S+   VE    P         +I  V+N +V +       C         + W R    +    + ER P       N  ++I ++   DA  Y C A N GG   +K  + ++ PP +    + P++  V  NM+   + S       KP + W  +   +L    DY Y    + + L I +    + G Y C A + AGQ   T  L + +PPK      I +  + V  G  V+F+C    G P P I WF   KD+ I P D   ++  N  ++  + + +++ G + C+  N  G  ++V  L V     +      VR       ++ C A G P P I+W    KG     T  + R      G L ITDA+ ED G++TC   N   Q S+S  +++   +SP     P +  ++  G+ + L C+V  GT    I W     P     +  I G    L  +G           G Y C+A + AG   + I ++++ +P+         +F+PT    + +   V+N+           + C ++ G P P+ITW  +G  ++     +T T     I         G  TC A N AG++     I +   P +S   S    V  D     TI C V G PKP +TW  D +     +      N +  + I ++     G + C  + + A   T +  L++ T P    + + K  +Q        C A + P P   W + G  I+S+L  +     G++ LQ+V+ EN G + C   N  G    S+ L V  KP++ + +     + +K   +   C+  G  + I  W KNG+ ++   + +  D    L I +A   D G Y C+ +N AG +Q   H+ V+ PP+  +LP    N +A +G+ + L C  E  P  +++W++    I  D    +++ +G+L I     E + +Y C AS+  G+  +
Sbjct:  418 APTAIG------SVIVGGPRAF----MSPIHQEFVGRDLNLSCTVESAS--AYTIYWVKTGEDIIGGPLFYHNTDTSVWTIPELSLKDAGEYECRVISNNGNYSVKTRVETRESP--------PEIFGVRNVSVPLGEAAFLHCSTRSAGEVEIRWTRYGATVFNGPNTERNPT------NGTLKIHHVTRADAGVYECMARNAGGMSTRKMRLDIMEPPSV---KVTPQD--VYFNMREGVNLSCEAMGDPKPEVHWYFKGRHLL---NDYKYQVGQDSKFLYIRDATHHDEGTYECRAMSQAGQARDTTDLMLATPPKV----EIIQNKMMVGRGDRVSFECKTIRGKPHPKIRWFKNGKDL-IKPDD---YIKINEGQLHIMGAKDEDAGAYSCVGENMAGKDVQVANLSVGRVPTIIESPHTVRVNIERQVTLQCLAVGIPPPEIEWQ---KGNVLLATLNNPRYTQLADGNLLITDAQIEDQGQFTCIARNTYGQQSQSTTLMVTGLVSPVLGHVPPEEQLIE-GQDLTLSCVVVLGTPKPSIVWIKDDKPVEEGPTIKIEGGGSLLRLRG-----GNPKDEGKYTCIAVSPAGNSTLHINVQLIKKPEFVYKPEGGIVFKPTISGMDEKHVAVVNSTHDVLDGEGFAIPC-VVSGTPPPIITWYLDGRPITPNSRDFTVTADNTLIVRKADKSYSGVYTCQATNSAGDNEQKTTIRIMNTPMISPGQSSFNMVVDD---LFTIPCDVYGDPKPVITWLLDDKPFTEGV-----VNEDGSLTIPNVNEAHRGTFTCHAQNA-AGNDTRTVTLTVHTTPTINAENQEKIALQNDDI-VLECPAKALPPPVRLWTYEGEKIDSQLIPHTIREDGALVLQNVKLENTGVFVCQVSNLAGEDSLSYTLTVHEKPKI-ISEVPGVVDVVKGFTIEIPCRATGVPEVIRTWNKNGIDLKMDEKKFSVDNLGTLRIYEADKNDIGNYNCVVTNEAGTSQMTTHVDVQEPPI--ILPSTQTNNTAVVGDRVELKCYVEASPPASVTWFRRGIAIGTDTKGYVVESDGTLVIQSASVEDATIYTCKASNPAGKAEA 1444          

HSP 10 Score: 61.6178 bits (148), Expect = 1.953e-8
Identity = 63/301 (20.93%), Postives = 127/301 (42.19%), Query Frame = 1
Query: 2002 HTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPK-ITWEFNGSPV--TIDG-NIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQP-PPRVKWLRGIAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQ 2889
            H  P   V  K  +      +   C A   P PT +W  +G+ ++ +   I+       S +K++     DSGE  C A+NS G   V    ++I++   + L   K    + +   + C        + +TWE+NG P+   + G + + N ++  LD + +++     + C   N    S           P +K  +  ++ + G+++ + C+V   P    V W +      +  +   D  ++  +NSL++  +   D+  Y C A N  GK  +  Q+ + G ++ + A+ +  +
Sbjct: 4567 HAAPQFIVKPKNTTAAIGAIVELRCSAAGPPHPTITWAKDGKLIEDSKFEIAY------SHLKVTLNSTSDSGEYTCMAQNSVGSSTVS---AFINVDNNI-LPTPKPSSNQKNVAVITCYERNQAYSRGLTWEYNGVPMPKNLAGIHFMNNGSLVILDTSSLKEGDLELYTCKVRNRRRHSIPHLTSAFEGVPEVKT-IDKVEVNNGDSVVLDCEVTSDPLTTHVVWTKN-----DQKMLDDDAIYVLPNNSLVLLNVEKYDEGVYKCVASNSIGKAFDDTQLNVYGGSSRREAYKKENE 4851          

HSP 11 Score: 59.3066 bits (142), Expect = 9.191e-8
Identity = 36/96 (37.50%), Postives = 46/96 (47.92%), Query Frame = 1
Query: 11851 CKTGFTWTSD-RGCIDIDECTSYTNPHSCQHQCINTYGSYHCLCPQGFSLNPKTMKCLDVDECRTNLGICSEKKLCINTPGNYSCIEPKCPKSYHF 12135
            C  GF      R C D+DEC  Y     C  +CIN  G + C CP G+ L  +   C DV+EC +    C + K C N  G Y CI+  CP +Y  
Sbjct: 4958 CPEGFAMNPHTRICEDLDECAFY---QPCDFECINYDGGFQCNCPLGYELAEE--GCRDVNECESVR--CEDGKACFNQLGGYECIDDPCPANYSL 5046          

HSP 12 Score: 55.8398 bits (133), Expect = 1.201e-6
Identity = 34/85 (40.00%), Postives = 44/85 (51.76%), Query Frame = 1
Query: 11032 CPPGFTLIKSQRFCEDVNECKNAKFHKCDQICENTVPRFKCNCRSGFMLSSDGKSCQDINECSKNISPCSEPNHECINTPGSYMC 11286
            CP GF +    R CED++EC  A +  CD  C N    F+CNC  G+ L+ +G  C+D+NEC    S   E    C N  G Y C
Sbjct: 4958 CPEGFAMNPHTRICEDLDEC--AFYQPCDFECINYDGGFQCNCPLGYELAEEG--CRDVNECE---SVRCEDGKACFNQLGGYEC 5035          
BLAST of Hemicentin-1 vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 949.118 bits (2452), Expect = 0.000e+0
Identity = 849/3136 (27.07%), Postives = 1379/3136 (43.97%), Query Frame = 1
Query:  205 SDPSTGISLAIVFDSTGSMGNDLKQVKRGSRRILNNHLQKGYKKFIKDFVLVQVHDPDVGPXXXXXXXXXXXXYLDYVFTQGGGDCPEMTISGIEMALEASRPHSLIYVFTDSSAKDYEITPRVLNLIQKKQSQVVFVLTGFCNSTEEIGFQVYKQIATISSGQIYILGKGDVKEFMKIIERAVETVKVHILQEESSNFGSKTYSFPIDSHITQFTIQVTNFKAN-ESIKVAIRDPEGR----ELTESNGLIRLLKSVKTVYFASKENPAPGMWTLEVTTKSSNHSVRITGASEVDFLPGFSTIPEPSNDRTSRQPIKGAKNYLMANVTGNFLPGTIEWLYIMSVNGSSIIQLPA--NQTENQIYISQYPFEIPVDGHFYIKLSGKDSRGNEMQRYSRIAIFSRDPLPVSVSCPAKI-----QVKRGHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNVTLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKNASIEPFKDAELECNVFSTSSNVVLKWFK-SIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRC-SATGVPQPKITWEFNGSP-VTIDGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRG--IAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEY--SNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGD------FKTFI---------------DAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDN-TITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAINIG--ESLNFTLVVLISPTILGKHSSKSVI---NINEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRV-EITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXX-------XXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFD-----PVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGN-LYLFCVSEGRPKPKIEWRKDGSRIDFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINR------LPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTL---MGVADPPAKITWERHGVP-LSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFY-KNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVK-ENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLT-FNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISN--NAKVLTIPSVNKEG--GIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKP--VIKWTRDGKGIFRYG-TKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPK--KSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFL-SEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPV----------ITWERNGITLS----KVKNYYTTTDSGLFI-FNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISVTGDEG----SSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEA-TSHPKPDIKWMFNGRAIE-----SKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGK-VDSIVWLKNGVIVQNSSRLYINDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKN-KKLIKYDF-VKSLIKNGSLRIIGVQKEHSGVYFCVASSNQG 9279
            +DP+   SLA VFD TGSM +DL QV+ G+ +I    + +  +K I ++++V  HDP +G    TT +  F + L  V+  GGGDCPE T++GI  AL+ S P S IYVFTD+ +KDY +   VLN IQ+KQS VVFV+TG C +    GF+ Y++IA  S GQ++ L K DV   ++ +  AV+  KVH++ E     G+ + + P+D H+++ TI ++  K + +++ + +RDPEGR     L    G    LK+VK +     ++P+PG+WT+   ++   H++R+ G   VDF  GF++ P    +    +P+     YL+ N+TG   PGT+  + ++  +G S+ +  A  ++T   +Y +  PF +P  G F++++ G D    E  R +  AI S     V V  P        Q   G  + ++C V+S   Y I W K    II      + +  T      I   +    G Y   ++       +  GN   +  V     PP++F  +N S+   + A L C+  S +  V ++W +     +   NT+R          N  +  L I   + +D G Y C+A + GG+S     +     P+  V  +++ F   + +  SC A+  P P   W+  GR L   D +  +  D +   + I +    D G   C+A + AG       L   + PK+  +   K +   GD+ +  C +  G P PKI W  NG   +  D  I INE  G L I   +    G + CV  N AG   +  NL +G  P I +    +  +    +T++C   G PPP ++W +G  +    N P     RY    D +L+I    +EDQ  + C A+N +G+  +S  + ++G+ +P +     ++ ++E      + C+VV   P   I W+K+ K +E   + +I    + L ++    +DE  YTCIA +  G +   I + +  KP  +        FK  I               D  DG+   + C   G P P I W   GRP+T  P  R       + L V    + ++G +TC ATN      ++  + +   P IS  G S + +   +   + C +  G+P P I W  + +P  E  G V   G   I  V   NE   G++ C A N   +D+R   +T+   P  +     KI   + + + L C     P P + W+++   +D Q  P  I     +   L++  ++ E  G++ C  +N+ G   +SY + + E PKII      V  +   TI + C A+G   P++   + K  I       K   +N  TL +  A     G Y+C+  NE G  Q  + V V  P I + +   N   N  +VG  +   C + ++PPA + WF+  I I        + +  DG TL +      D+ IY C A N       N  + V+ SP I        V+   +I E     + C    NP P+  WY ++  LI      + ++  + L + K + +D  VY+C   N AGE  K+F V V VP +++    ++     +G    L C VSGFP PQI W    T+           L ++   LHF +V       Y C+A ++      + D      VL  P  IV  D + + ++ KD  L     +++    T  W  +G        V I + G +L++ +A+  + G Y C V+N  G  ++  T+D++ PP +       A+Q  +G N + L C   G PKP + W+ DG+ +D  +  L D+   L     +   + +  C AEN  G     F +Q    PT    G +      +   T+ L+C VS +    ITW+K G+P+        L + R  I+  ++  E I         Y+CVA NT GQ+    DV +   P I    +  E  I  G+E+ L C A G+P P   +  D N  D+            K  +       + + +  +  +G+Y+C A+N +G  V   +V VRT P F++   E ++     ++ +LEC +   +GV      I+W  +G P L+    ++    G  + + + K  D G Y C   NE    +  FN+ V + P    +   YT IE   N ++ + CE TG P P + W +  + +   K       +L      +I + +     +Y C A N  GT E  F++ +I  P I K   G +N     +   + F C + +    K  I+W +   PI +   D  +T  +N + LTILN   ++ G+Y+C  KN AG++S  F  TV  PP         +    V+  T V   CPA G P P I WF     I   ++ + + +   N   L I  + KEG  G + C A N  GS+ +   + VI    +  D I     S  +  V+ +   Y +P   I W + GK +      KT +    L +   +E D+ +YTC  TN+   D +   V ++  P  + P   + I V  G    L C  +G+    I W   GN    +     Y F  + + L I +      G Y C+A N  G  ++  TLEV++ P            V++   +    ++EG    +          + W+++G+T++    +  ++     SG  + F S +  D G  TCI +N AGE R  F   V   P +S  +S    +       V I C V G P P V W  D + L+         N+   + I   + E  G Y C  + +  +A     +L   T P    K + + V +        C A +S P   + W  +  +++     SK  +N + ++ + +++ ++ G Y C A N  G  +  F L VI  P     Q   P    KR  L C   G    +I+++K+G  +  S  + I    L+I+  + +  G Y CIA N AG ++  + + V  PP  +    N+    G+ L L C  E      I+W +   K  + D   +S      L I+    E +  Y C+A ++ G
Sbjct:   29 NDPTGKSSLAFVFDITGSMFDDLVQVREGAAKIFKTVMAQ-REKLIYNYIMVPFHDPYLGEIINTTDSTYFMRQLSKVYVHGGGDCPEKTLTGILKALQISLPSSFIYVFTDARSKDYHLEDEVLNTIQEKQSSVVFVMTGDCGNRTHPGFRTYEKIAAASFGQVFHLEKSDVSTVLEYVRHAVKQKKVHLMYEARERGGTVSRNIPVDKHLSELTISLSGDKDDSDNLDIVLRDPEGRTVDKRLYSKEGGTIDLKNVKLIRL---KDPSPGVWTVNTNSRLK-HTIRVFGHGAVDFKYGFASRPLDRIELARPRPVLNQDTYLLINMTGLIPPGTVGEIDLVDYHGHSLYKAVASPHRTNPNMYFAG-PF-VPPKGLFFVRVQGYDEDNYEFMRIAPTAIGS-----VIVGGPRAFMSPIHQEFVGRDLNLSCTVESASAYTIYWVKTGEDIIGGP---LFYHNTDTSVWTIPELSLKDAGEYECRVI-------SNNGNYSVKTRVETRESPPEIFGVRNVSVPLGEAAFLHCSTRS-AGEVEIRWTRYGATVFNGPNTER----------NPTNGTLKIHHVTRADAGVYECMARNAGGMSTRKMRLDIMEPPSVKVTPQDVYFNMREGVNLSCEAMGDPKPEVHWYFKGRHL-LNDYKYQVGQDSK--FLYIRDATHHDEGTYECRAMSQAGQARDTTDLMLATPPKV-EIIQNKMMVGRGDRVSFECKTIRGKPHPKIRWFKNGKDLIKPDDYIKINE--GQLHIMGAKDEDAGAYSCVGENMAGKDVQVANLSVGRVPTIIESPHTVRVNIERQVTLQCLAVGIPPPEIEWQKGNVLLATLNNP-----RYTQLADGNLLITDAQIEDQGQFTCIARNTYGQQSQSTTLMVTGLVSPVLGHVPPEEQLIEGQ-DLTLSCVVVLGTPKPSIVWIKDDKPVEEGPTIKIEGGGSLLRLRGGNPKDEGKYTCIAVSPAGNSTLHINVQLIKKPEFVYKPEGGIVFKPTISGMDEKHVAVVNSTHDVLDGEGFAIPCVVSGTPPPIITWYLDGRPIT--PNSRDFTVTADNTLIVRKADKSYSGVYTCQATNSAGDNEQKTTIRIMNTPMISP-GQSSFNMVVDDLFTIPCDV-YGDPKPVITWLLDDKPFTE--GVVNEDGSLTIPNV---NEAHRGTFTCHAQNAAGNDTRTVTLTVHTTPTINAENQEKI-ALQNDDIVLECPAKALPPPVRLWTYEGEKIDSQLIPHTIR----EDGALVLQNVKLENTGVFVCQVSNLAGEDSLSYTLTVHEKPKIISEVPGVVDVVKGFTIEIPCRATG--VPEVIRTWNKNGIDLKMDEKKFSVDNLGTLRIYEADKNDIGNYNCVVTNEAGTSQMTTHVDVQEPPIILPSTQTN---NTAVVGDRVELKCYVEASPPASVTWFRRGIAI--GTDTKGYVVESDG-TLVIQSASVEDATIYTCKASNPAGKAEANLQVTVIASPDI----KDPDVVTQESIKESHPFSLYCPVFSNPLPQISWYLNDKPLIDDKTSWKTSDDKRKLHVFKAKITDSGVYKCVARNAAGEGSKSFQVEVIVPLNLDESKYKKKVFAKEGEEVTLGCPVSGFPVPQINWVVDGTVVEPGKKYKGATLSNDGLTLHFDSVSVKQEGNYHCVAQSKG----NILDIDVELSVLAVP--IVGEDDNLEVFLGKDISLSCDLQTESDDKTTFVWSINGSESDRPDNVQIPSDGHRLYITDAKPENNGKYMCRVTNSAGKAERTLTLDVLEPP-VFVEPVFEANQKLIGNNPIILQCQVTGNPKPTVIWKIDGNDVD--KSWLFDESLSLLRIEKLTGKSAQISCTAENKAGTASRDFFIQNIAAPTFKNEGDQETIFRES--ETITLDCPVS-LGDFQITWMKQGLPLTENDAIFTLDNTRLTILNANRDHEDI---------YTCVANNTAGQVSKDFDVVVQVLPKIKNAVVTLE--INEGEEIILTCDAEGNPTPTAKW--DFNQGDL-----------PKEAVFVNNNHTVVVNNVTKYHTGVYKCYATNKVGQAVKTINVHVRTKPRFESGLTESELTVNLTRSITLECDVDDAIGVG-----ISWTVNGKPFLAETDGVQTLAGGRFLHIVSAKTDDHGSYACTVTNEAGVATKTFNLFVQVPPTIVNEGGEYTVIE---NNSLVLPCEVTGKPNPVVTWTKDGRPVGDLK----SVQVLSEGQQFKIVHAEIAHKGSYICMAKNDVGTAEISFDVDIITRPMIQK---GIKNIVTAIKGGALPFKCPIDDDKNFKGQIIWLRNYQPIDLEAEDARITRLSNDRRLTILNVTENDEGQYSCRVKNDAGENSFDFKATVLVPPTIIM-LDKDKNKTAVEHST-VTLSCPATGKPEPDITWFKDGEAIHIENIADIIPNGELNGNQLKITRI-KEGDAGKYTCEADNSAGSVEQDVNVNVITIPKIEKDGIPSDYESQQNERVVISCPVYARPPAKITWLKAGKPLQSDKFVKTSANGQKLYLFKLRETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKGSPSPTITWLKDGNAIEPN---DRYVFFDAGRQLQISKTEGSDQGRYTCIATNSVGSDDLENTLEVIIPP------------VIDGERREAVAVIEGFSSELFCDSNSTGVDVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSISDELSSANIQTIVPYYPVEINCVVSGSPHPKVYWLFDDKPLEPDSAAYELTNNGETLKIVRSQVEHAGTYTCEAQNNVGKAR--KDFLVRVTAPPHFEKEREEVVARVGDTMLLTCNAESSVPLSSVYWHAHDESVQNGVITSKYAANEK-TLNVTNIQLDDEGFYYCTAVNEAGITKKFFKLIVIETPYFLDQQKLYPIILGKRLTLDCSATGTPPPTILFMKDGKRLNESDEVDIIGSTLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPPKLSKEWINVEVQAGDPLTLECPIEDTSGVHITWSRQFGKDGQLDMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAG 3021          

HSP 2 Score: 744.191 bits (1920), Expect = 0.000e+0
Identity = 711/2709 (26.25%), Postives = 1168/2709 (43.12%), Query Frame = 1
Query: 1438 VKRGHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNVTLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKNASIEPFKDA-ELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILS-----LDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRI-KDFVTNIDGSYGENITIRCQVEGQPPPRVKWLR-GIAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKV----IVCLVVESKPPAVISWLKNGKE-IEYSNRIMAKDNTLVIKTVKAE--DEAIYTCIAKNQVG--TAKFDIELDVQTKPIIIGD--FKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLR---IVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNC-IITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPK------ASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKN---DLLITQMRSE-LQG---IYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDN-TITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAIN-IGESLNFTLVVLISPTILGKHSSKSVININEETDLYITC-----------WS-EGNPAPRYLWYKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEF--LKGSTTNLWCNVSGFPTPQIRWTY----METIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFD-PVLTYPPKIVSLDPDKKRWILKDGELRLSC--NSDAAPVATIEWFKDGE---LIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRRV--LLSD---DGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRY-RIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSS----GGS-IRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEA-VQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPV--ILWTKENSPILIGD-TDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKE-GGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTR----DGKGIFRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVL-LPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQG---LIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISV-TGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESK---LNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSE-SIKRTILMCKVEGK-VDSIVWLKNGVIVQNSSRLYI-NDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANL-GEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNGSLRIIGVQK-EHSGVYFCVASSNQG 9279
            V  G G  + C+V    P +I WY +   I     D   F  T++ TL + +A++   GVY          Q T      +Q     +   P +   +++      D   + C+V+     V+       P              + +        L I + +E+  G + C A++  G       +  HT P  + + +E   + ND I   C A + PPP   W   G ++D      +I  D     + + NVK +++G  +C+  N AG D +   L+    PKI+S     +D+ K   +E     + C ATGVP+   TW  NG  + +D      + +GTL I   +KN  G + CV TN AG+S+ + ++D+   P I     TN     G+ + ++C VE  PP  V W R GIA G +        Y +  D +L+I+  S+ED + Y C A N  GK + ++Q+ +  IA+P I   +   VV + ++K+     + C V  S P   ISW  N K  I+        D+   +   KA+  D  +Y C+A+N  G  +  F +E+ V   P+ + +  +K  + AK+G+ + L C   G P P+I W   G    +EPG +     +S DG  L   S++ +  G + C A +    +  + ++SV A P + ++   + E+   +++ L+C + T  +      W  NG    + P  V+I    + L +     +  G Y C+ TN      R   + +L  P        ++ K+I         + L C++ G P PT  W               I  + +DK+   D  ++ +R E L G     +C   N  G+A   + +  + +P      D+  +F ++ TITL C  S     +I W+ +   +  N   + +   +   L +  A   H   Y+C+A N  G+  K+  V V    +  K  N  +T   I  G  I  +C     P    KW  N+ D    LPK+   ++ + + +     K+  +G+YKC A N +G+++    V + +        ++S + +N    + + C           W+  G P   +L   D  Q ++GGR         L I   +  D   Y C VTNEAG   K F++ V VPP+I    + E  E+  ++ ++  L C V+G P P + WT     +  + S  +LS   Q   ++ + +H   Y C+A N+ G+A   FD  ++T P  ++          +K G L   C  + D      I W ++ +   L   + R+   +   +L +LN  E+D G Y C V N  G +   +   +++PP+I    K           + L C + G+P+P I W KDG  I    +  ++ +   +G  L +    E DAG+Y C A+N+ G  +   +V V   P ++  G      E      VV+ C V   P   ITWLK G P   L S ++ +   N ++L +  ++ +D+ +Y+C+A N  G  +    V++   PS D   I+    +  G+   L CPA GSP+P I + KDGN+++     PN       R +     + L +   + +D G Y C A+N++G D +E ++ V  PP  D    E  V      +  L C           + W++ G+ ++     G S I+I   G +++  + ++ D+G Y C  +N   +   +F+  V   P          I+  V    V+++C  +G P P + W   ++ +  D   Y   ++      ++I   Q + A TY C A N  G   K F + V  PP   K        RV + M +T  C   N   + P+  + W   +  +  G  T  Y    N ++L + N + D+ G Y C A N AG     F L V   P F     ++     + LG  +   C A G+P P+I++      ++  D ++ + S     L I +  KE  G + CIA N+ G   K   +EV++P  +  + I V  ++G   ++ C  E      I W+R    DG+   R  + +D     L I  A  ED   Y+C   N          V + +PPKI     S    V +  L +PC  EG  P  I W+  G       IL       +QG   L ID ++ +  G Y CVA N AG  E    +E+   P++   +E     V      ++C++  G P+PV+ W ++G   +     ++T  S L +  +  + D G+ TCIA N AGE + T  + V + P++     V  G EG++  + C+V G+P P VTWK++G+ ++       +FN    ++I +    D G Y CI       A  A   + +FT+P F       N+V+    K   C+   HPKP I W+  GR        L+  G   + L++ R +  G Y C+A N  G  E  F + V  KP +       P   +    IL C V G    ++ W +    V N SR  I N+++L IN   ++D G Y CIA N AG         V   P F    GN+   +  + + + C     P+P+ISW++  K +      S+  +GS   I   K    G Y C AS+  G
Sbjct: 1012 VLDGEGFAIPCVVSGTPPPIITWYLDGRPITPNSRD---FTVTADNTLIVRKADKSYSGVYTC--------QATNSAGDNEQKTTIRIMNTPMISPGQSSFNMVVDDLFTIPCDVYGDPKPVITWLLDDKP--------------FTEGVVNEDGSLTIPNVNEAHRGTFTCHAQNAAGNDTRTVTLTVHTTPTINAENQEKIALQNDDIVLECPAKALPPPVRLWTYEGEKIDSQLIPHTIRED---GALVLQNVKLENTGVFVCQVSNLAGEDSLSYTLTVHEKPKIISEVPGVVDVVKGFTIE-----IPCRATGVPEVIRTWNKNGIDLKMDEKKFSVDNLGTLRIYEADKNDIGNYNCVVTNEAGTSQMTTHVDVQEPPIILPSTQTNNTAVVGDRVELKCYVEASPPASVTWFRRGIAIGTDT-----KGYVVESDGTLVIQSASVEDATIYTCKASNPAGKAEANLQVTV--IASPDI---KDPDVVTQESIKESHPFSLYCPVF-SNPLPQISWYLNDKPLIDDKTSWKTSDDKRKLHVFKAKITDSGVYKCVARNAAGEGSKSFQVEVIV---PLNLDESKYKKKVFAKEGEEVTLGCPVSGFPVPQINWVVDG--TVVEPGKKYKGATLSNDGLTLHFDSVSVKQEGNYHCVAQSKGNILDIDVELSVLAVPIVGED--DNLEVFLGKDISLSCDLQTESDDKTTFVWSINGSE-SDRPDNVQIPSDGHRLYITDAKPENNGKYMCRVTNSAGKAERTLTLDVLEPPVFVEPVFEANQKLIG-----NNPIILQCQVTGNPKPTVIWK--------------IDGNDVDKSWLFDESLSLLRIEKLTGKSAQISCTAENKAGTASRDFFIQNIAAPTFKNEGDQETIFRESETITLDCPVSLGDF-QITWMKQGLPLTENDAIFTL---DNTRLTILNANRDHEDIYTCVANNTAGQVSKDFDVVV---QVLPKIKNAVVTLE-INEGEEIILTCDAEGNPTPTAKWDFNQGD----LPKEAVFVNNNHTVVVNNVTKY-HTGVYKCYATNKVGQAVKTINVHVRTKPRFESGLTESELTVNLTRSITLECDVDDAIGVGISWTVNGKP---FLAETDGVQTLAGGRF--------LHIVSAKTDDHGSYACTVTNEAGVATKTFNLFVQVPPTI----VNEGGEYTVIENNSLVLPCEVTGKPNPVVTWTKDGRPVGDLKSVQVLSEGQQFKIVHAEIAHKGSYICMAKNDVGTAEISFDVDIITRP--MIQKGIKNIVTAIKGGALPFKCPIDDDKNFKGQIIWLRNYQPIDLEAEDARITRLSNDRRLTILNVTENDEGQYSCRVKNDAGENSFDFKATVLVPPTIIMLDKDKNKTAVEHSTVTLSCPATGKPEPDITWFKDGEAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSAGSVEQDVNVNVITIPKIEKDGIPS-DYESQQNERVVISCPVYARPPAKITWLKAGKP---LQSDKFVKTSANGQKLYLFKLRETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKGSPSPTITWLKDGNAIE-----PND------RYVFFDAGRQLQISKTEGSDQGRYTCIATNSVGSDDLENTLEVIIPPVIDGERRE-AVAVIEGFSSELFCDSNSTG---VDVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSISDELSSANIQTIVPYYPVEINCVVSGSPHPKVYWLFDDKPLEPDSAAY---ELTNNGETLKIVRSQVEHAGTYTCEAQNNVGKARKDFLVRVTAPPHFEKER-EEVVARVGDTMLLT--C---NAESSVPLSSVYWHAHDESVQNGVITSKYAA--NEKTLNVTNIQLDDEGFYYCTAVNEAGITKKFFKLIVIETPYFLDQQKLY----PIILGKRLTLDCSATGTPPPTILFMKDGKRLNESDEVDIIGS----TLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPPKLSKEWINVEVQAGDPLTLECPIEDTSGVHITWSRQFGKDGQLDMRAQSSSDKSK--LYIMQATPEDADSYSCIAVNDAGGAEAVFQVTVNTPPKIFGDSFSTTEIVADTTLEIPCRTEGIPPPEISWFLDG-----KPILEMPGVTYKQGDLSLRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEPPRVVMASEVMRV-VEGRQTTIRCEVF-GNPEPVVNWLKDGEPYTSDLLQFSTKLSYLHLRET-TLADGGTYTCIATNKAGESQTTTDVEVLVPPRIEDEERVLQGKEGNTYMVHCQVTGRPVPYVTWKRNGKEIE-------QFNPV--LHIRNATRADEGKYSCIASNEAGTA-VADFLIDVFTKPTFETHETTFNIVEGESAK-IECKIDGHPKPTISWLKGGRPFNMDNIILSPRGDTLMILKAQRFD-GGLYTCVATNSYGDSEQDFKVNVYTKPYIDETIDQTPKAVAGGEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNNYDLKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIGKPTFVRKGGNLYEVIENDTITMDCGVTSRPLPSISWFRGDKPVYLYDRYSISPDGSHITINKAKLSDGGKYICRASNEAG 3559          

HSP 3 Score: 724.546 bits (1869), Expect = 0.000e+0
Identity = 667/2552 (26.14%), Postives = 1101/2552 (43.14%), Query Frame = 1
Query: 1900 KLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASV---DEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVN-DVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTV-RCSATGVPQPKITWEFNGSPVTIDGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKD--FVTNIDGSYGENITIRCQVEGQPPPRVKWLR-GIAGGYNIPIALGDRY-FINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAV-ISWLKNGKEIEYSN-------RIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIV------LQCQTKGDPKPKIEWRKGGRPLTMEP-GLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSK--ENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIY-TKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQET-LIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAIN-IGESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLF-DPVLTYPPKIVSLDPDKKRWILKDGE-LRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRI--DFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPT-LDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLM---GVADPPAKITWERHGVPLSSG--GSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFL-------------------------KPR---------------FYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVN-KEGGIFKCIARNEVGSIMKVYKLEVIM-PALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGK----GIFRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDV-VIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKV-SLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSF-RCEATSHPKPDIKWMFNGR-AIESKLNSNGRGS-ITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGKVDSIVWL--KNGVIVQNSSRLYINDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQG 9279
            +L IL+ +E+D G+Y C  +++ G   +  F  T  +P   +    +K  + +++ ++T SC A   P P  +WF +G  +   +    I N ++  +Q+KI+ +K  D+G+  C+A NSAG  E  + ++ I++PKI    +  +   + +++ V  C     P  KITW   G P+  D  +  +     L + ++ +    ++ C+ATN AG+ ++ F + +   P   +   V  I  + G   T+ C  +G P P + WL+ G A      I   DRY F +    L I      DQ  Y C A N  G   + ++  +  I  P I   + + V V       + C   +S    V + W K+G  I           +I +    +   + +  D   YTCI +N  G A+   +  V   P I  +    + + +   IV      + C   G P PK+ W    +PL  EP      ++ +G  L +     EHAGT+TC A N+     K+F V V APP   KE     E+ ++  + + L C   S  P   + W+ + + +       + A  +  L V     D+ G Y C A NE     +FF++ ++  P   D +  K+Y    G++LTL+C   G P PT  +      L+ + +   I  S      L+I   + E++G YTC   N  G ++    V +L  PK+ +      V   + +TL C         I W   ++      +  +    + ++ L + +A       YSC+A N+ G  +    VTV  P    K    + +   I+    +   C     PP EI WF +   I + +P   +K      +L +  +K    G Y C+A N  G +   T V +  P  +   S   V+ + E     I C   GNP P   W KD     S   ++ +     L +++   +D   Y C  TN+AGE +   DV V VPP I         +  +G+T  + C V+G P P + W      N   +   N  LH  N  ++   +Y+CIA+NEAG+A   F   V T P    + +  +  + + +GE  ++ C  D  P  TI W K G    N   + ++ RG  L +L AQ  D G+Y C+ +N  G  +Q + V++   P I          VA GG + L C   G P P + W++    +  D R  ++++  Y L +NS    DAG+Y CIA N  G     +  +V   PT +  GG  Y  +E     T+ ++C V+  P P+I+W +   P+      RY I  +   + I   + SD G+Y C A N  G  +I + + I  PP ID++ I+   +  V   + L CP +G P P++ + K+G  ++M D           R++++Q  +   + + + TD G Y C A+N  G    ++S+ V +PPEFD    +P +      T +L C +     +AD    ++W +    L      ++ IS DG ++T+      +AG Y C A N   + SL F VE+                           KPR                 +N +  ++ AV   T+ M C  TG+P P++ W +  +E+  D+       I+    V+QI     D A  ++C A N  G  E +  + V  PP +  +S  P    + E + +  + S   Y    P + W K  S I        ++   G  L I + K  + G YTC+A N AG    +  + V  PP+   D       +  Q   S+  QC A+G P P + W      ++ +      +++++  + I +V+  + G++ C A N  GS   +Y ++V+  P +      +V E  G    + C  EGYP P + W R+G     G+      TD R  +L I +A+  D+G Y C+ TN+     ++  + V++SP  I S    +    G +  LPC V G     I W   GN+ I     G +   ++  L I++  + H  +Y C A NDAG   +   ++ +V PKI         G   T   ++C+I         +W +NG+ L    N   + D  L    S ++ D+G  +C A N AG       + V + PK+   P +    +G  VT+ C+  G P+P +TW KD + L N   +      +  +    + P   G Y C  E   A ++     L +   P+ V  P+  NV    R   F  C AT  P+P I WM +   AI++       G+ + +++V  ++ G Y CIAK+  G        + IA  ++ V   + PS+      + C  +GK     ++  +      N   L   D          +D+ +   IA       +    +L+ + P F + P N +A +G ++ L C+A G P PTI+W K+ KLI+    K  I    L++       SG Y C+A ++ G
Sbjct: 2250 RLTILNVTENDEGQYSCRVKNDAG-ENSFDFKATVLVPPTIIMLDKDKNKTAVEHSTVTLSCPATGKPEPDITWFKDGEAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSAGSVEQDVNVNVITIPKIEKDGIPSDYESQQNERVVISCPVYARPPAKITWLKAGKPLQSDKFVKTSANGQKLYLFKLRETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKGSPSPTITWLKDGNA------IEPNDRYVFFDAGRQLQISKTEGSDQGRYTCIATNSVG--SDDLENTLEVIIPPVIDGERREAVAVIEGFSSELFC---DSNSTGVDVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSISDE----LSSANIQTIVPYYPVEINCVVSGSPHPKVYWLFDDKPL--EPDSAAYELTNNGETLKIVRSQVEHAGTYTCEAQNNVGKARKDFLVRVTAPPHFEKE---REEVVARVGDTMLLTCNAESSVPLSSVYWHAHDESVQNGVITSKYAANEKTLNVTNIQLDDEGFYYCTAVNEAGITKKFFKLIVIETPYFLDQQ--KLYPIILGKRLTLDCSATGTPPPTILFMKDGKRLN-ESDEVDIIGS-----TLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPPKLSKEWINVEVQAGDPLTLECPIEDTSGVHITW--SRQFGKDGQLDMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGGAEAVFQVTVNTP---PKIFGDSFSTTEIVADTTLEIPCRTEGIPPPEISWFLDGKPILE-MPGVTYKQG--DLSLRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEPPRVVMASE--VMRVVEGRQTTIRCEVFGNPEPVVNWLKDGEPYTSD-LLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQTTTDVEVLVPPRIE--DEERVLQGKEGNTYMVHCQVTGRPVPYVTWKR----NGKEIEQFNPVLHIRNATRADEGKYSCIASNEAGTAVADFLIDVFTKP----TFETHETTFNIVEGESAKIECKIDGHPKPTISWLKGGRPF-NMDNIILSPRGDTLMILKAQRFDGGLYTCVATNSYGDSEQDFKVNVYTKPYIDETIDQTPKAVA-GGEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNN--YDLKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIGKPTFVRKGGNLYEVIEN---DTITMDCGVTSRPLPSISWFRGDKPVYLYD--RYSISPDGSHITINKAKLSDGGKYICRASNEAGTSDIDLILKILVPPKIDKSNIIGNPLAIVARTIYLECPISGIPQPDVIWTKNGMDINMTD----------SRVILAQNNETFGIENVQVTDQGRYTCTATNRGGKASHDFSLDVLSPPEFDIHGTQPTIKR-EGDTITLTCPIKLAEDIADQVMDVSWTKDSRALDGDLTDNVDISDDGRKLTISQASLENAGLYTCIALNRAGEASLEFKVEILCTSLATVKCREHENNYIARHMPHVVTKPREMSQSANAYPPPVIDISRNDVQPQV-AVNQPTI-MRCAVTGHPFPSIKWLKNGKEVTDDE----NIRIVEQGQVLQILRTDSDHAGKWSCVAENDAGVKELEMVLDVFTPPVVSVKSDNPIK-ALGETITLFCNASGNPY----PQLKWAKGGSLIFDSPDGARISLK-GARLDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVLVPPEINRDGIDMSPRLPAQ--QSLTLQCLAQGKPVPQMRWTLNGTALT-HSTPGITVASDSTFIQINNVSLSDKGVYTCYAENVAGSDNLMYNVDVVQAPVISNGGTKQVIE--GELAVIECLVEGYPAPQVSWLRNGNRVETGVQGVRYVTDGR--MLTIIEARSLDSGIYLCSATNEAGSAQQAYTLEVLVSPKIITSTPGVLTPSSGSKFSLPCAVRGYPDPIISWTLNGND-IKDGENG-HTIGADGTLHIEKAEERHL-IYECTAKNDAGADTLEFPVQTIVAPKISTSGNRYINGSEGTETVIKCEIESE--SSEFSWSKNGVPLLPSNNLIFSEDYKLIKILSTRLSDQGEYSCTAANKAGNATQKTNLNVGVAPKIMERPRTQVVHKGDQVTLWCEASGVPQPAITWYKDNELLTNTGVDETATTKKKSVIFSSISPSQAGVYTCKAENWVA-STEEDIDLIVMIPPEVV--PERMNVSTNPRQTVFLSCNATGIPEPVISWMRDSNIAIQNNEKYQILGTTLAIRNVLPDDDGFYHCIAKSDAG--------QKIATRKLIV---NKPSDRPAPIWVECDEKGKPKKTEYMIDRGDTPDDNPQLLPWKDV---------EDSSLNGSIAYRCMPGPRSSRTVLLHAAPQFIVKPKNTTAAIGAIVELRCSAAGPPHPTITWAKDGKLIEDS--KFEIAYSHLKVTLNSTSDSGEYTCMAQNSVG 4682          

HSP 4 Score: 723.005 bits (1865), Expect = 0.000e+0
Identity = 662/2523 (26.24%), Postives = 1089/2523 (43.16%), Query Frame = 1
Query: 1903 LIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNII---INETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNI-DGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYF-INQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNR--IMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIG-DFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSK-ENVELNCIITSGNPSPKIEWYKNGQPLVEIPGR----VEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQ--FNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIV-TVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAINIGE--SLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSI-NGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWT-----YMETIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCV--SEGRPKPKIEWRKDGSRIDF-----RRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPT---LDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDG--IPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCEC--TGYPPPTLLWYRQEQEILADKERYPKF-DILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGS-PTPSIMWFYKDMPISPYDMMNFVISN----NAKVLTIPSVN-KEGGIFKCIARNEVGSIMKVYKLEVI-MPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQG-----LIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNY-YTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISVTGD-EGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSE-NEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSF--RCEATSHPKPDIKWMFNGRAIESKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGKVD-SIVWLKNGV-IVQNSSRLYINDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPP-VFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQGEVHSQ 9294
            LI+  A +S +G Y C A +  G +E    I+    P  S  +   + + +D  T  C     P P  +W L+ +          +VN  ++  + I NV     G   C A+N+AG D   + L+  + P I + +  K I L+ D   + C A  +P P   W + G    ID  +I   I E  G L +  ++    G +VC  +N AG    S+ L +   P+I   V  + D   G  I I C+  G P     W +       I + + ++ F ++   +L I      D   Y C   N+ G  Q +  + +     P I    ++         +V +   VE+ PPA ++W + G  I    +  ++  D TLVI++   ED  IYTC A N  G A+ ++++ V   P I   D  T    K+     L C    +P P+I W    +PL ++       S D  +L V+      +G + C A N      K F+V V  P  + +          + E V L C + SG P P+I W  +G  +VE PG+      ++     L     +  + G+Y C A ++ +      ++++L  P   +   ++++  +   L+ + + +     T  WS   S  D   N       P D + L IT  + E  G Y C  TN  G A+ +  + +LE P  ++  F     +  +N I L C  +GNP P + W      I  N V    + +   +L+     +    + SC AEN+ G   ++  +  + AP    +   + I          IT  C + S    +I W K  +     L ++    +LD + LT+         IY C+A N     S +F +VV + P I    ++   + INE  ++ +TC +EGNP P   W  D +Q          N   T+++  V +    VY+C+ TN+ G+  K  +V+V   P   +G++  E    L  S T L C+V       I WT     ++   +    L+    LH ++        Y C  TNEAG A K F+  +  PP IV  +   +  ++++  L L C     P   + W KDG  + +   V + + G Q  +++A+ +  G Y C+  N +G  + ++ VDI+  P I+   K     +  GG L   C    +   K +I W ++   ID      R   LS+D   LT+ +  E D G+Y C  +N  G+    F   V   PT   LD   K    VE +   TV L C  +G P P ITW KDG  I I  +         N  QL+I  ++  DAG+Y+C A N+ G +E  ++V +   P I+++ I ++Y  +  + + + CP    P   I + K G  L              K +  S   Q L L+  + TDS  Y C A+N  G D  ++ V +   P FD  N+  ++   +    +L C   G   P   ITW + G  +           G ++ +   +  D G Y C A N V    L   +EV + P     +    +  ++  + ++ C+   TG     + W +    I  D  R   F  I      M   + +  D+  Y C   N  G   K F+ +V  PP I           +     +  +C V       P + W  ++ P+      Y LT NNG++L I+  + + +G YTCEA+N  G+    F++ VT+PP F  +    RE +  ++G ++   C AE S P  S+ W   D  +      N VI++    N K L + ++   + G + C A NE G   K +KL VI  P  +   K+      G   ++ C+A G P P I + +DGK +     + D     L I + ++E  GRYTC   NK  +  K + V ++ PPK+     ++ V+ G+ + L C +E T    I W    + Q      G+    ++       L I +   + +  Y C+A NDAG  E    + V   PKIF  + + T  V +T L++ C+  EGIP P I+W  +G  + ++    Y   D  L I N +K   EG  TC+A+N AG       + +   P+V +   V    EG   TI C+V G P+P V W KDG+   + L    +F+++ + +++ +    D G Y CI      E+ T +T + +   P+   + +   V+Q     ++   C+ T  P P + W  NG+ IE + N      + +++    + G+Y CIA N  G+    F+++V  KP    +++       +   + CK++G    +I WLK G     ++  L      L+I +A+  D G+Y C+A+NS G+++    + V + P +   +     A  G  +IL C   G P PT++W +    +  D   +++ N  L+I  V  E +G Y C+A +  G + + 
Sbjct: 1056 LIVRKADKSYSGVYTCQATNSAGDNEQKTTIRIMNTPMISPGQSSFNMVVDDLFTIPCDVYGDPKPVITWLLDDKPFTE-----GVVN--EDGSLTIPNVNEAHRGTFTCHAQNAAGNDTRTVTLTVHTTPTINAENQEK-IALQNDDIVLECPAKALPPPVRLWTYEGE--KIDSQLIPHTIRED-GALVLQNVKLENTGVFVCQVSNLAGEDSLSYTLTVHEKPKIISEVPGVVDVVKGFTIEIPCRATGVPEVIRTWNKN-----GIDLKMDEKKFSVDNLGTLRIYEADKNDIGNYNCVVTNEAGTSQMTTHVDVQ---EPPIILPSTQTNNTAVVGDRVELKCYVEASPPASVTWFRRGIAIGTDTKGYVVESDGTLVIQSASVEDATIYTCKASNPAGKAEANLQVTVIASPDIKDPDVVTQESIKESHPFSLYCPVFSNPLPQISWYLNDKPL-IDDKTSWKTSDDKRKLHVFKAKITDSGVYKCVARNAAGEGSKSFQVEVIVPLNLDESKYKKKVFAKEGEEVTLGCPV-SGFPVPQINWVVDGT-VVE-PGKKYKGATLSNDGLTLHFDSVSVKQEGNYHCVAQSKGNILDIDVELSVLAVPIVGEDDNLEVFLGKDISLSCDLQTESDDKTTFVWSINGSESDRPDN----VQIPSDGHRLYITDAKPENNGKYMCRVTNSAGKAERTLTLDVLEPPVFVEPVFEANQKLIGNNPIILQCQVTGNPKPTVIWK-----IDGNDVDKSWLFDESLSLLRIEKLTGKSAQISCTAENKAGTASRDFFIQNIAAPTFKNEGDQETIFRE----SETITLDCPV-SLGDFQITWMKQGL----PLTENDAIFTLDNTRLTILNANRDHEDIYTCVANNTAGQVSKDFDVVVQVLPKI---KNAVVTLEINEGEEIILTCDAEGNPTPTAKW--DFNQGDLPKEAVFVNNNHTVVVNNVTKYHTGVYKCYATNKVGQAVKTINVHVRTKPRFESGLTESELTVNLTRSIT-LECDVDDAIGVGISWTVNGKPFLAETDGVQTLAGGRFLHIVSAKTDDHGSYACTVTNEAGVATKTFNLFVQVPPTIV--NEGGEYTVIENNSLVLPCEVTGKPNPVVTWTKDGRPVGDLKSVQVLSEGQQFKIVHAEIAHKGSYICMAKNDVGTAEISFDVDIITRPMIQKGIKNIVTAIK-GGALPFKCPIDDDKNFKGQIIWLRNYQPIDLEAEDARITRLSND-RRLTILNVTENDEGQYSCRVKNDAGENSFDFKATVLVPPTIIMLDKD-KNKTAVEHS---TVTLSCPATGKPEPDITWFKDGEAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSAGSVEQDVNVNVITIPKIEKDGIPSDYESQQNERVVISCPVYARPPAKITWLKAGKPL-----------QSDKFVKTSANGQKLYLFKLRETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKG--SPSPTITWLKDGNAIEPNDRYVFFDAGRQLQISKTEGSDQGRYTCIATNSVGSDDLENTLEVIIPP-VIDGERREAVAVIEGFSSELFCDSNSTGV---DVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSISDELSSANIQTIVPYYPVEINCVVSG--SPHPKVYWLFDDKPLEPDSAAYELT-NNGETLKIVRSQVEHAGTYTCEAQNNVGKARKDFLVRVTAPPHFEKE----REEVVARVGDTMLLTCNAESSVPLSSVYWHAHDESV-----QNGVITSKYAANEKTLNVTNIQLDDEGFYYCTAVNEAGITKKFFKLIVIETPYFLDQQKL-YPIILGKRLTLDCSATGTPPPTILFMKDGKRL-NESDEVDIIGSTLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPPKLSKEWINVEVQAGDPLTLECPIEDTSGVHITW----SRQFGKD--GQLDMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGGAEAVFQVTVNTPPKIFGDSFSTTEIVADTTLEIPCRT-EGIPPPEISWFLDGKPILEMPGVTYKQGDLSLRIDN-IKPNQEGRYTCVAENKAGRAEQDTYVEISEPPRVVMASEVMRVVEGRQTTIRCEVFGNPEPVVNWLKDGEPYTSDL---LQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQT-TTDVEVLVPPRIEDEER---VLQGKEGNTYMVHCQVTGRPVPYVTWKRNGKEIE-QFNP----VLHIRNATRADEGKYSCIASNEAGTAVADFLIDVFTKPTFETHETTFNIVEGESAKIECKIDGHPKPTISWLKGGRPFNMDNIILSPRGDTLMILKAQRFDGGLYTCVATNSYGDSEQDFKVNVYTKPYIDETIDQTPKAVAGGEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNNYDLKINSVTTEDAGQYSCIAVNEAGNLTTH 3472          

HSP 5 Score: 701.819 bits (1810), Expect = 0.000e+0
Identity = 707/2740 (25.80%), Postives = 1128/2740 (41.17%), Query Frame = 1
Query: 1447 GHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNVTLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKNASIEPFKDAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDE----KEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKI-----LSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSY-GEN-ITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYI-CDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRIMAKDNT-LVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYE--IGSKENVELNCIITSGNPSPKIEWYKNGQP-LVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQ------------GIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVV--FIDNTITLTCIASGNPTPK--IKWLFKKKLIPPNAVGYKMVG-ENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAP-YIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRF-KISLDGSTLTLFEVKHLDSGIYKCLAINIGESL--NFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRW----TYMETIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDG-----ELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFN-SKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRI--DFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLV-SGIPTPAITW-LKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMD-VTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQM----LTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRI----SPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKS-DESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNK-EGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKI-ESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGN---NQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSL------PISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENE-INIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRC-----EATSHPKPDIKWMFNGRAIESKLNSN------GRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLE-------------------------VIAKPR-------------VRVYQSD-DPSESIKR-TILMCKVEGK-VDSIVWLKNGVIVQNSSRLYINDFNLIIN--QAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLI--KYDFVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQG 9279
            G  +++ C V++  P  + W++   + I   TD   +   S+ TL I  A+     +Y  +           K     QV V   P      V    SI+      L C VFS     +  +    P  + K +       +K S +    KL +  A  +D+G Y CVA +  G  E     +   +   ++DE    K++   + + +T  C     P P  +W ++G  ++P               +   +V  +  G   C A++   I ++ ++LS +++P +     L + L K+I L  D QT     T        W  NGS      N+ I      L I   +    G+++C  TNSAG + ++  LD+   P   + V   +    G N I ++CQV G P P V W      G ++     D+ ++  ++  +++   +  +SA I C A+N+ G    S    I  IAAP       ++ +   +    + C V  S     I+W+K G  +  ++ I   DNT L I     + E IYTC+A N  G    D ++ VQ  P I     T ++  +G+ I+L C  +G+P P  +W      L  E     V   +   + V ++T+ H G + C ATN     VK   V V+  P+  + G+++ E  +    ++ L C +        I W  NG+P L E  G   +AG +  L +     D+ GSY C  TNE    ++ F + + V P   +    +    E   L L C++ G P P   W+           P G         DL   Q+ SE Q            G Y C   N  G+A++S+DV I+  P +IQ   K++V       +   C    +   K  I WL   + I   A   ++    N   L +        G+YSC  +N+ G++  +   TV  P  I M   +KN T    +    +T SC     P  +I WFK+   I+     D      L+G+ L +  +K  D+G Y C A N   S+  +  + V+  P I  K    S     +   + I+C     P  +  W K    L S   V+ +  G+ L + K+R +D S Y C  TNEAG DK++F V++ V PS +  ++        G+ + L C   G P+P I W      +E  +  +      QL     + S   RYTCIATN  GS   L + +    P ++  +  +   +++     L C+S++  V  +EW KDG     + +R +  + I + G ++  L+A++SD G Y C+V N  G  ++ +   +  PPSI    S A    +     + + CV  G P PK+ W  D   +  D     L+++G  L +  +    AG Y C A+N  G+    F V+VT  P  +   K   +V   VG T++L C   S +P  ++ W   D    N + + +Y    N K L +  +Q  D G Y C A N  G  + F   + I  P  +D+ ++   Y I +G  L L C A G+P P I F KDG                 KRL  S E  +    L + + ++   G Y C A N  G    +  V V  PP+     +  +V        +LEC +   +     ITW R        G + +    S D +++ +      DA  Y C A N+      VF V V   P+ + +   T  E V +TT+++ C   G PPP + W+   + IL      P     +G+  ++I NI+P+    Y C A N  G  E+   + +  PP+++  S   E  RV E  Q T  C V+     +PV+ W K+  P     T   L F+   S   L   +  + G YTC A N AG+   T  + V  PP+   +  + +     + G +    C   G P P + W      I  ++           VL I +  + + G + CIA NE G+ +  + ++V         +       G S  + C  +G+PKP I W + G+           R   L I  A+  D G YTC  TN      +   V + + P I E+  ++     G +++L C V G     + W    +   N    TI+  Y       L I+ V  + +G Y C+A N+AG        EV+ +P   R        + N  + M C +    P P I+W R    +     Y  + D      N  K+ D G   C A N AG   +   + + + PK+        P+++      ++ + C + G P+P V W K+G  + N+  +R      NE   I +++  D G Y C     G +AS   + L + + P+F        + +E    +  C     E  +    D+ W  + RA++  L  N      GR  +T+     ENAG Y CIA NR G     F +E                         V+ KPR             + + ++D  P  ++ + TI+ C V G    SI WLKNG  V +   + I +   ++   +  S   G + C+A N AG  + ++ L V +PPV ++   N    LGE + L C A G P P + W K   LI    D  +  +K   L I  ++K   G Y C A +  G
Sbjct: 1377 GDRVELKCYVEASPPASVTWFR---RGIAIGTDTKGYVVESDGTLVIQSASVEDATIYTCKA-----SNPAGKAEANLQVTVIASPDIKDPDVVTQESIKESHPFSLYCPVFSNPLPQISWYLNDKPLIDDKTS-------WKTSDD--KRKLHVFKAKITDSGVYKCVARNAAG--EGSKSFQVEVIVPLNLDESKYKKKVFAKEGEEVTLGCPVSGFPVPQINWVVDGTVVEPGKKYKGATLSNDGLTLHFDSVSVKQEGNYHCVAQSKGNILDIDVELSVLAVPIVGEDDNLEVFLGKDISLSCDLQTESDDKT-----TFVWSINGSESDRPDNVQIPSDGHRLYITDAKPENNGKYMCRVTNSAGKAERTLTLDVLEPPVFVEPVFEANQKLIGNNPIILQCQVTGNPKPTVIWK---IDGNDV-----DKSWLFDESLSLLRIEKLTGKSAQISCTAENKAGTA--SRDFFIQNIAAPTFKNEGDQETIFRESETITLDCPV--SLGDFQITWMKQGLPLTENDAIFTLDNTRLTILNANRDHEDIYTCVANNTAGQVSKDFDVVVQVLPKIKNAVVT-LEINEGEEIILTCDAEGNPTPTAKWDFNQGDLPKE----AVFVNNNHTVVVNNVTKYHTGVYKCYATNKVGQAVKTINVHVRTKPRF-ESGLTESELTVNLTRSITLECDVDDA-IGVGISWTVNGKPFLAETDGVQTLAGGR-FLHIVSAKTDDHGSYACTVTNEAGVATKTFNLFVQVPPTIVNEGG-EYTVIENNSLVLPCEVTGKPNPVVTWTKDG-------RPVG---------DLKSVQVLSEGQQFKIVHAEIAHKGSYICMAKNDVGTAEISFDVDIITRP-MIQKGIKNIVTAIKGGALPFKCPIDDDKNFKGQIIWLRNYQPIDLEAEDARITRLSNDRRLTILNVTENDEGQYSCRVKNDAGENSFDFKATVLVPPTIIMLDKDKNKT---AVEHSTVTLSCPATGKPEPDITWFKDGEAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSAGSVEQDVNVNVITIPKI-EKDGIPSDYESQQNERVVISCPVYARPPAKITWLKAGKPLQSDKFVKTSANGQKLYLFKLRETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKGSPSPTITWLKDGNAIEPNDRYVFFDAGRQLQISKTEGSDQGRYTCIATNSVGS-DDLENTLEVIIPPVIDGERREAVAVIEGFSSELFCDSNSTGV-DVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSISDELSSANIQTIVPYYPVEINCVVSGSPHPKVYWLFDDKPLEPDSAAYELTNNGETLKIVRSQVEHAGTYTCEAQNNVGKARKDFLVRVTAPPHFE---KEREEVVARVGDTMLLTCNAESSVPLSSVYWHAHDESVQNGVITSKYA--ANEKTLNVTNIQLDDEGFYYCTAVNEAGITKKFFKLIVIETPYFLDQQKL---YPIILGKRLTLDCSATGTPPPTILFMKDG-----------------KRLNESDEVDIIGSTLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPPKLSKEWINVEVQ--AGDPLTLECPIEDTSG--VHITWSRQ---FGKDGQLDMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGGAEAVFQVTVNTPPKIFGDSFST-TEIVADTTLEIPCRTEGIPPPEISWFLDGKPIL----EMPGVTYKQGDLSLRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEPPRVVMAS---EVMRVVEGRQTTIRCEVFGN--PEPVVNWLKDGEPY----TSDLLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQTTTDVEVLVPPRIEDEERVLQG----KEGNTYMVHCQVTGRPVPYVTWKRNGKEIEQFN----------PVLHIRNATRADEGKYSCIASNEAGTAVADFLIDVFTKPTFETHETTFNIVEGESAKIECKIDGHPKPTISWLKGGRPFNMDNIILSPRGDTLMILKAQRFDGGLYTCVATNSYGDSEQDFKVNVYTKPYIDETIDQTPKAVAGGEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNNYD------LKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIGKPTFVRKGGNLYEVIENDTITMDCGVTSR-PLPSISWFRGDKPVYLYDRYSISPDGSHITINKAKLSDGGKYICRASNEAGTSDIDLILKILVPPKIDKSNIIGNPLAIVA---RTIYLECPISGIPQPDVIWTKNGMDI-NMTDSRVILAQNNETFGIENVQVTDQGRYTCTATNRGGKASHDFS-LDVLSPPEFDIHGTQPTIKREGDTITLTCPIKLAEDIADQVMDVSWTKDSRALDGDLTDNVDISDDGR-KLTISQASLENAGLYTCIALNRAGEASLEFKVEILCTSLATVKCREHENNYIARHMPHVVTKPREMSQSANAYPPPVIDISRNDVQPQVAVNQPTIMRCAVTGHPFPSIKWLKNGKEVTDDENIRIVEQGQVLQILRTDSDHAGKWSCVAENDAGVKELEMVLDVFTPPVVSVKSDNPIKALGETITLFCNASGNPYPQLKWAKGGSLIFDSPDGARISLKGARLDIPHLKKTDVGDYTCQALNAAG 3975          

HSP 6 Score: 690.649 bits (1781), Expect = 0.000e+0
Identity = 652/2558 (25.49%), Postives = 1105/2558 (43.20%), Query Frame = 1
Query: 1840 KNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTH----TLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPL-EGDQQTVRCSATGVPQPKITWEFNGSPVTIDG-NIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKD--FVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRY----FINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVC-LVVESKPPAVISWLKNGKEIEYSN--RIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGD-FKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKS--VVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKN--EIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAIN-IGES-LNFTLVVLISPTILGKHSSKSVININEETDLYITCW--SEGNPAPRYLWYKDNSQLIS----GGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRW------TYMETIXXX--XXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELR------LSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFR-RVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPIN----RLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSI-DRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGG-SIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQS-LTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPK-FPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSV--NKEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISVT--GDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLS--IFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAI----ESKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRV-RVYQSDDPSESIKRTI-LMCKVEG-KVDSIVWLKNGV-IVQNSSRLYI--NDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANL-GEVLILPCA---AEGYP--IPTISWYKNKKLIKYDFVKSLIKNGSLRIIGVQK---EHSGVYFCVASSNQGEV 9285
            KN    +++  K S +   + L I  A ++D G Y CV  +E G S+    +        LP+   +   +     D +   C   ++PP + +WF  G  +  TD +  +V    +  + I +   +D+    CKA N AG  E  ++++ I+ P I   D+  +  + E    ++ C     P P+I+W  N  P+  D  +   ++    L + + +    G + CVA N+AG   KSF +++     + +  +   +    GE +T+ C V G P P++ W+  + G    P   G +Y      N   +L    +S++ +  Y C AQ++ G + + + + +S +A P +    + +V +   +   + C L  ES       W  NG E +  +  +I +  + L I   K E+   Y C   N  G A+  + LDV   P+ +   F+        + I+LQCQ  G+PKP + W+  G  +        +     S L +  +T + A   +CTA N      ++F +   A P    EG  +      E + L+C ++ G+   +I W K G PL E      +   +  L +   N D    Y C A N     S+ F + + V PK  ++ ++ +   EGE++ L C  +G PTPT KW +     DL +    + N+    + +++  +     G+Y C  TN  G A  + +V +   P+      +S   V +  +ITL C         I W    K       G + +   +   IV      HG  Y+C   NE G   K   + V  P   +   N+   Y  +I   ++   C +   P   + W K+   +   KS+     ++  +G    +   +    G Y C+A N +G + ++F + ++  P I  +   K+++   +   L   C    + N   + +W + N Q I       R+   +  + L I  V  +D+  Y C V N+AGE+  +F   V VPP+I  +   +    ++ ST  L C  +G P P I W       ++E I         N +QL    + +    +YTC A N AGS  +  +  +   PKI      +K  I  D E +      +SC   A P A I W K G+ ++++  V  +  G +L+L   +E+D   Y C+ +N+ G DK+ + V +++ PS    +      V  G    L C ++G P P I W KDG+ I+   R +  D G  L ++ T  +D GRY CIA N+ G  D+   ++V   P +D  G+R   V    G +  L C  +      + W KDG+ IN    R  S+  +I  + K++  ++ + SD+GRY+C+ +N  G+     D  +  PPSI D     N   I     + + C  +GSP+P + +  D   L+     P+  A+Y+    ++   + L +  ++   +G Y C A N +G    ++ VRV  PP F+    E  V      T  L C       P + + W  H   + +G  + + + +   + V N++  D G Y C A NE       F + V   P F   Q    I  +    + + C  TG PPPT+L+ +  + +    E     DI+   S + I N Q +    Y C A N  G  EK   + V++PPK+ K  +   N  V+    +T  C + + +     I W+++      G  D     ++ +S L I+    +++  Y+C A N AG     F +TV +PPK F   FS    T  +   T++   C  EG P P I WF    PI   +M           L I ++  N+EG  + C+A N+ G   +   +E+  P  V +    +R   G   ++ C   G P+PV+ W +DG+       +  ++   L + +    D G YTC  TNK  +   + DV ++ PP+IE  ++ +  + G   ++ C V G     + W   G          E +  +    I +  R D  G Y C+A+N+AG       ++V  +P  F   ET    V     +++CKI +G P+P I+W + G   +      +     L I  + +  D G  TC+A N  G+    F++ V   P +   I  T     G  + + C V G P PTVTWK+   ++ N   +R    +  ++ I  +  ED G Y CI      EA   +T+ +  +  +P FV K      V E    +  C  TS P P I W    + +       ++ +G   IT+   +  + G+Y C A N  G+ +   +L+++  P++ +     +P   + RTI L C + G     ++W KNG+ I    SR+ +  N+    I   +  D G Y C A+N  G+A     L V SPP F +     +    G+ + L C    AE     +  +SW K+ + +  D   ++  +   R + + +   E++G+Y C+A +  GE 
Sbjct: 1306 KNGIDLKMDEKKFSVDNLGT-LRIYEADKNDIGNYNCVVTNEAGTSQMTTHVDVQEPPIILPSTQTNNTAVV---GDRVELKCYVEASPPASVTWFRRGIAIG-TDTKGYVVE--SDGTLVIQSASVEDATIYTCKASNPAGKAEANLQVTVIASPDIKDPDVVTQESIKESHPFSLYCPVFSNPLPQISWYLNDKPLIDDKTSWKTSDDKRKLHVFKAKITDSGVYKCVARNAAGEGSKSFQVEVIVPLNLDESKYKKKVFAKEGEEVTLGCPVSGFPVPQINWV--VDGTVVEP---GKKYKGATLSNDGLTLHFDSVSVKQEGNYHCVAQSK-GNILD-IDVELSVLAVPIVGEDDNLEVFLGKDIS--LSCDLQTESDDKTTFVWSINGSESDRPDNVQIPSDGHRLYITDAKPENNGKYMCRVTNSAGKAERTLTLDVLEPPVFVEPVFEANQKLIGNNPIILQCQVTGNPKPTVIWKIDGNDVDKS----WLFDESLSLLRIEKLTGKSA-QISCTAENKAGTASRDFFIQNIAAPTFKNEGDQETIFRESETITLDCPVSLGDF--QITWMKQGLPLTENDAIFTLDNTR--LTILNANRDHEDIYTCVANNTAGQVSKDFDVVVQVLPKIKNA-VVTLEINEGEEIILTCDAEGNPTPTAKWDFNQG--DLPKEAVFVNNN----HTVVVNNVTKYHTGVYKCYATNKVGQAVKTINVHVRTKPRFESGLTESELTVNLTRSITLECDVDDAIGVGISWTVNGKPFLAETDGVQTLAGGRFLHIVSAKTDDHGS-YACTVTNEAGVATKTFNLFVQVPPTIV---NEGGEYT-VIENNSLVLPCEVTGKPNPVVTWTKDGRPVGDLKSV-----QVLSEGQQFKIVHAEIAHKGSYICMAKNDVGTAEISFDVDIITRPMI--QKGIKNIVTAIKGGALPFKCPIDDDKNFKGQIIWLR-NYQPIDLEAEDARITRLSNDRRLTILNVTENDEGQYSCRVKNDAGENSFDFKATVLVPPTIIMLDKDKNKTAVEHSTVTLSCPATGKPEPDITWFKDGEAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSAGSVEQDVNVNVITIPKI------EKDGIPSDYESQQNERVVISCPVYARPPAKITWLKAGKPLQSDKFVKTSANGQKLYLFKLRETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKGSPSPTITWLKDGNAIEPNDRYVFFDAGRQLQISKTEGSDQGRYTCIATNSVGSDDLENTLEVIIPPVID--GERREAVAVIEGFSSELFCDSNSTGV-DVEWQKDGLTINQDTLRGDSF-IQIPSSGKKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSISDELSSANIQTIVPYYPVEINCVVSGSPHPKVYWLFDDKPLE-----PDS-AAYE----LTNNGETLKIVRSQVEHAGTYTCEAQNNVGKARKDFLVRVTAPPHFEKEREE--VVARVGDTMLLTCNAESSV-PLSSVYWHAHDESVQNGVITSKYAANEKTLNVTNIQLDDEGFYYCTAVNEAGITKKFFKLIVIETPYFLDQQKLYPI--ILGKRLTLDCSATGTPPPTILFMKDGKRLNESDE----VDII--GSTLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPPKLSKEWI---NVEVQAGDPLTLECPIEDTSGVH--ITWSRQFGKD--GQLDMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGGAEAVFQVTVNTPPKIFGDSFS----TTEIVADTTLEIPCRTEGIPPPEISWFLDGKPI--LEMPGVTYKQGDLSLRIDNIKPNQEGR-YTCVAENKAGRAEQDTYVEISEPPRVVMASEVMRVVEGRQTTIRCEVFGNPEPVVNWLKDGEPYTSDLLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQTTTDVEVLVPPRIEDEERVLQGKEGNTYMVHCQVTGRPVPYVTWKRNGK---------EIEQFNPVLHIRNATRADE-GKYSCIASNEAGTAVADFLIDVFTKP-TFETHETTFNIVEGESAKIECKI-DGHPKPTISWLKGGRPFNMDNIILSPRGDTLMILKAQRF-DGGLYTCVATNSYGDSEQDFKVNVYTKPYIDETIDQTPKAVAGGEIILKCPVLGNPTPTVTWKRGDDAVPN--DSRHTIVNNYDLKINSVTTEDAGQYSCIAVN---EAGNLTTHYAAEVIGKPTFVRKGGNLYEVIENDTITMDCGVTSRPLPSISWFRGDKPVYLYDRYSISPDG-SHITINKAKLSDGGKYICRASNEAGTSDIDLILKILVPPKIDKSNIIGNPLAIVARTIYLECPISGIPQPDVIWTKNGMDINMTDSRVILAQNNETFGIENVQVTDQGRYTCTATNRGGKASHDFSLDVLSPPEFDIHGTQPTIKREGDTITLTCPIKLAEDIADQVMDVSWTKDSRALDGDLTDNVDISDDGRKLTISQASLENAGLYTCIALNRAGEA 3754          

HSP 7 Score: 687.567 bits (1773), Expect = 0.000e+0
Identity = 665/2567 (25.91%), Postives = 1035/2567 (40.32%), Query Frame = 1
Query: 1903 LIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPK--ITWEFNGSPVTI---DGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRI--KDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQD---NSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSN--RIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIG-DFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNG----QPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDS-------KMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIA-SGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTP---NKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAIN-IGESLNFTLVVLISPTILGKHSSKSVININEETD--LYITCWSEGNPAPRYLW---YKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTY----METIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRID-FRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFT---NQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVIL---WTKENSPILIGD-TDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVL--------------------------TVTSPPKF--------PTDFSIFRETITVQLGTS--VNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKE-GGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRY--GTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQ--VLLPCIVEGTRPFRIHWYTPGNNQISST----ILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITL-SKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKV--SLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLN---SNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEV------IAKPRVRVYQSDDPSESIKRTILMCKVEGKVD-SIVWLKNGVIVQNSS---RLYINDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQGE 9282
            L I+SA   D+G Y C   +E GV+     +     P    +  E + I+N+S+   C     P P  +W  +GR   P     S+    +  Q KI + +    G  IC AKN  G  E+   +  I+ P I          ++G     +C        K  I W  N  P+ +   D  I        L I  + +N +GQ+ C   N AG +   F   +   P I   D   N        +T+ C   G+P P + W +    G  I I        N +   N L I  +   D   Y C+A N  G V++ V + +  I  PKI              ++V++   V ++PPA I+WLK GK ++     +  A    L +  ++  D + YTCIA N+ GT K D ++ +   P     +    I    G+   L C  KG P P I W K G    +EP  R V    G QL +        G +TC ATN   +   E  + V  PP I  E      +    + EL C   S +    +EW K+G    Q  +     ++I      +      + ++G Y C   N      + F   +   P  SD         ++  Y  E     +NC + G P P   W +    L+     + +TN   +   L I + + E  G YTC+  N  G A+  + V +   P   +  ++ V  + +T+ LTC A S  P   + W    + +  N V       N++TL V        G Y C A NE G  +K      F   I ++TP   ++   Y PII+G  +T  C    TPP  I + K+   + +S      ++ + GSTL +   +    G Y C+A N  G S    +V ++ P  L    SK  IN+  +    L + C  E        W   +  + QL    R + ++    L I +    D   Y C   N+AG  +  F V V  PP I G S   T E +  +T  + C   G P P+I W      +  +        +  L   N+  +   RYTC+A N+AG A +     ++ PP++V      +  +++  +  + C     P   + W KDGE   ++L +  + + + LHL     +D G Y C+ +NK G  +    V++++PP I+   +    Q   G    + C   GRP P + W+++G  I+ F  VL         + +    D G+Y CIA N  G     F + V   PT +     +  VE   G +  +EC + G P P I+WLK G P N + +      G++  L I+  Q  D G Y+CVA N++G  E    V +   P ID   I        G E+ L CP  G+P P + + K G+     D  PN      +  +V+     L + S    D+G Y C A N  G     Y+  V   P F    V    N +    N T +++C +   + P   I+W R   P+       ISPDG+ IT+   K  D G+Y C A NE     +   +++ + P+  K+ +     A+   T+ + C  +G P P ++W +   +I     R     + + N    I N+Q  D   Y CTATN GG     F + V+ PP+       P   R  E   IT  C +         ++   WTK+ S  L GD TD     ++G+ LTI     + +G YTC A N AG+ S  F +                           VT P +         P    I R  +  Q+  +     +C   G P PSI W      ++  D  N  I    +VL I   + +  G + C+A N+ G       L+V  P +V +      +  G + ++ C A G P P +KW + G  IF    G +   +   L+I   K+ D G YTC   N       SV V ++ PP+I      +  R+  Q  + L C+ +G    ++ W   G     ST    +  +  F+      I+ V     GVY C A N AG   +   ++V+  P I   +   T  V+   L +   ++EG P P ++W RNG  + + V+     TD  +      +  D G   C A N AG  +  + + V + PK+  S P  +T   GS  ++ C V G P P ++W  +G  +++   N     ++  ++I   + E    Y C   ++ A A T    +     PK            E      +CE  S          NG  +    N   S     I + S R  + GEY C A N+ G+      L V      + +PR +V    D      +  L C+  G    +I W K+  ++ N+           ++I +       G+Y C A N     +  + L+V  PP       N+S N  + + L C A G P P ISW ++  +   +  K  I   +L I  V  +  G Y C+A S+ G+
Sbjct: 2063 LHIVSAKTDDHGSYACTVTNEAGVATKTFNLFVQVPPTIVNEGGEYTVIENNSLVLPCEVTGKPNPVVTWTKDGR---PVGDLKSVQVLSEGQQFKIVHAEIAHKGSYICMAKNDVGTAEISFDVDIITRPMIQKGIKNIVTAIKGGALPFKCPIDDDKNFKGQIIWLRNYQPIDLEAEDARITRLSNDRRLTILNVTENDEGQYSCRVKNDAGENSFDFKATVLVPPTIIMLDKDKNKTAVEHSTVTLSCPATGKPEPDITWFKD---GEAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSAGSVEQDVNVNV--ITIPKIEKDGIPSDYESQQNERVVISCPVYARPPAKITWLKAGKPLQSDKFVKTSANGQKLYLFKLRETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKGSPSPTITWLKDGN--AIEPNDRYVFFDAGRQLQISKTEGSDQGRYTCIATNSVGSDDLENTLEVIIPPVIDGERREAVAVIEGFSSELFC--DSNSTGVDVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSISDELSSANIQTIVPYYPVE-----INCVVSGSPHPKVYWLFDDKPLEPDSAAYELTN---NGETLKIVRSQVEHAGTYTCEAQNNVGKARKDFLVRVTAPPHFEKEREEVVARVGDTMLLTCNAESSVPLSSVYWHAHDESVQ-NGVITSKYAANEKTLNVTNIQLDDEGFYYCTAVNEAGITKK------FFKLIVIETPYFLDQQKLY-PIILGKRLTLDCSATGTPPPTILFMKDGKRLNES-----DEVDIIGSTLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPPKL----SKEWINVEVQAGDPLTLECPIEDTSGVHITWSRQFGKDGQL--DMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGGAEAVFQVTVNTPPKIFGDSFSTT-EIVADTTLEIPCRTEGIPPPEISWFLDGKPILEMPGVTYKQGDLSLRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEPPRVVMASEVMR--VVEGRQTTIRCEVFGNPEPVVNWLKDGEPYTSDL-LQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQTTTDVEVLVPPRIEDEERV--LQGKEGNTYMVHCQVTGRPVPYVTWKRNGKEIEQFNPVL--------HIRNATRADEGKYSCIASNEAGTAVADFLIDVFTKPTFETHETTFNIVE---GESAKIECKIDGHPKPTISWLKGGRPFN-MDNIILSPRGDT--LMILKAQRFDGGLYTCVATNSYGDSEQDFKVNVYTKPYIDET-IDQTPKAVAGGEIILKCPVLGNPTPTVTW-KRGD-----DAVPND----SRHTIVNNYD--LKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIGKPTF----VRKGGNLYEVIENDTITMDCGV--TSRPLPSISWFRGDKPVYLYDRYSISPDGSHITINKAKLSDGGKYICRASNEAGTSDIDLILKILVPPKIDKSNIIGNPLAIVARTIYLECPISGIPQPDVIWTKNGMDINMTDSR---VILAQNNETFGIENVQVTDQGRYTCTATNRGGKASHDFSLDVLSPPEFDIHGTQPTIKR--EGDTITLTCPIKLAEDIADQVMDVSWTKD-SRALDGDLTDNVDISDDGRKLTISQASLENAGLYTCIALNRAGEASLEFKVEILCTSLATVKCREHENNYIARHMPHVVTKPREMSQSANAYPPPVIDISRNDVQPQVAVNQPTIMRCAVTGHPFPSIKWLKNGKEVT--DDENIRIVEQGQVLQILRTDSDHAGKWSCVAENDAGVKELEMVLDVFTPPVVSVKSDNPIKALGETITLFCNASGNPYPQLKWAKGGSLIFDSPDGARISLKGARLDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVLVPPEINRDGIDMSPRLPAQQSLTLQCLAQGKPVPQMRWTLNGTALTHSTPGITVASDSTFIQ-----INNVSLSDKGVYTCYAENVAGSDNLMYNVDVVQAPVI---SNGGTKQVIEGELAVIECLVEGYPAPQVSWLRNGNRVETGVQGVRYVTDGRMLTIIEARSLDSGIYLCSATNEAGSAQQAYTLEVLVSPKIITSTPGVLTPSSGSKFSLPCAVRGYPDPIISWTLNGNDIKDG-ENGHTIGADGTLHIEKAE-ERHLIYECTA-KNDAGADTLEFPVQTIVAPKISTSGNRYINGSEGTETVIKCEIESESSEFSWSK-NGVPLLPSNNLIFSEDYKLIKILSTRLSDQGEYSCTAANKAGNATQKTNLNVGVAPKIMERPRTQVVHKGD------QVTLWCEASGVPQPAITWYKDNELLTNTGVDETATTKKKSVIFSSISPSQAGVYTCKAENWVASTEEDIDLIVMIPPEVVPERMNVSTNPRQTVFLSCNATGIPEPVISWMRDSNIAIQNNEKYQILGTTLAIRNVLPDDDGFYHCIAKSDAGQ 4525          

HSP 8 Score: 623.624 bits (1607), Expect = 1.624e-178
Identity = 641/2610 (24.56%), Postives = 1065/2610 (40.80%), Query Frame = 1
Query: 1837 LKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDE----KEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRC--SATGVPQPKITWEFNGSPV---TIDGN--IIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTN-----IDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYF--INQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIE---YSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCII--TSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSS-ILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIV----GGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAIN-IGESL-NFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGR------VEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIX---XXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDF--RRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPA-----ITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGA--------------------------------------PPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHG-VPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKN--QLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDY-YLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKEGGIFKCIARNEVGSIMKVYKLEVIM-PALVRLDKIEVRERSGTSFSVLCTAEGYP------KPVIKWTRDGKGIFRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKR-TILMCKVEGKVDS--IVWLKNGV-IVQNSSRL-YINDFNLII---NQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPT-ISWYKNKKLIKYDFVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQGEVHSQPIYLTVQIPGGWSAWQEWSK 9354
            LK  K  + + + K+ +A   KL +    E+D+ +Y C+A +E G  +     K   L A S DE    + I+    +  T  C A  +P PT +W  +G  ++P D  +         Q++IS  +  D G   C A NS G D++   L  I  P I          +EG    + C  ++TGV    + W+ +G  +   T+ G+  I I  +   +      K+  G++ C+  N AG +RK F+  +   P I D +++     I   Y   + I C V G P P+V WL       + P+      +   N   +L I    +E    Y C+AQN  GK ++   +R++   AP     + ++VV       ++ C    S P + + W  + + ++    +++  A + TL +  ++ +DE  Y C A N+ G  K   +L V   P  + D +       G  + L C   G P P I + K G+ L     + I+    GS L + +  +E  G +TC A N      K+  V V  PP++SKE I + E+ + + + L C I  TSG     I W +      ++  R + +  K+ L +     ++  SY C A N+       FQ+T+   PK                L + C+ +G P P   W      IL++     G+T    D + L I  ++   +G YTC   N  G A+    V I E P+++  ++   V      T+ C   GNP P + WL   +   P              L +       GG Y+C+A N+ G+ Q  + V V  P          I     ++    G      C +   P   + W +N  +I +  P            L +      D G Y C+A N  G ++ +F + V   PT     + ++  NI E     I C  +G+P P   W K       GGR      + ++  G TL+I K +R D  +Y C  TN  G+ +++F VNV+  P I+  ++ +TP+ + G    L C V G PTP + W   +      S   + NN  L   +V      +Y+CIA NEAG+    +   +   P  V    +    ++++  + + C   + P+ +I WF+  + +    R +I+  G+ + +  A+ SD G Y C  SN+ G       + I++PP I  ++  G     +   +YL C   G P+P + W K+G  I+    RV+L+ +     + +   TD GRY C A N  G+    F + V   P  D  G +     +  G T+ L C +      A     ++W KD   ++   +    I  + ++L I      +AG Y+C+A N  G+  +   V I                                        PP ID +R   +  + V     + C   G P P+I + K+G           K+ +  + + + ++ Q+L +       +G + C A N  G   +E  + V TPP     +  P       +T +L C   G  +P  ++ W + G +   S    RIS  G R+ + ++K+ D G+Y C A N         +V+V + P   ++   +  ++ A Q+ T+Q  C   G P P + W      +       P   +   ++ +QI N+   D   Y C A N  G+    + + V+  P I          +V E       C V  Y    P + W +  + +  G     Y+T  +G+ LTI+  +S +SG Y C A N AG     + L V   PK  T        +T   G+  +  C   G P P I W      I   D  N         L I    +   I++C A+N+ G+    + ++ I+ P +       +    GT   + C  E         K  +        IF    K      +++I   +  D G Y+CT  NK    ++  ++ +   PKI    ++ +V  G+QV L C   G     I WY   N  +++T + E     ++ +I   +    +GVY C A N     E  I L V++ P++       +T    TV  + C    GIP+PVI+W R+     +    Y    + L I N L  +D+G   CIAK+ AG+   T ++ V        PI V  DE          +GKPK T             + +R     +N   +     ED+     I  R      ++ T L +   P+F+ KPK             RC A   P P I W  +G+ IE          + +    + ++GEY C+A+N VGS   S  + V       +  +  PS + K   ++ C    +  S  + W  NGV + +N + + ++N+ +L+I   +  K  D  +Y C   N    +   +    +  P    +   +  N G+ ++L C     P+ T + W KN + +  D    ++ N SL ++ V+K   GVY CVAS++ G+         + + GG S  + + K
Sbjct: 2420 LKAGKPLQSDKFVKT-SANGQKLYLFKLRETDSSKYTCIATNEAGTDKR--DFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKGSPSPTITWLKDGNAIEPNDRYVFFD---AGRQLQISKTEGSDQGRYTCIATNSVGSDDLENTLEVIIPPVIDGERREAVAVIEGFSSELFCDSNSTGV---DVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSISDELSSANIQTIVPYYP--VEINCVVSGSPHPKVYWLFD-----DKPLEPDSAAYELTNNGETLKIVRSQVEHAGTYTCEAQNNVGKARKDFLVRVT---APPHFEKEREEVVARVGDTMLLTCNAESSVPLSSVYWHAHDESVQNGVITSKYAANEKTLNVTNIQLDDEGFYYCTAVNEAGITKKFFKLIVIETPYFL-DQQKLYPIILGKRLTLDCSATGTPPPTILFMKDGKRLNESDEVDII----GSTLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPPKLSKEWI-NVEVQAGDPLTLECPIEDTSG---VHITWSRQFGKDGQLDMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGGAEAVFQVTVNTPPKIFGDSFSTTEIVADTTLEIPCRTEGIPPPEISWFLDGKPILEMP----GVTYKQGDLS-LRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEPPRVVMASEVMRVVEGRQTTIRCEVFGNPEPVVNWLKDGE---PYTSDLLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQTTTDVEVLVP--------PRIEDEERVLQGKEGNTYMVHCQVTGRPVPYVTWKRNGKEIEQFNP-----------VLHIRNATRADEGKYSCIASNEAGTAVADFLIDVFTKPTF---ETHETTFNIVEGESAKIECKIDGHPKPTISWLK-------GGRPFNMDNIILSPRGDTLMILKAQRFDGGLYTCVATNSYGDSEQDFKVNVYTKPYIDE-TIDQTPKAVAGGEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNNYDLKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIGKPTFVRKGGNLYE-VIENDTITMDCGVTSRPLPSISWFRGDKPVYLYDRYSISPDGSHITINKAKLSDGGKYICRASNEAGTSDIDLILKILVPPKIDKSNIIGNPLAIVARTIYLECPISGIPQPDVIWTKNGMDINMTDSRVILAQNNETFGIENVQVTDQGRYTCTATNRGGKASHDFSLDVLSPPEFDIHGTQ--PTIKREGDTITLTCPIKLAEDIADQVMDVSWTKDSRALDGDLTDNVDISDDGRKLTISQASLENAGLYTCIALNRAGEASLEFKVEILCTSLATVKCREHENNYIARHMPHVVTKPREMSQSANAYPPPVIDISRNDVQPQVAVNQPTIMRCAVTGHPFPSIKWLKNG-----------KEVTDDENIRIVEQGQVLQILRTDSDHAGKWSCVAENDAGVKELEMVLDVFTPPVVSVKSDNPIKAL--GETITLFCNASG--NPYPQLKWAKGGSLIFDSPDGARISLKGARLDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVLVPPEINRDGIDMSPRLPAQQSLTLQ--CLAQGKPVPQMRWTLNGTAL---THSTPGITVASDSTFIQINNVSLSDKGVYTCYAENVAGSDNLMYNVDVVQAPVISNGG----TKQVIEGELAVIECLVEGY--PAPQVSWLRNGNRVETGVQGVRYVT--DGRMLTIIEARSLDSGIYLCSATNEAGSAQQAYTLEVLVSPKIITSTP---GVLTPSSGSKFSLPCAVRGYPDPIISWTLNGNDIK--DGENGHTIGADGTLHIEKAEERHLIYECTAKNDAGADTLEFPVQTIVAPKISTSGNRYINGSEGTETVIKCEIESESSEFSWSKNGVPLLPSNNLIFSEDYK------LIKILSTRLSDQGEYSCTAANKAGNATQKTNLNVGVAPKIMERPRTQVVHKGDQVTLWCEASGVPQPAITWYK-DNELLTNTGVDETATTKKKSVIFSSISPSQAGVYTCKAENWVASTEEDIDLIVMIPPEVVPERMNVSTNPRQTVF-LSCNAT-GIPEPVISWMRDSNIAIQNNEKYQILGTTLAIRNVLP-DDDGFYHCIAKSDAGQKIATRKLIVNKPSDRPAPIWVECDE----------KGKPKKT-----------EYMIDRGDTPDDNPQLLPWKDVEDSSLNGSIAYRCMPGPRSSRTVL-LHAAPQFIVKPK-NTTAAIGAIVELRCSAAGPPHPTITWAKDGKLIEDSKFEIAYSHLKVTLNSTSDSGEYTCMAQNSVGSSTVSAFINV----DNNILPTPKPSSNQKNVAVITCYERNQAYSRGLTWEYNGVPMPKNLAGIHFMNNGSLVILDTSSLKEGDLELYTCKVRNRRRHSIPHLTSAFEGVPEVKTI-DKVEVNNGDSVVLDCEVTSDPLTTHVVWTKNDQKMLDDDAIYVLPNNSLVLLNVEKYDEGVYKCVASNSIGKAFDD---TQLNVYGGSSRREAYKK 4886          

HSP 9 Score: 544.658 bits (1402), Expect = 1.763e-154
Identity = 573/2435 (23.53%), Postives = 985/2435 (40.45%), Query Frame = 1
Query: 1735 ASIEPFKDAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITA------SCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSA-TGVPQPKITWEFNGSPV---TIDGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDN-------SLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKN-GKEIEYSNRIMAKDNT--LVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFA-PYIDMKTPNKNITYNP-IIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAINIGESL--NFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTY--ME---TIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPK--IVSLDPDKKRWILKDGELRLSC-----NSDAAPVATIEWFKDGELIRNNL--RVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMI--------------------------------------PPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRI-DFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSG-GSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPIL-----IGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFR-ETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVN-KEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNG--ITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISVTGDEGSSVTIICKVEGKPKPT--VTWKKDGQSL-QNVLGNRFRFNSENEI-NIYDLKPEDTGNYIC-IGERSGAEASTASTYLSIFTRPKFVYKPKLKN---VVQETRWKSFRCEATSHP-KPDIKWMFNGRAI--ESKLNSNGRGSITLQSVRSENAGEYKCIAKNRVG 8745
            A IE F  +EL C+  S S+ V ++W K        N    R + + + P++   K+  LSA +SD+G Y C+  +  G +  +     +  P+ S    E+S  +  +I        +C    +P P   W  + + L+P      + N+ +   +KI   + + +G   C+A+N+ G    +  L  ++ P     +  + +   GD   + C+A + VP   + W  +   V    I      NE   TL++  I+ + +G + C A N AG ++K F L +   P   D         G+ +T+ C   G PPP + +++             D   +N+ +       +L+I     E +  Y C A+N+ G+ ++ + + +  +  PK++  +   V V++     + C  +E      I+W +  GK+ +   R  +  +   L I     ED   Y+CIA N  G A+   ++ V T P I GD  +  +      + + C+T+G P P+I W   G+P+   PG  +        L + +I     G +TC A N      ++  V +  PP++         +  ++   + C +  GNP P + W K+G+P       ++ + + + L +      + G+Y C ATN+         + +LV P+  D + + +  KEG    ++C++ G P P   W      ++ Q NP            L I       +G Y+C  +N  G+A   + + +   P          +    +  + C   G+P P I WL   +   P  +   ++    +TL++ +A    GG Y+C+A N  G  +++  V V+  PYID     + I   P  + GG I   C +   P   + W + +     ++P D     ++   L +  V   D+G Y C+A+N   +L  ++   V+  PT + K    ++  + E   + + C     P P   W++ +  +    R  I+  G  + I K + SD   Y C  +NEAG    +  + + VPP I+  ++   P  +   T  L C +SG P P + WT   M+   T +  +L  NN      NV  +   RYTC ATN  G A   F   +  PP+  I    P  KR   +   + L+C        A  V  + W KD   +  +L   V+I++ G +L +  A   + G+Y C+  N+ G     + V+I+                                       PP I  +      QVA+     + C   G P P I+W K+G  + D   + + + G  L +  T    AG++ C+AEN  G  ++   + V   P +        K    +G T+ L C  SG P P + W K G  I   P    RI     +L+I  ++ +D G Y+C A N  G  E  + V +  PP I+R+ I     +     L L C A G P P + +  +G +L                + V+ +   + + +   +D G+Y C A N  G D + Y+V V   P       +  +     +   +EC + G   P  +++W R+G  + +G   +R   DG  +T+   +  D+G Y C A NE       + +EV + P+   +     +     +   + C   GYP P + W     +I   +  +     +  +  + I   + +    Y CTA N  G    +F +  I+ PKI   + G       E  +    C + + +        +K   P+L     I   DY L       + IL+ +  + G Y+C A N AG  +    L V   PK      + R  T  V  G  V   C A G P P+I W YKD  +     ++   +   K +   S++  + G++ C A N V S  +   L V++P  V  +++ V      +  + C A G P+PVI W RD     +   K       L I +   +D G Y C   +   Q   +  +++  P    +P           + + C  +G      +    G+    +  L  ++ + +  L       + S  YRC+     G +  R  L       I +P    TT  +  +++++C    G P P ITW ++G  I  SK +  Y+     L   NS    D G  TC+A+N  G   ++  I V+      LP         +V +I   E     +  +TW+ +G  + +N+ G  F  N    I +   LK  D   Y C +  R        ++        K + K ++ N   VV         CE TS P    + W  N + +  +  +      S+ L +V   + G YKC+A N +G
Sbjct: 2581 AVIEGFS-SELFCD--SNSTGVDVEWQKDGLTI---NQDTLRGDSFIQIPSS-GKKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSIS---DELSSANIQTIVPYYPVEINCVVSGSPHPKVYWLFDDKPLEPDSAAYELTNNGE--TLKIVRSQVEHAGTYTCEAQNNVG-KARKDFLVRVTAPPHFEKEREEVVARVGDTMLLTCNAESSVPLSSVYWHAHDESVQNGVITSKYAANEK--TLNVTNIQLDDEGFYYCTAVNEAGITKKFFKLIVIETPYFLDQQKLYPIILGKRLTLDCSATGTPPPTILFMK-------------DGKRLNESDEVDIIGSTLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEV--LLPPKLS-KEWINVEVQAGDPLTLEC-PIEDTSGVHITWSRQFGKDGQLDMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGGAEAVFQVTVNTPPKIFGDSFSTTEIVADTTLEIPCRTEGIPPPEISWFLDGKPILEMPG--VTYKQGDLSLRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEPPRVVMASEVMRVVEGRQTT-IRCEVF-GNPEPVVNWLKDGEPYTS--DLLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQTTTDVEVLVPPRIEDEERV-LQGKEGNTYMVHCQVTGRPVPYVTWKRNGKEIE-QFNPV-----------LHIRNATRADEGKYSCIASNEAGTAVADFLIDVFTKPTFETHETTFNIVEGESAKIECKIDGHPKPTISWLKGGR---PFNMDNIILSPRGDTLMILKAQRFDGGLYTCVATNSYGDSEQDFKVNVYTKPYID-----ETIDQTPKAVAGGEIILKCPVLGNPTPTVTWKRGD----DAVPNDSRHTIVNNYDLKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIGKPTFVRK--GGNLYEVIENDTITMDCGVTSRPLPSISWFRGDKPVYLYDRYSISPDGSHITINKAKLSDGGKYICRASNEAGTSDIDLILKILVPPKIDKSNIIGNPLAIVARTIYLECPISGIPQPDVIWTKNGMDINMTDSRVILAQNNETFGIENVQVTDQGRYTCTATNRGGKASHDFSLDVLSPPEFDIHGTQPTIKR---EGDTITLTCPIKLAEDIADQVMDVSWTKDSRALDGDLTDNVDISDDGRKLTISQASLENAGLYTCIALNRAGEASLEFKVEILCTSLATVKCREHENNYIARHMPHVVTKPREMSQSANAYPPPVIDISRNDVQPQVAVNQPTIMRCAVTGHPFPSIKWLKNGKEVTDDENIRIVEQGQVLQILRTDSDHAGKWSCVAENDAGVKELEMVLDVFTPPVVSVKSDNPIKA---LGETITLFCNASGNPYPQLKWAKGGSLIFDSPD-GARISLKGARLDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVLVPPEINRDGIDMSPRLPAQQSLTLQCLAQGKPVPQMRWTLNGTAL----------THSTPGITVASDSTFIQINNVSLSDKGVYTCYAENVAGSDNLMYNVDVVQAPVISNGGTKQVIE---GELAVIECLVEGY--PAPQVSWLRNGNRVETGVQGVRYVTDGRMLTIIEARSLDSGIYLCSATNEAGSAQQAYTLEVLVSPKIITSTPGV-LTPSSGSKFSLPCAVRGYPDPIISWTLNGNDIKDGENGH----TIGADGTLHIEKAE-ERHLIYECTAKNDAGADTLEFPVQTIVAPKI--STSGNRYINGSEGTETVIKCEIESESSEFSW---SKNGVPLLPSNNLIFSEDYKL-------IKILSTRLSDQGEYSCTAANKAGNATQKTNLNVGVAPKI-----MERPRTQVVHKGDQVTLWCEASGVPQPAITW-YKDNELLTNTGVDETATTKKKSVIFSSISPSQAGVYTCKAENWVASTEEDIDLIVMIPPEVVPERMNVSTNPRQTVFLSCNATGIPEPVISWMRDSNIAIQNNEKYQILGTTLAIRNVLPDDDGFYHCIAKSDAGQKIATRKLIVNKPSDRPAP-----------IWVECDEKGKPKKTEYMIDRGDTPDDNPQLLPWKDVEDSSL-------NGSIAYRCM----PGPRSSRTVLLHAAPQFIVKP--KNTTAAIGAIVELRCS-AAGPPHPTITWAKDGKLIEDSKFEIAYSHLKVTL---NS--TSDSGEYTCMAQNSVGSSTVSAFINVD---NNILPTPKPSSNQKNVAVITCYERNQAYSRGLTWEYNGVPMPKNLAGIHFMNNGSLVILDTSSLKEGDLELYTCKVRNRRRHSIPHLTSAFEGVPEVKTIDKVEVNNGDSVV-------LDCEVTSDPLTTHVVWTKNDQKMLDDDAIYVLPNNSLVLLNVEKYDEGVYKCVASNSIG 4864          

HSP 10 Score: 256.144 bits (653), Expect = 3.665e-67
Identity = 276/1092 (25.27%), Postives = 455/1092 (41.67%), Query Frame = 1
Query: 6199 ASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMS------CECTGYPPPTLLWYRQEQEIL--ADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDY-YLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPA-EGSPTPSIMWFY--KDMPISPYDMMNFVISNNAKVLTIPSVNKEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRYGTKTDSR-----TGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVI---ISPPKIESPKKSIMVRVGEQVLLPCIVE-GTRPFRIHWYT---PGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPK---------IFRPT----ETETTGVLNTV--------LQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPIS----VTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLNSNG---RGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILM--CKVEGKVDSI-VWLKNGVIVQNSSRLYIND--FNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPG---NISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIK-NGSLRIIGVQKEHSGVYFCVASSNQGEVHS 9291
            A  AIG      SV V  P  F    + P    F  +  +L CT+   +     I W + G  +  G     + D +  T+  +   DAGEY+C   +     S+   VE    P         +I  V+N +V +       C         + W R    +    + ER P       N  ++I ++   DA  Y C A N GG   +K  + ++ PP +    + P++  V  NM+   + S       KP + W  +   +L    DY Y    + + L I +    + G Y C A + AGQ   T  L + +PPK      I +  + V  G  V+F+C    G P P I WF   KD+ I P D   ++  N  ++  + + +++ G + C+  N  G  ++V  L V     +      VR       ++ C A G P P I+W    KG     T  + R      G L ITDA+ ED G++TC   N   Q S+S  +++   +SP     P +  ++  G+ + L C+V  GT    I W     P     +  I G    L  +G           G Y C+A + AG   + I ++++ +P+         +F+PT    + +   V+N+           + C ++ G P P+ITW  +G  ++     +T T     I         G  TC A N AG++     I +   P +S   S    V  D     TI C V G PKP +TW  D +     +      N +  + I ++     G + C  + + A   T +  L++ T P    + + K  +Q        C A + P P   W + G  I+S+L  +     G++ LQ+V+ EN G + C   N  G    S+ L V  KP++ + +     + +K   +   C+  G  + I  W KNG+ ++   + +  D    L I +A   D G Y C+ +N AG +Q   H+ V+ PP+  +LP    N +A +G+ + L C  E  P  +++W++    I  D    +++ +G+L I     E + +Y C AS+  G+  +
Sbjct:  418 APTAIG------SVIVGGPRAF----MSPIHQEFVGRDLNLSCTVESAS--AYTIYWVKTGEDIIGGPLFYHNTDTSVWTIPELSLKDAGEYECRVISNNGNYSVKTRVETRESP--------PEIFGVRNVSVPLGEAAFLHCSTRSAGEVEIRWTRYGATVFNGPNTERNPT------NGTLKIHHVTRADAGVYECMARNAGGMSTRKMRLDIMEPPSV---KVTPQD--VYFNMREGVNLSCEAMGDPKPEVHWYFKGRHLL---NDYKYQVGQDSKFLYIRDATHHDEGTYECRAMSQAGQARDTTDLMLATPPKV----EIIQNKMMVGRGDRVSFECKTIRGKPHPKIRWFKNGKDL-IKPDD---YIKINEGQLHIMGAKDEDAGAYSCVGENMAGKDVQVANLSVGRVPTIIESPHTVRVNIERQVTLQCLAVGIPPPEIEWQ---KGNVLLATLNNPRYTQLADGNLLITDAQIEDQGQFTCIARNTYGQQSQSTTLMVTGLVSPVLGHVPPEEQLIE-GQDLTLSCVVVLGTPKPSIVWIKDDKPVEEGPTIKIEGGGSLLRLRG-----GNPKDEGKYTCIAVSPAGNSTLHINVQLIKKPEFVYKPEGGIVFKPTISGMDEKHVAVVNSTHDVLDGEGFAIPC-VVSGTPPPIITWYLDGRPITPNSRDFTVTADNTLIVRKADKSYSGVYTCQATNSAGDNEQKTTIRIMNTPMISPGQSSFNMVVDD---LFTIPCDVYGDPKPVITWLLDDKPFTEGV-----VNEDGSLTIPNVNEAHRGTFTCHAQNA-AGNDTRTVTLTVHTTPTINAENQEKIALQNDDI-VLECPAKALPPPVRLWTYEGEKIDSQLIPHTIREDGALVLQNVKLENTGVFVCQVSNLAGEDSLSYTLTVHEKPKI-ISEVPGVVDVVKGFTIEIPCRATGVPEVIRTWNKNGIDLKMDEKKFSVDNLGTLRIYEADKNDIGNYNCVVTNEAGTSQMTTHVDVQEPPI--ILPSTQTNNTAVVGDRVELKCYVEASPPASVTWFRRGIAIGTDTKGYVVESDGTLVIQSASVEDATIYTCKASNPAGKAEA 1444          

HSP 11 Score: 61.6178 bits (148), Expect = 1.858e-8
Identity = 63/301 (20.93%), Postives = 127/301 (42.19%), Query Frame = 1
Query: 2002 HTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPK-ITWEFNGSPV--TIDG-NIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQP-PPRVKWLRGIAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQ 2889
            H  P   V  K  +      +   C A   P PT +W  +G+ ++ +   I+       S +K++     DSGE  C A+NS G   V    ++I++   + L   K    + +   + C        + +TWE+NG P+   + G + + N ++  LD + +++     + C   N    S           P +K  +  ++ + G+++ + C+V   P    V W +      +  +   D  ++  +NSL++  +   D+  Y C A N  GK  +  Q+ + G ++ + A+ +  +
Sbjct: 4605 HAAPQFIVKPKNTTAAIGAIVELRCSAAGPPHPTITWAKDGKLIEDSKFEIAY------SHLKVTLNSTSDSGEYTCMAQNSVGSSTVS---AFINVDNNI-LPTPKPSSNQKNVAVITCYERNQAYSRGLTWEYNGVPMPKNLAGIHFMNNGSLVILDTSSLKEGDLELYTCKVRNRRRHSIPHLTSAFEGVPEVKT-IDKVEVNNGDSVVLDCEVTSDPLTTHVVWTKN-----DQKMLDDDAIYVLPNNSLVLLNVEKYDEGVYKCVASNSIGKAFDDTQLNVYGGSSRREAYKKENE 4889          

HSP 12 Score: 59.3066 bits (142), Expect = 9.587e-8
Identity = 36/96 (37.50%), Postives = 46/96 (47.92%), Query Frame = 1
Query: 11851 CKTGFTWTSD-RGCIDIDECTSYTNPHSCQHQCINTYGSYHCLCPQGFSLNPKTMKCLDVDECRTNLGICSEKKLCINTPGNYSCIEPKCPKSYHF 12135
            C  GF      R C D+DEC  Y     C  +CIN  G + C CP G+ L  +   C DV+EC +    C + K C N  G Y CI+  CP +Y  
Sbjct: 4996 CPEGFAMNPHTRICEDLDECAFY---QPCDFECINYDGGFQCNCPLGYELAEE--GCRDVNECESVR--CEDGKACFNQLGGYECIDDPCPANYSL 5084          

HSP 13 Score: 55.4546 bits (132), Expect = 1.231e-6
Identity = 34/85 (40.00%), Postives = 44/85 (51.76%), Query Frame = 1
Query: 11032 CPPGFTLIKSQRFCEDVNECKNAKFHKCDQICENTVPRFKCNCRSGFMLSSDGKSCQDINECSKNISPCSEPNHECINTPGSYMC 11286
            CP GF +    R CED++EC  A +  CD  C N    F+CNC  G+ L+ +G  C+D+NEC    S   E    C N  G Y C
Sbjct: 4996 CPEGFAMNPHTRICEDLDEC--AFYQPCDFECINYDGGFQCNCPLGYELAEEG--CRDVNECE---SVRCEDGKACFNQLGGYEC 5073          
BLAST of Hemicentin-1 vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 949.118 bits (2452), Expect = 0.000e+0
Identity = 849/3136 (27.07%), Postives = 1379/3136 (43.97%), Query Frame = 1
Query:  205 SDPSTGISLAIVFDSTGSMGNDLKQVKRGSRRILNNHLQKGYKKFIKDFVLVQVHDPDVGPXXXXXXXXXXXXYLDYVFTQGGGDCPEMTISGIEMALEASRPHSLIYVFTDSSAKDYEITPRVLNLIQKKQSQVVFVLTGFCNSTEEIGFQVYKQIATISSGQIYILGKGDVKEFMKIIERAVETVKVHILQEESSNFGSKTYSFPIDSHITQFTIQVTNFKAN-ESIKVAIRDPEGR----ELTESNGLIRLLKSVKTVYFASKENPAPGMWTLEVTTKSSNHSVRITGASEVDFLPGFSTIPEPSNDRTSRQPIKGAKNYLMANVTGNFLPGTIEWLYIMSVNGSSIIQLPA--NQTENQIYISQYPFEIPVDGHFYIKLSGKDSRGNEMQRYSRIAIFSRDPLPVSVSCPAKI-----QVKRGHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNVTLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKNASIEPFKDAELECNVFSTSSNVVLKWFK-SIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRC-SATGVPQPKITWEFNGSP-VTIDGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRG--IAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEY--SNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGD------FKTFI---------------DAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDN-TITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAINIG--ESLNFTLVVLISPTILGKHSSKSVI---NINEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRV-EITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXX-------XXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFD-----PVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGN-LYLFCVSEGRPKPKIEWRKDGSRIDFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINR------LPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTL---MGVADPPAKITWERHGVP-LSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFY-KNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVK-ENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLT-FNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISN--NAKVLTIPSVNKEG--GIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIK--WTRDGKGIFRYG-TKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPK--KSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFL-SEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPV----------ITWERNGITLS----KVKNYYTTTDSGLFI-FNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISVTGDEG----SSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEA-TSHPKPDIKWMFNGRAIE-----SKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGK-VDSIVWLKNGVIVQNSSRLYINDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKN-KKLIKYDF-VKSLIKNGSLRIIGVQKEHSGVYFCVASSNQG 9279
            +DP+   SLA VFD TGSM +DL QV+ G+ +I    + +  +K I ++++V  HDP +G    TT +  F + L  V+  GGGDCPE T++GI  AL+ S P S IYVFTD+ +KDY +   VLN IQ+KQS VVFV+TG C +    GF+ Y++IA  S GQ++ L K DV   ++ +  AV+  KVH++ E     G+ + + P+D H+++ TI ++  K + +++ + +RDPEGR     L    G    LK+VK +     ++P+PG+WT+   ++   H++R+ G   VDF  GF++ P    +    +P+     YL+ N+TG   PGT+  + ++  +G S+ +  A  ++T   +Y +  PF +P  G F++++ G D    E  R +  AI S     V V  P        Q   G  + ++C V+S   Y I W K    II      + +  T      I   +    G Y   ++       +  GN   +  V     PP++F  +N S+   + A L C+  S +  V ++W +     +   NT+R          N  +  L I   + +D G Y C+A + GG+S     +     P+  V  +++ F   + +  SC A+  P P   W+  GR L   D +  +  D +   + I +    D G   C+A + AG       L   + PK+  +   K +   GD+ +  C +  G P PKI W  NG   +  D  I INE  G L I   +    G + CV  N AG   +  NL +G  P I +    +  +    +T++C   G PPP ++W +G  +    N P     RY    D +L+I    +EDQ  + C A+N +G+  +S  + ++G+ +P +     ++ ++E      + C+VV   P   I W+K+ K +E   + +I    + L ++    +DE  YTCIA +  G +   I + +  KP  +        FK  I               D  DG+   + C   G P P I W   GRP+T  P  R       + L V    + ++G +TC ATN      ++  + +   P IS  G S + +   +   + C +  G+P P I W  + +P  E  G V   G   I  V   NE   G++ C A N   +D+R   +T+   P  +     KI   + + + L C     P P + W+++   +D Q  P  I     +   L++  ++ E  G++ C  +N+ G   +SY + + E PKII      V  +   TI + C A+G   P++   + K  I       K   +N  TL +  A     G Y+C+  NE G  Q  + V V  P I + +   N   N  +VG  +   C + ++PPA + WF+  I I        + +  DG TL +      D+ IY C A N       N  + V+ SP I        V+   +I E     + C    NP P+  WY ++  LI      + ++  + L + K + +D  VY+C   N AGE  K+F V V VP +++    ++     +G    L C VSGFP PQI W    T+           L ++   LHF +V       Y C+A ++      + D      VL  P  IV  D + + ++ KD  L     +++    T  W  +G        V I + G +L++ +A+  + G Y C V+N  G  ++  T+D++ PP +       A+Q  +G N + L C   G PKP + W+ DG+ +D  +  L D+   L     +   + +  C AEN  G     F +Q    PT    G +      +   T+ L+C VS +    ITW+K G+P+        L + R  I+  ++  E I         Y+CVA NT GQ+    DV +   P I    +  E  I  G+E+ L C A G+P P   +  D N  D+            K  +       + + +  +  +G+Y+C A+N +G  V   +V VRT P F++   E ++     ++ +LEC +   +GV      I+W  +G P L+    ++    G  + + + K  D G Y C   NE    +  FN+ V + P    +   YT IE   N ++ + CE TG P P + W +  + +   K       +L      +I + +     +Y C A N  GT E  F++ +I  P I K   G +N     +   + F C + +    K  I+W +   PI +   D  +T  +N + LTILN   ++ G+Y+C  KN AG++S  F  TV  PP         +    V+  T V   CPA G P P I WF     I   ++ + + +   N   L I  + KEG  G + C A N  GS+ +   + VI    +  D I     S  +  V+ +   Y +P  K  W + GK +      KT +    L +   +E D+ +YTC  TN+   D +   V ++  P  + P   + I V  G    L C  +G+    I W   GN    +     Y F  + + L I +      G Y C+A N  G  ++  TLEV++ P            V++   +    ++EG    +          + W+++G+T++    +  ++     SG  + F S +  D G  TCI +N AGE R  F   V   P +S  +S    +       V I C V G P P V W  D + L+         N+   + I   + E  G Y C  + +  +A     +L   T P    K + + V +        C A +S P   + W  +  +++     SK  +N + ++ + +++ ++ G Y C A N  G  +  F L VI  P     Q   P    KR  L C   G    +I+++K+G  +  S  + I    L+I+  + +  G Y CIA N AG ++  + + V  PP  +    N+    G+ L L C  E      I+W +   K  + D   +S      L I+    E +  Y C+A ++ G
Sbjct:   29 NDPTGKSSLAFVFDITGSMFDDLVQVREGAAKIFKTVMAQ-REKLIYNYIMVPFHDPYLGEIINTTDSTYFMRQLSKVYVHGGGDCPEKTLTGILKALQISLPSSFIYVFTDARSKDYHLEDEVLNTIQEKQSSVVFVMTGDCGNRTHPGFRTYEKIAAASFGQVFHLEKSDVSTVLEYVRHAVKQKKVHLMYEARERGGTVSRNIPVDKHLSELTISLSGDKDDSDNLDIVLRDPEGRTVDKRLYSKEGGTIDLKNVKLIRL---KDPSPGVWTVNTNSRLK-HTIRVFGHGAVDFKYGFASRPLDRIELARPRPVLNQDTYLLINMTGLIPPGTVGEIDLVDYHGHSLYKAVASPHRTNPNMYFAG-PF-VPPKGLFFVRVQGYDEDNYEFMRIAPTAIGS-----VIVGGPRAFMSPIHQEFVGRDLNLSCTVESASAYTIYWVKTGEDIIGGP---LFYHNTDTSVWTIPELSLKDAGEYECRVI-------SNNGNYSVKTRVETRESPPEIFGVRNVSVPLGEAAFLHCSTRS-AGEVEIRWTRYGATVFNGPNTER----------NPTNGTLKIHHVTRADAGVYECMARNAGGMSTRKMRLDIMEPPSVKVTPQDVYFNMREGVNLSCEAMGDPKPEVHWYFKGRHL-LNDYKYQVGQDSK--FLYIRDATHHDEGTYECRAMSQAGQARDTTDLMLATPPKV-EIIQNKMMVGRGDRVSFECKTIRGKPHPKIRWFKNGKDLIKPDDYIKINE--GQLHIMGAKDEDAGAYSCVGENMAGKDVQVANLSVGRVPTIIESPHTVRVNIERQVTLQCLAVGIPPPEIEWQKGNVLLATLNNP-----RYTQLADGNLLITDAQIEDQGQFTCIARNTYGQQSQSTTLMVTGLVSPVLGHVPPEEQLIEGQ-DLTLSCVVVLGTPKPSIVWIKDDKPVEEGPTIKIEGGGSLLRLRGGNPKDEGKYTCIAVSPAGNSTLHINVQLIKKPEFVYKPEGGIVFKPTISGMDEKHVAVVNSTHDVLDGEGFAIPCVVSGTPPPIITWYLDGRPIT--PNSRDFTVTADNTLIVRKADKSYSGVYTCQATNSAGDNEQKTTIRIMNTPMISP-GQSSFNMVVDDLFTIPCDV-YGDPKPVITWLLDDKPFTE--GVVNEDGSLTIPNV---NEAHRGTFTCHAQNAAGNDTRTVTLTVHTTPTINAENQEKI-ALQNDDIVLECPAKALPPPVRLWTYEGEKIDSQLIPHTIR----EDGALVLQNVKLENTGVFVCQVSNLAGEDSLSYTLTVHEKPKIISEVPGVVDVVKGFTIEIPCRATG--VPEVIRTWNKNGIDLKMDEKKFSVDNLGTLRIYEADKNDIGNYNCVVTNEAGTSQMTTHVDVQEPPIILPSTQTN---NTAVVGDRVELKCYVEASPPASVTWFRRGIAI--GTDTKGYVVESDG-TLVIQSASVEDATIYTCKASNPAGKAEANLQVTVIASPDI----KDPDVVTQESIKESHPFSLYCPVFSNPLPQISWYLNDKPLIDDKTSWKTSDDKRKLHVFKAKITDSGVYKCVARNAAGEGSKSFQVEVIVPLNLDESKYKKKVFAKEGEEVTLGCPVSGFPVPQINWVVDGTVVEPGKKYKGATLSNDGLTLHFDSVSVKQEGNYHCVAQSKG----NILDIDVELSVLAVP--IVGEDDNLEVFLGKDISLSCDLQTESDDKTTFVWSINGSESDRPDNVQIPSDGHRLYITDAKPENNGKYMCRVTNSAGKAERTLTLDVLEPP-VFVEPVFEANQKLIGNNPIILQCQVTGNPKPTVIWKIDGNDVD--KSWLFDESLSLLRIEKLTGKSAQISCTAENKAGTASRDFFIQNIAAPTFKNEGDQETIFRES--ETITLDCPVS-LGDFQITWMKQGLPLTENDAIFTLDNTRLTILNANRDHEDI---------YTCVANNTAGQVSKDFDVVVQVLPKIKNAVVTLE--INEGEEIILTCDAEGNPTPTAKW--DFNQGDL-----------PKEAVFVNNNHTVVVNNVTKYHTGVYKCYATNKVGQAVKTINVHVRTKPRFESGLTESELTVNLTRSITLECDVDDAIGVG-----ISWTVNGKPFLAETDGVQTLAGGRFLHIVSAKTDDHGSYACTVTNEAGVATKTFNLFVQVPPTIVNEGGEYTVIE---NNSLVLPCEVTGKPNPVVTWTKDGRPVGDLK----SVQVLSEGQQFKIVHAEIAHKGSYICMAKNDVGTAEISFDVDIITRPMIQK---GIKNIVTAIKGGALPFKCPIDDDKNFKGQIIWLRNYQPIDLEAEDARITRLSNDRRLTILNVTENDEGQYSCRVKNDAGENSFDFKATVLVPPTIIM-LDKDKNKTAVEHST-VTLSCPATGKPEPDITWFKDGEAIHIENIADIIPNGELNGNQLKITRI-KEGDAGKYTCEADNSAGSVEQDVNVNVITIPKIEKDGIPSDYESQQNERVVISCPVYARPPAKITWLKAGKPLQSDKFVKTSANGQKLYLFKLRETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKGSPSPTITWLKDGNAIEPN---DRYVFFDAGRQLQISKTEGSDQGRYTCIATNSVGSDDLENTLEVIIPP------------VIDGERREAVAVIEGFSSELFCDSNSTGVDVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSISDELSSANIQTIVPYYPVEINCVVSGSPHPKVYWLFDDKPLEPDSAAYELTNNGETLKIVRSQVEHAGTYTCEAQNNVGKAR--KDFLVRVTAPPHFEKEREEVVARVGDTMLLTCNAESSVPLSSVYWHAHDESVQNGVITSKYAANEK-TLNVTNIQLDDEGFYYCTAVNEAGITKKFFKLIVIETPYFLDQQKLYPIILGKRLTLDCSATGTPPPTILFMKDGKRLNESDEVDIIGSTLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPPKLSKEWINVEVQAGDPLTLECPIEDTSGVHITWSRQFGKDGQLDMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAG 3021          

HSP 2 Score: 744.577 bits (1921), Expect = 0.000e+0
Identity = 710/2709 (26.21%), Postives = 1167/2709 (43.08%), Query Frame = 1
Query: 1438 VKRGHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNVTLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKNASIEPFKDA-ELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILS-----LDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRI-KDFVTNIDGSYGENITIRCQVEGQPPPRVKWLR-GIAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKV----IVCLVVESKPPAVISWLKNGKEI---EYSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVG--TAKFDIELDVQTKPIIIGD--FKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLR---IVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNC-IITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPK------ASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKN---DLLITQMRSE-LQG---IYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDN-TITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAIN-IGESLNFTLVVLISPTILGKHSSKSVININEETDLYITC-----------WS-EGNPAPRYLWYKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEF--LKGSTTNLWCNVSGFPTPQIRWTY----METIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFD-PVLTYPPKIVSLDPDKKRWILKDGELRLSC--NSDAAPVATIEWFKDGE---LIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRRV--LLSD---DGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRY-RIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSS----GGS-IRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEA-VQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPV--ILWTKENSPILIGD-TDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKE-GGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTR----DGKGIFRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVL-LPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQG---LIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISV-TGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESK---LNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSE-SIKRTILMCKVEGK-VDSIVWLKNGVIVQNSSRLYI-NDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANL-GEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNGSLRIIGVQK-EHSGVYFCVASSNQG 9279
            V  G G  + C+V    P +I WY +   I     D   F  T++ TL + +A++   GVY          Q T      +Q     +   P +   +++      D   + C+V+     V+       P              + +        L I + +E+  G + C A++  G       +  HT P  + + +E   + ND I   C A + PPP   W   G ++D      +I  D     + + NVK +++G  +C+  N AG D +   L+    PKI+S     +D+ K   +E     + C ATGVP+   TW  NG  + +D      + +GTL I   +KN  G + CV TN AG+S+ + ++D+   P I     TN     G+ + ++C VE  PP  V W R GIA G +        Y +  D +L+I+  S+ED + Y C A N  GK + ++Q+ +  IA+P I   +   VV + ++K+     + C V  S P   ISW  N K +   + S +       L +   K  D  +Y C+A+N  G  +  F +E+ V   P+ + +  +K  + AK+G+ + L C   G P P+I W   G    +EPG +     +S DG  L   S++ +  G + C A +    +  + ++SV A P + ++   + E+   +++ L+C + T  +      W  NG    + P  V+I    + L +     +  G Y C+ TN      R   + +L  P        ++ K+I         + L C++ G P PT  W               I  + +DK+   D  ++ +R E L G     +C   N  G+A   + +  + +P      D+  +F ++ TITL C  S     +I W+ +   +  N   + +   +   L +  A   H   Y+C+A N  G+  K+  V V    +  K  N  +T   I  G  I  +C     P    KW  N+ D    LPK+   ++ + + +     K+  +G+YKC A N +G+++    V + +        ++S + +N    + + C           W+  G P   +L   D  Q ++GGR         L I   +  D   Y C VTNEAG   K F++ V VPP+I    + E  E+  ++ ++  L C V+G P P + WT     +  + S  +LS   Q   ++ + +H   Y C+A N+ G+A   FD  ++T P  ++          +K G L   C  + D      I W ++ +   L   + R+   +   +L +LN  E+D G Y C V N  G +   +   +++PP+I    K           + L C + G+P+P I W KDG  I    +  ++ +   +G  L +    E DAG+Y C A+N+ G  +   +V V   P ++  G      E      VV+ C V   P   ITWLK G P   L S ++ +   N ++L +  ++ +D+ +Y+C+A N  G  +    V++   PS D   I+    +  G+   L CPA GSP+P I + KDGN+++     PN       R +     + L +   + +D G Y C A+N++G D +E ++ V  PP  D    E  V      +  L C           + W++ G+ ++     G S I+I   G +++  + ++ D+G Y C  +N   +   +F+  V   P          I+  V    V+++C  +G P P + W   ++ +  D   Y   ++      ++I   Q + A TY C A N  G   K F + V  PP   K        RV + M +T  C   N   + P+  + W   +  +  G  T  Y    N ++L + N + D+ G Y C A N AG     F L V   P F     ++     + LG  +   C A G+P P+I++      ++  D ++ + S     L I +  KE  G + CIA N+ G   K   +EV++P  +  + I V  ++G   ++ C  E      I W+R    DG+   R  + +D     L I  A  ED   Y+C   N          V + +PPKI     S    V +  L +PC  EG  P  I W+  G       IL       +QG   L ID ++ +  G Y CVA N AG  E    +E+   P++   +E     V      ++C++  G P+PV+ W ++G   +     ++T  S L +  +  + D G+ TCIA N AGE + T  + V + P++     V  G EG++  + C+V G+P P VTWK++G+ ++       +FN    ++I +    D G Y CI       A  A   + +FT+P F       N+V+    K   C+   HPKP I W+  GR        L+  G   + L++ R +  G Y C+A N  G  E  F + V  KP +       P   +    IL C V G    ++ W +    V N SR  I N+++L IN   ++D G Y CIA N AG         V   P F    GN+   +  + + + C     P+P+ISW++  K +      S+  +GS   I   K    G Y C AS+  G
Sbjct: 1012 VLDGEGFAIPCVVSGTPPPIITWYLDGRPITPNSRD---FTVTADNTLIVRKADKSYSGVYTC--------QATNSAGDNEQKTTIRIMNTPMISPGQSSFNMVVDDLFTIPCDVYGDPKPVITWLLDDKP--------------FTEGVVNEDGSLTIPNVNEAHRGTFTCHAQNAAGNDTRTVTLTVHTTPTINAENQEKIALQNDDIVLECPAKALPPPVRLWTYEGEKIDSQLIPHTIRED---GALVLQNVKLENTGVFVCQVSNLAGEDSLSYTLTVHEKPKIISEVPGVVDVVKGFTIE-----IPCRATGVPEVIRTWNKNGIDLKMDEKKFSVDNLGTLRIYEADKNDIGNYNCVVTNEAGTSQMTTHVDVQEPPIILPSTQTNNTAVVGDRVELKCYVEASPPASVTWFRRGIAIGTDT-----KGYVVESDGTLVIQSASVEDATIYTCKASNPAGKAEANLQVTV--IASPDI---KDPDVVTQESIKESHPFSLYCPVF-SNPLPQISWYLNDKPLIDDKTSWKTSDDKRKLHVFKAKITDSGVYKCVARNAAGEGSKSFQVEVIV---PLNLDESKYKKKVFAKEGEEVTLGCPVSGFPVPQINWVVDG--TVVEPGKKYKGATLSNDGLTLHFDSVSVKQEGNYHCVAQSKGNILDIDVELSVLAVPIVGED--DNLEVFLGKDISLSCDLQTESDDKTTFVWSINGSE-SDRPDNVQIPSDGHRLYITDAKPENNGKYMCRVTNSAGKAERTLTLDVLEPPVFVEPVFEANQKLIG-----NNPIILQCQVTGNPKPTVIWK--------------IDGNDVDKSWLFDESLSLLRIEKLTGKSAQISCTAENKAGTASRDFFIQNIAAPTFKNEGDQETIFRESETITLDCPVSLGDF-QITWMKQGLPLTENDAIFTL---DNTRLTILNANRDHEDIYTCVANNTAGQVSKDFDVVV---QVLPKIKNAVVTLE-INEGEEIILTCDAEGNPTPTAKWDFNQGD----LPKEAVFVNNNHTVVVNNVTKY-HTGVYKCYATNKVGQAVKTINVHVRTKPRFESGLTESELTVNLTRSITLECDVDDAIGVGISWTVNGKP---FLAETDGVQTLAGGRF--------LHIVSAKTDDHGSYACTVTNEAGVATKTFNLFVQVPPTI----VNEGGEYTVIENNSLVLPCEVTGKPNPVVTWTKDGRPVGDLKSVQVLSEGQQFKIVHAEIAHKGSYICMAKNDVGTAEISFDVDIITRP--MIQKGIKNIVTAIKGGALPFKCPIDDDKNFKGQIIWLRNYQPIDLEAEDARITRLSNDRRLTILNVTENDEGQYSCRVKNDAGENSFDFKATVLVPPTIIMLDKDKNKTAVEHSTVTLSCPATGKPEPDITWFKDGEAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSAGSVEQDVNVNVITIPKIEKDGIPS-DYESQQNERVVISCPVYARPPAKITWLKAGKP---LQSDKFVKTSANGQKLYLFKLRETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKGSPSPTITWLKDGNAIE-----PND------RYVFFDAGRQLQISKTEGSDQGRYTCIATNSVGSDDLENTLEVIIPPVIDGERRE-AVAVIEGFSSELFCDSNSTG---VDVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSISDELSSANIQTIVPYYPVEINCVVSGSPHPKVYWLFDDKPLEPDSAAY---ELTNNGETLKIVRSQVEHAGTYTCEAQNNVGKARKDFLVRVTAPPHFEKER-EEVVARVGDTMLLT--C---NAESSVPLSSVYWHAHDESVQNGVITSKYAA--NEKTLNVTNIQLDDEGFYYCTAVNEAGITKKFFKLIVIETPYFLDQQKLY----PIILGKRLTLDCSATGTPPPTILFMKDGKRLNESDEVDIIGS----TLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPPKLSKEWINVEVQAGDPLTLECPIEDTSGVHITWSRQFGKDGQLDMRAQSSSDKSK--LYIMQATPEDADSYSCIAVNDAGGAEAVFQVTVNTPPKIFGDSFSTTEIVADTTLEIPCRTEGIPPPEISWFLDG-----KPILEMPGVTYKQGDLSLRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEPPRVVMASEVMRV-VEGRQTTIRCEVF-GNPEPVVNWLKDGEPYTSDLLQFSTKLSYLHLRET-TLADGGTYTCIATNKAGESQTTTDVEVLVPPRIEDEERVLQGKEGNTYMVHCQVTGRPVPYVTWKRNGKEIE-------QFNPV--LHIRNATRADEGKYSCIASNEAGTA-VADFLIDVFTKPTFETHETTFNIVEGESAK-IECKIDGHPKPTISWLKGGRPFNMDNIILSPRGDTLMILKAQRFD-GGLYTCVATNSYGDSEQDFKVNVYTKPYIDETIDQTPKAVAGGEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNNYDLKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIGKPTFVRKGGNLYEVIENDTITMDCGVTSRPLPSISWFRGDKPVYLYDRYSISPDGSHITINKAKLSDGGKYICRASNEAG 3559          

HSP 3 Score: 738.028 bits (1904), Expect = 0.000e+0
Identity = 662/2512 (26.35%), Postives = 1096/2512 (43.63%), Query Frame = 1
Query: 1900 KLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASV---DEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVN-DVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTV-RCSATGVPQPKITWEFNGSPVTIDGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKD--FVTNIDGSYGENITIRCQVEGQPPPRVKWLR-GIAGGYNIPIALGDRY-FINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAV-ISWLKNGKEIEYSN-------RIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIV------LQCQTKGDPKPKIEWRKGGRPLTMEP-GLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSK--ENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIY-TKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQET-LIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAIN-IGESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLF-DPVLTYPPKIVSLDPDKKRWILKDGE-LRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRI--DFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPT-LDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLM---GVADPPAKITWERHGVPLSSG--GSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKE-NMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVN-KEGGIFKCIARNEVGSIMKVYKLEVIM-PALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGK----GIFRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDV-VIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKV-SLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSF-RCEATSHPKPDIKWMFNGR-AIESKLNSNGRGS-ITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGKVDSIVWL-KNGVIVQNSSRLYINDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQG 9279
            +L IL+ +E+D G+Y C  +++ G   +  F  T  +P   +    +K  + +++ ++T SC A   P P  +WF +G  +   +    I N ++  +Q+KI+ +K  D+G+  C+A NSAG  E  + ++ I++PKI    +  +   + +++ V  C     P  KITW   G P+  D  +  +     L + ++ +    ++ C+ATN AG+ ++ F + +   P   +   V  I  + G   T+ C  +G P P + WL+ G A      I   DRY F +    L I      DQ  Y C A N  G   + ++  +  I  P I   + + V V       + C   +S    V + W K+G  I           +I +    +   + +  D   YTCI +N  G A+   +  V   P I  +    + + +   IV      + C   G P PK+ W    +PL  EP      ++ +G  L +     EHAGT+TC A N+     K+F V V APP   KE     E+ ++  + + L C   S  P   + W+ + + +       + A  +  L V     D+ G Y C A NE     +FF++ ++  P   D +  K+Y    G++LTL+C   G P PT  +      L+ + +   I  S      L+I   + E++G YTC   N  G ++    V +L  PK+ +      V   + +TL C         I W   ++      +  +    + ++ L + +A       YSC+A N+ G  +    VTV  P    K    + +   I+    +   C     PP EI WF +   I + +P   +K      +L +  +K    G Y C+A N  G +   T V +  P  +   S   V+ + E     I C   GNP P   W KD     S   ++ +     L +++   +D   Y C  TN+AGE +   DV V VPP I         +  +G+T  + C V+G P P + W      N   +   N  LH  N  ++   +Y+CIA+NEAG+A   F   V T P    + +  +  + + +GE  ++ C  D  P  TI W K G    N   + ++ RG  L +L AQ  D G+Y C+ +N  G  +Q + V++   P I          VA GG + L C   G P P + W++    +  D R  ++++  Y L +NS    DAG+Y CIA N  G     +  +V   PT +  GG  Y  +E     T+ ++C V+  P P+I+W +   P+      RY I  +   + I   + SD G+Y C A N  G  +I + + I  PP ID++ I+   +  V   + L CP +G P P++ + K+G  ++M D           R++++Q  +   + + + TD G Y C A+N  G    ++S+ V +PPEFD    +P +      T +L C +     +AD    ++W +    L      ++ IS DG ++T+      +AG Y C A N   + SL F VE+   P    ++   + +   N    M C  TG+P P++ W +  +E+  D+       I+    V+QI     D A  ++C A N  G  E +  + V  PP +  +S  P    +K     IT  C+        P + W K  S I        ++   G  L I + K  + G YTC+A N AG    +  + V  PP+   D       +  Q   S+  QC A+G P P + W      ++ +      +++++  + I +V+  + G++ C A N  GS   +Y ++V+  P +      +V E  G    + C  EGYP P + W R+G     G+      TD R  +L I +A+  D+G Y C+ TN+     ++  + V++SP  I S    +    G +  LPC V G     I W   GN+ I     G +   ++  L I++  + H  +Y C A NDAG   +   ++ +V PKI         G   T   ++C+I         +W +NG+ L    N   + D  L    S ++ D+G  +C A N AG       + V + PK+   P +    +G  VT+ C+  G P+P +TW KD + L N   +      +  +    + P   G Y C  E   A ++     L +   P+ V  P+  NV    R   F  C AT  P+P I WM +   AI++       G+ + +++V  ++ G Y CIAK+  G        + IA  ++ V   + PS+      + C  +GK     ++   G    ++ +L        +     +D+ +   IA       +    +L+ + P F + P N +A +G ++ L C+A G P PTI+W K+ KLI+    K  I    L++       SG Y C+A ++ G
Sbjct: 2250 RLTILNVTENDEGQYSCRVKNDAG-ENSFDFKATVLVPPTIIMLDKDKNKTAVEHSTVTLSCPATGKPEPDITWFKDGEAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSAGSVEQDVNVNVITIPKIEKDGIPSDYESQQNERVVISCPVYARPPAKITWLKAGKPLQSDKFVKTSANGQKLYLFKLRETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKGSPSPTITWLKDGNA------IEPNDRYVFFDAGRQLQISKTEGSDQGRYTCIATNSVG--SDDLENTLEVIIPPVIDGERREAVAVIEGFSSELFC---DSNSTGVDVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSISDE----LSSANIQTIVPYYPVEINCVVSGSPHPKVYWLFDDKPL--EPDSAAYELTNNGETLKIVRSQVEHAGTYTCEAQNNVGKARKDFLVRVTAPPHFEKE---REEVVARVGDTMLLTCNAESSVPLSSVYWHAHDESVQNGVITSKYAANEKTLNVTNIQLDDEGFYYCTAVNEAGITKKFFKLIVIETPYFLDQQ--KLYPIILGKRLTLDCSATGTPPPTILFMKDGKRLN-ESDEVDIIGS-----TLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPPKLSKEWINVEVQAGDPLTLECPIEDTSGVHITW--SRQFGKDGQLDMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGGAEAVFQVTVNTP---PKIFGDSFSTTEIVADTTLEIPCRTEGIPPPEISWFLDGKPILE-MPGVTYKQG--DLSLRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEPPRVVMASE--VMRVVEGRQTTIRCEVFGNPEPVVNWLKDGEPYTSD-LLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQTTTDVEVLVPPRIE--DEERVLQGKEGNTYMVHCQVTGRPVPYVTWKR----NGKEIEQFNPVLHIRNATRADEGKYSCIASNEAGTAVADFLIDVFTKP----TFETHETTFNIVEGESAKIECKIDGHPKPTISWLKGGRPF-NMDNIILSPRGDTLMILKAQRFDGGLYTCVATNSYGDSEQDFKVNVYTKPYIDETIDQTPKAVA-GGEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNN--YDLKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIGKPTFVRKGGNLYEVIEND---TITMDCGVTSRPLPSISWFRGDKPVYLYD--RYSISPDGSHITINKAKLSDGGKYICRASNEAGTSDIDLILKILVPPKIDKSNIIGNPLAIVARTIYLECPISGIPQPDVIWTKNGMDINMTD----------SRVILAQNNETFGIENVQVTDQGRYTCTATNRGGKASHDFSLDVLSPPEFDIHGTQPTIKR-EGDTITLTCPIKLAEDIADQVMDVSWTKDSRALDGDLTDNVDISDDGRKLTISQASLENAGLYTCIALNRAGEASLEFKVEILSPPVIDISRNDVQPQVAVNQPTIMRCAVTGHPFPSIKWLKNGKEVTDDE----NIRIVEQGQVLQILRTDSDHAGKWSCVAENDAGVKELEMVLDVFTPPVVSVKSDNP----IKALGETITLFCNASGNPY--PQLKWAKGGSLIFDSPDGARISLK-GARLDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVLVPPEINRDGIDMSPRLPAQ--QSLTLQCLAQGKPVPQMRWTLNGTALT-HSTPGITVASDSTFIQINNVSLSDKGVYTCYAENVAGSDNLMYNVDVVQAPVISNGGTKQVIE--GELAVIECLVEGYPAPQVSWLRNGNRVETGVQGVRYVTDGR--MLTIIEARSLDSGIYLCSATNEAGSAQQAYTLEVLVSPKIITSTPGVLTPSSGSKFSLPCAVRGYPDPIISWTLNGND-IKDGENG-HTIGADGTLHIEKAEERHL-IYECTAKNDAGADTLEFPVQTIVAPKISTSGNRYINGSEGTETVIKCEIESE--SSEFSWSKNGVPLLPSNNLIFSEDYKLIKILSTRLSDQGEYSCTAANKAGNATQKTNLNVGVAPKIMERPRTQVVHKGDQVTLWCEASGVPQPAITWYKDNELLTNTGVDETATTKKKSVIFSSISPSQAGVYTCKAENWVA-STEEDIDLIVMIPPEVV--PERMNVSTNPRQTVFLSCNATGIPEPVISWMRDSNIAIQNNEKYQILGTTLAIRNVLPDDDGFYHCIAKSDAG--------QKIATRKLIV---NKPSDRPAPIWVECDEKGKPKKTEYMIDRGDTPDDNPQL--------LPWKDVEDSSLNGSIAYRCMPGPRSSRTVLLHAAPQFIVKPKNTTAAIGAIVELRCSAAGPPHPTITWAKDGKLIEDS--KFEIAYSHLKVTLNSTSDSGEYTCMAQNSVG 4644          

HSP 4 Score: 723.005 bits (1865), Expect = 0.000e+0
Identity = 662/2523 (26.24%), Postives = 1089/2523 (43.16%), Query Frame = 1
Query: 1903 LIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNII---INETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNI-DGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYF-INQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNR--IMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIG-DFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSK-ENVELNCIITSGNPSPKIEWYKNGQPLVEIPGR----VEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQ--FNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIV-TVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAINIGE--SLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSI-NGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWT-----YMETIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCV--SEGRPKPKIEWRKDGSRIDF-----RRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPT---LDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDG--IPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCEC--TGYPPPTLLWYRQEQEILADKERYPKF-DILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGS-PTPSIMWFYKDMPISPYDMMNFVISN----NAKVLTIPSVN-KEGGIFKCIARNEVGSIMKVYKLEVI-MPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQG-----LIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNY-YTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISVTGD-EGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSE-NEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSF--RCEATSHPKPDIKWMFNGRAIESKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGKVD-SIVWLKNGV-IVQNSSRLYINDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPP-VFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQGEVHSQ 9294
            LI+  A +S +G Y C A +  G +E    I+    P  S  +   + + +D  T  C     P P  +W L+ +          +VN  ++  + I NV     G   C A+N+AG D   + L+  + P I + +  K I L+ D   + C A  +P P   W + G    ID  +I   I E  G L +  ++    G +VC  +N AG    S+ L +   P+I   V  + D   G  I I C+  G P     W +       I + + ++ F ++   +L I      D   Y C   N+ G  Q +  + +     P I    ++         +V +   VE+ PPA ++W + G  I    +  ++  D TLVI++   ED  IYTC A N  G A+ ++++ V   P I   D  T    K+     L C    +P P+I W    +PL ++       S D  +L V+      +G + C A N      K F+V V  P  + +          + E V L C + SG P P+I W  +G  +VE PG+      ++     L     +  + G+Y C A ++ +      ++++L  P   +   ++++  +   L+ + + +     T  WS   S  D   N       P D + L IT  + E  G Y C  TN  G A+ +  + +LE P  ++  F     +  +N I L C  +GNP P + W      I  N V    + +   +L+     +    + SC AEN+ G   ++  +  + AP    +   + I          IT  C + S    +I W K  +     L ++    +LD + LT+         IY C+A N     S +F +VV + P I    ++   + INE  ++ +TC +EGNP P   W  D +Q          N   T+++  V +    VY+C+ TN+ G+  K  +V+V   P   +G++  E    L  S T L C+V       I WT     ++   +    L+    LH ++        Y C  TNEAG A K F+  +  PP IV  +   +  ++++  L L C     P   + W KDG  + +   V + + G Q  +++A+ +  G Y C+  N +G  + ++ VDI+  P I+   K     +  GG L   C    +   K +I W ++   ID      R   LS+D   LT+ +  E D G+Y C  +N  G+    F   V   PT   LD   K    VE +   TV L C  +G P P ITW KDG  I I  +         N  QL+I  ++  DAG+Y+C A N+ G +E  ++V +   P I+++ I ++Y  +  + + + CP    P   I + K G  L              K +  S   Q L L+  + TDS  Y C A+N  G D  ++ V +   P FD  N+  ++   +    +L C   G   P   ITW + G  +           G ++ +   +  D G Y C A N V    L   +EV + P     +    +  ++  + ++ C+   TG     + W +    I  D  R   F  I      M   + +  D+  Y C   N  G   K F+ +V  PP I           +     +  +C V       P + W  ++ P+      Y LT NNG++L I+  + + +G YTCEA+N  G+    F++ VT+PP F  +    RE +  ++G ++   C AE S P  S+ W   D  +      N VI++    N K L + ++   + G + C A NE G   K +KL VI  P  +   K+      G   ++ C+A G P P I + +DGK +     + D     L I + ++E  GRYTC   NK  +  K + V ++ PPK+     ++ V+ G+ + L C +E T    I W    + Q      G+    ++       L I +   + +  Y C+A NDAG  E    + V   PKIF  + + T  V +T L++ C+  EGIP P I+W  +G  + ++    Y   D  L I N +K   EG  TC+A+N AG       + +   P+V +   V    EG   TI C+V G P+P V W KDG+   + L    +F+++ + +++ +    D G Y CI      E+ T +T + +   P+   + +   V+Q     ++   C+ T  P P + W  NG+ IE + N      + +++    + G+Y CIA N  G+    F+++V  KP    +++       +   + CK++G    +I WLK G     ++  L      L+I +A+  D G+Y C+A+NS G+++    + V + P +   +     A  G  +IL C   G P PT++W +    +  D   +++ N  L+I  V  E +G Y C+A +  G + + 
Sbjct: 1056 LIVRKADKSYSGVYTCQATNSAGDNEQKTTIRIMNTPMISPGQSSFNMVVDDLFTIPCDVYGDPKPVITWLLDDKPFTE-----GVVN--EDGSLTIPNVNEAHRGTFTCHAQNAAGNDTRTVTLTVHTTPTINAENQEK-IALQNDDIVLECPAKALPPPVRLWTYEGE--KIDSQLIPHTIRED-GALVLQNVKLENTGVFVCQVSNLAGEDSLSYTLTVHEKPKIISEVPGVVDVVKGFTIEIPCRATGVPEVIRTWNKN-----GIDLKMDEKKFSVDNLGTLRIYEADKNDIGNYNCVVTNEAGTSQMTTHVDVQ---EPPIILPSTQTNNTAVVGDRVELKCYVEASPPASVTWFRRGIAIGTDTKGYVVESDGTLVIQSASVEDATIYTCKASNPAGKAEANLQVTVIASPDIKDPDVVTQESIKESHPFSLYCPVFSNPLPQISWYLNDKPL-IDDKTSWKTSDDKRKLHVFKAKITDSGVYKCVARNAAGEGSKSFQVEVIVPLNLDESKYKKKVFAKEGEEVTLGCPV-SGFPVPQINWVVDGT-VVE-PGKKYKGATLSNDGLTLHFDSVSVKQEGNYHCVAQSKGNILDIDVELSVLAVPIVGEDDNLEVFLGKDISLSCDLQTESDDKTTFVWSINGSESDRPDN----VQIPSDGHRLYITDAKPENNGKYMCRVTNSAGKAERTLTLDVLEPPVFVEPVFEANQKLIGNNPIILQCQVTGNPKPTVIWK-----IDGNDVDKSWLFDESLSLLRIEKLTGKSAQISCTAENKAGTASRDFFIQNIAAPTFKNEGDQETIFRE----SETITLDCPV-SLGDFQITWMKQGL----PLTENDAIFTLDNTRLTILNANRDHEDIYTCVANNTAGQVSKDFDVVVQVLPKI---KNAVVTLEINEGEEIILTCDAEGNPTPTAKW--DFNQGDLPKEAVFVNNNHTVVVNNVTKYHTGVYKCYATNKVGQAVKTINVHVRTKPRFESGLTESELTVNLTRSIT-LECDVDDAIGVGISWTVNGKPFLAETDGVQTLAGGRFLHIVSAKTDDHGSYACTVTNEAGVATKTFNLFVQVPPTIV--NEGGEYTVIENNSLVLPCEVTGKPNPVVTWTKDGRPVGDLKSVQVLSEGQQFKIVHAEIAHKGSYICMAKNDVGTAEISFDVDIITRPMIQKGIKNIVTAIK-GGALPFKCPIDDDKNFKGQIIWLRNYQPIDLEAEDARITRLSND-RRLTILNVTENDEGQYSCRVKNDAGENSFDFKATVLVPPTIIMLDKD-KNKTAVEHS---TVTLSCPATGKPEPDITWFKDGEAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSAGSVEQDVNVNVITIPKIEKDGIPSDYESQQNERVVISCPVYARPPAKITWLKAGKPL-----------QSDKFVKTSANGQKLYLFKLRETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKG--SPSPTITWLKDGNAIEPNDRYVFFDAGRQLQISKTEGSDQGRYTCIATNSVGSDDLENTLEVIIPP-VIDGERREAVAVIEGFSSELFCDSNSTGV---DVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSISDELSSANIQTIVPYYPVEINCVVSG--SPHPKVYWLFDDKPLEPDSAAYELT-NNGETLKIVRSQVEHAGTYTCEAQNNVGKARKDFLVRVTAPPHFEKE----REEVVARVGDTMLLTCNAESSVPLSSVYWHAHDESV-----QNGVITSKYAANEKTLNVTNIQLDDEGFYYCTAVNEAGITKKFFKLIVIETPYFLDQQKL-YPIILGKRLTLDCSATGTPPPTILFMKDGKRL-NESDEVDIIGSTLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPPKLSKEWINVEVQAGDPLTLECPIEDTSGVHITW----SRQFGKD--GQLDMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGGAEAVFQVTVNTPPKIFGDSFSTTEIVADTTLEIPCRT-EGIPPPEISWFLDGKPILEMPGVTYKQGDLSLRIDN-IKPNQEGRYTCVAENKAGRAEQDTYVEISEPPRVVMASEVMRVVEGRQTTIRCEVFGNPEPVVNWLKDGEPYTSDL---LQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQT-TTDVEVLVPPRIEDEER---VLQGKEGNTYMVHCQVTGRPVPYVTWKRNGKEIE-QFNP----VLHIRNATRADEGKYSCIASNEAGTAVADFLIDVFTKPTFETHETTFNIVEGESAKIECKIDGHPKPTISWLKGGRPFNMDNIILSPRGDTLMILKAQRFDGGLYTCVATNSYGDSEQDFKVNVYTKPYIDETIDQTPKAVAGGEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNNYDLKINSVTTEDAGQYSCIAVNEAGNLTTH 3472          

HSP 5 Score: 703.745 bits (1815), Expect = 0.000e+0
Identity = 664/2533 (26.21%), Postives = 1034/2533 (40.82%), Query Frame = 1
Query: 1903 LIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPK--ITWEFNGSPVTI---DGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRI--KDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQD---NSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSN--RIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIG-DFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNG----QPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDS-------KMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIA-SGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTP---NKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAIN-IGESLNFTLVVLISPTILGKHSSKSVININEETD--LYITCWSEGNPAPRYLW---YKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTY----METIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRID-FRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFT---NQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVIL---WTKENSPILIGD-TDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTS--VNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKE-GGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRY--GTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQ--VLLPCIVEGTRPFRIHWYTPGNNQISST----ILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITL-SKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKV--SLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLN---SNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEV------IAKPRVRVYQSDDPSESIKRTILMCKVEGKVD-SIVWLKNGVIVQNSS---RLYINDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQGE 9282
            L I+SA   D+G Y C   +E GV+     +     P    +  E + I+N+S+   C     P P  +W  +GR   P     S+    +  Q KI + +    G  IC AKN  G  E+   +  I+ P I          ++G     +C        K  I W  N  P+ +   D  I        L I  + +N +GQ+ C   N AG +   F   +   P I   D   N        +T+ C   G+P P + W +    G  I I        N +   N L I  +   D   Y C+A N  G V++ V + +  I  PKI              ++V++   V ++PPA I+WLK GK ++     +  A    L +  ++  D + YTCIA N+ GT K D ++ +   P     +    I    G+   L C  KG P P I W K G    +EP  R V    G QL +        G +TC ATN   +   E  + V  PP I  E      +    + EL C   S +    +EW K+G    Q  +     ++I      +      + ++G Y C   N      + F   +   P  SD         ++  Y  E     +NC + G P P   W +    L+     + +TN   +   L I + + E  G YTC+  N  G A+  + V +   P   +  ++ V  + +T+ LTC A S  P   + W    + +  N V       N++TL V        G Y C A NE G  +K      F   I ++TP   ++   Y PII+G  +T  C    TPP  I + K+   + +S      ++ + GSTL +   +    G Y C+A N  G S    +V ++ P  L    SK  IN+  +    L + C  E        W   +  + QL    R + ++    L I +    D   Y C   N+AG  +  F V V  PP I G S   T E +  +T  + C   G P P+I W      +  +        +  L   N+  +   RYTC+A N+AG A +     ++ PP++V      +  +++  +  + C     P   + W KDGE   ++L +  + + + LHL     +D G Y C+ +NK G  +    V++++PP I+   +    Q   G    + C   GRP P + W+++G  I+ F  VL         + +    D G+Y CIA N  G     F + V   PT +     +  VE   G +  +EC + G P P I+WLK G P N + +      G++  L I+  Q  D G Y+CVA N++G  E    V +   P ID   I        G E+ L CP  G+P P + + K G+     D  PN      +  +V+     L + S    D+G Y C A N  G     Y+  V   P F    V    N +    N T +++C +   + P   I+W R   P+       ISPDG+ IT+   K  D G+Y C A NE     +   +++ + P+  K+ +     A+   T+ + C  +G P P ++W +   +I     R     + + N    I N+Q  D   Y CTATN GG     F + V+ PP+       P   R  E   IT  C +         ++   WTK+ S  L GD TD     ++G+ LTI     + +G YTC A N AG+ S  F + + SPP       I R  +  Q+  +     +C   G P PSI W      ++  D  N  I    +VL I   + +  G + C+A N+ G       L+V  P +V +      +  G + ++ C A G P P +KW + G  IF    G +   +   L+I   K+ D G YTC   N       SV V ++ PP+I      +  R+  Q  + L C+ +G    ++ W   G     ST    +  +  F+      I+ V     GVY C A N AG   +   ++V+  P I   +   T  V+   L +   ++EG P P ++W RNG  + + V+     TD  +      +  D G   C A N AG  +  + + V + PK+  S P  +T   GS  ++ C V G P P ++W  +G  +++   N     ++  ++I   + E    Y C   ++ A A T    +     PK            E      +CE  S          NG  +    N   S     I + S R  + GEY C A N+ G+      L V      + +PR +V    D      +  L C+  G    +I W K+  ++ N+           ++I +       G+Y C A N     +  + L+V  PP       N+S N  + + L C A G P P ISW ++  +   +  K  I   +L I  V  +  G Y C+A S+ G+
Sbjct: 2063 LHIVSAKTDDHGSYACTVTNEAGVATKTFNLFVQVPPTIVNEGGEYTVIENNSLVLPCEVTGKPNPVVTWTKDGR---PVGDLKSVQVLSEGQQFKIVHAEIAHKGSYICMAKNDVGTAEISFDVDIITRPMIQKGIKNIVTAIKGGALPFKCPIDDDKNFKGQIIWLRNYQPIDLEAEDARITRLSNDRRLTILNVTENDEGQYSCRVKNDAGENSFDFKATVLVPPTIIMLDKDKNKTAVEHSTVTLSCPATGKPEPDITWFKD---GEAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSAGSVEQDVNVNV--ITIPKIEKDGIPSDYESQQNERVVISCPVYARPPAKITWLKAGKPLQSDKFVKTSANGQKLYLFKLRETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKGSPSPTITWLKDGN--AIEPNDRYVFFDAGRQLQISKTEGSDQGRYTCIATNSVGSDDLENTLEVIIPPVIDGERREAVAVIEGFSSELFC--DSNSTGVDVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSISDELSSANIQTIVPYYPVE-----INCVVSGSPHPKVYWLFDDKPLEPDSAAYELTN---NGETLKIVRSQVEHAGTYTCEAQNNVGKARKDFLVRVTAPPHFEKEREEVVARVGDTMLLTCNAESSVPLSSVYWHAHDESVQ-NGVITSKYAANEKTLNVTNIQLDDEGFYYCTAVNEAGITKK------FFKLIVIETPYFLDQQKLY-PIILGKRLTLDCSATGTPPPTILFMKDGKRLNES-----DEVDIIGSTLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPPKL----SKEWINVEVQAGDPLTLECPIEDTSGVHITWSRQFGKDGQL--DMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGGAEAVFQVTVNTPPKIFGDSFSTT-EIVADTTLEIPCRTEGIPPPEISWFLDGKPILEMPGVTYKQGDLSLRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEPPRVVMASEVMR--VVEGRQTTIRCEVFGNPEPVVNWLKDGEPYTSDL-LQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQTTTDVEVLVPPRIEDEERV--LQGKEGNTYMVHCQVTGRPVPYVTWKRNGKEIEQFNPVL--------HIRNATRADEGKYSCIASNEAGTAVADFLIDVFTKPTFETHETTFNIVE---GESAKIECKIDGHPKPTISWLKGGRPFN-MDNIILSPRGDT--LMILKAQRFDGGLYTCVATNSYGDSEQDFKVNVYTKPYIDET-IDQTPKAVAGGEIILKCPVLGNPTPTVTW-KRGD-----DAVPND----SRHTIVNNYD--LKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIGKPTF----VRKGGNLYEVIENDTITMDCGV--TSRPLPSISWFRGDKPVYLYDRYSISPDGSHITINKAKLSDGGKYICRASNEAGTSDIDLILKILVPPKIDKSNIIGNPLAIVARTIYLECPISGIPQPDVIWTKNGMDINMTDSR---VILAQNNETFGIENVQVTDQGRYTCTATNRGGKASHDFSLDVLSPPEFDIHGTQPTIKR--EGDTITLTCPIKLAEDIADQVMDVSWTKD-SRALDGDLTDNVDISDDGRKLTISQASLENAGLYTCIALNRAGEASLEFKVEILSPPVI----DISRNDVQPQVAVNQPTIMRCAVTGHPFPSIKWLKNGKEVT--DDENIRIVEQGQVLQILRTDSDHAGKWSCVAENDAGVKELEMVLDVFTPPVVSVKSDNPIKALGETITLFCNASGNPYPQLKWAKGGSLIFDSPDGARISLKGARLDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVLVPPEINRDGIDMSPRLPAQQSLTLQCLAQGKPVPQMRWTLNGTALTHSTPGITVASDSTFIQ-----INNVSLSDKGVYTCYAENVAGSDNLMYNVDVVQAPVI---SNGGTKQVIEGELAVIECLVEGYPAPQVSWLRNGNRVETGVQGVRYVTDGRMLTIIEARSLDSGIYLCSATNEAGSAQQAYTLEVLVSPKIITSTPGVLTPSSGSKFSLPCAVRGYPDPIISWTLNGNDIKDG-ENGHTIGADGTLHIEKAE-ERHLIYECTA-KNDAGADTLEFPVQTIVAPKISTSGNRYINGSEGTETVIKCEIESESSEFSWSK-NGVPLLPSNNLIFSEDYKLIKILSTRLSDQGEYSCTAANKAGNATQKTNLNVGVAPKIMERPRTQVVHKGD------QVTLWCEASGVPQPAITWYKDNELLTNTGVDETATTKKKSVIFSSISPSQAGVYTCKAENWVASTEEDIDLIVMIPPEVVPERMNVSTNPRQTVFLSCNATGIPEPVISWMRDSNIAIQNNEKYQILGTTLAIRNVLPDDDGFYHCIAKSDAGQ 4487          

HSP 6 Score: 690.649 bits (1781), Expect = 0.000e+0
Identity = 653/2557 (25.54%), Postives = 1106/2557 (43.25%), Query Frame = 1
Query: 1840 KNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTH----TLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPL-EGDQQTVRCSATGVPQPKITWEFNGSPVTIDG-NIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKD--FVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRY----FINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVC-LVVESKPPAVISWLKNGKEIEYSN--RIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGD-FKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKS--VVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKN--EIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAIN-IGES-LNFTLVVLISPTILGKHSSKSVININEETDLYITCW--SEGNPAPRYLWYKDNSQLIS----GGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRW------TYMETIXXX--XXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELR------LSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFR-RVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPIN----RLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSI-DRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGG-SIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQS-LTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPK-FPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSV--NKEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISVT--GDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLS--IFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAI--ESKLNSNGRGS-ITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRV-RVYQSDDPSESIKRTI-LMCKVEG-KVDSIVWLKNGV-IVQNSSRLYI--NDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANL-GEVLILPCA---AEGYP--IPTISWYKNKKLIKYDFVKSLIKNGSLRIIGVQK---EHSGVYFCVASSNQGEV 9285
            KN    +++  K S +   + L I  A ++D G Y CV  +E G S+    +        LP+   +   +     D +   C   ++PP + +WF  G  +  TD +  +V    +  + I +   +D+    CKA N AG  E  ++++ I+ P I   D+  +  + E    ++ C     P P+I+W  N  P+  D  +   ++    L + + +    G + CVA N+AG   KSF +++     + +  +   +    GE +T+ C V G P P++ W+  + G    P   G +Y      N   +L    +S++ +  Y C AQ++ G + + + + +S +A P +    + +V +   +   + C L  ES       W  NG E +  +  +I +  + L I   K E+   Y C   N  G A+  + LDV   P+ +   F+        + I+LQCQ  G+PKP + W+  G  +        +     S L +  +T + A   +CTA N      ++F +   A P    EG  +      E + L+C ++ G+   +I W K G PL E      +   +  L +   N D    Y C A N     S+ F + + V PK  ++ ++ +   EGE++ L C  +G PTPT KW +     DL +    + N+    + +++  +     G+Y C  TN  G A  + +V +   P+      +S   V +  +ITL C         I W    K       G + +   +   IV      HG  Y+C   NE G   K   + V  P   +   N+   Y  +I   ++   C +   P   + W K+   +   KS+     ++  +G    +   +    G Y C+A N +G + ++F + ++  P I  +   K+++   +   L   C    + N   + +W + N Q I       R+   +  + L I  V  +D+  Y C V N+AGE+  +F   V VPP+I  +   +    ++ ST  L C  +G P P I W       ++E I         N +QL    + +    +YTC A N AGS  +  +  +   PKI      +K  I  D E +      +SC   A P A I W K G+ ++++  V  +  G +L+L   +E+D   Y C+ +N+ G DK+ + V +++ PS    +      V  G    L C ++G P P I W KDG+ I+   R +  D G  L ++ T  +D GRY CIA N+ G  D+   ++V   P +D  G+R   V    G +  L C  +      + W KDG+ IN    R  S+  +I  + K++  ++ + SD+GRY+C+ +N  G+     D  +  PPSI D     N   I     + + C  +GSP+P + +  D   L+     P+  A+Y+    ++   + L +  ++   +G Y C A N +G    ++ VRV  PP F+    E  V      T  L C       P + + W  H   + +G  + + + +   + V N++  D G Y C A NE       F + V   P F   Q    I  +    + + C  TG PPPT+L+ +  + +    E     DI+   S + I N Q +    Y C A N  G  EK   + V++PPK+ K  +   N  V+    +T  C + + +     I W+++      G  D     ++ +S L I+    +++  Y+C A N AG     F +TV +PPK F   FS    T  +   T++   C  EG P P I WF    PI   +M           L I ++  N+EG  + C+A N+ G   +   +E+  P  V +    +R   G   ++ C   G P+PV+ W +DG+       +  ++   L + +    D G YTC  TNK  +   + DV ++ PP+IE  ++ +  + G   ++ C V G     + W   G          E +  +    I +  R D  G Y C+A+N+AG       ++V  +P  F   ET    V     +++CKI +G P+P I+W + G   +      +     L I  + +  D G  TC+A N  G+    F++ V   P +   I  T     G  + + C V G P PTVTWK+   ++ N   +R    +  ++ I  +  ED G Y CI      EA   +T+ +  +  +P FV K      V E    +  C  TS P P I W    + +    + + +  GS IT+   +  + G+Y C A N  G+ +   +L+++  P++ +     +P   + RTI L C + G     ++W KNG+ I    SR+ +  N+    I   +  D G Y C A+N  G+A     L V SPP F +     +    G+ + L C    AE     +  +SW K+ + +  D   ++  +   R + + +   E++G+Y C+A +  GE 
Sbjct: 1306 KNGIDLKMDEKKFSVDNLGT-LRIYEADKNDIGNYNCVVTNEAGTSQMTTHVDVQEPPIILPSTQTNNTAVV---GDRVELKCYVEASPPASVTWFRRGIAIG-TDTKGYVVE--SDGTLVIQSASVEDATIYTCKASNPAGKAEANLQVTVIASPDIKDPDVVTQESIKESHPFSLYCPVFSNPLPQISWYLNDKPLIDDKTSWKTSDDKRKLHVFKAKITDSGVYKCVARNAAGEGSKSFQVEVIVPLNLDESKYKKKVFAKEGEEVTLGCPVSGFPVPQINWV--VDGTVVEP---GKKYKGATLSNDGLTLHFDSVSVKQEGNYHCVAQSK-GNILD-IDVELSVLAVPIVGEDDNLEVFLGKDIS--LSCDLQTESDDKTTFVWSINGSESDRPDNVQIPSDGHRLYITDAKPENNGKYMCRVTNSAGKAERTLTLDVLEPPVFVEPVFEANQKLIGNNPIILQCQVTGNPKPTVIWKIDGNDVDKS----WLFDESLSLLRIEKLTGKSA-QISCTAENKAGTASRDFFIQNIAAPTFKNEGDQETIFRESETITLDCPVSLGDF--QITWMKQGLPLTENDAIFTLDNTR--LTILNANRDHEDIYTCVANNTAGQVSKDFDVVVQVLPKIKNA-VVTLEINEGEEIILTCDAEGNPTPTAKWDFNQG--DLPKEAVFVNNN----HTVVVNNVTKYHTGVYKCYATNKVGQAVKTINVHVRTKPRFESGLTESELTVNLTRSITLECDVDDAIGVGISWTVNGKPFLAETDGVQTLAGGRFLHIVSAKTDDHGS-YACTVTNEAGVATKTFNLFVQVPPTIV---NEGGEYT-VIENNSLVLPCEVTGKPNPVVTWTKDGRPVGDLKSV-----QVLSEGQQFKIVHAEIAHKGSYICMAKNDVGTAEISFDVDIITRPMI--QKGIKNIVTAIKGGALPFKCPIDDDKNFKGQIIWLR-NYQPIDLEAEDARITRLSNDRRLTILNVTENDEGQYSCRVKNDAGENSFDFKATVLVPPTIIMLDKDKNKTAVEHSTVTLSCPATGKPEPDITWFKDGEAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSAGSVEQDVNVNVITIPKI------EKDGIPSDYESQQNERVVISCPVYARPPAKITWLKAGKPLQSDKFVKTSANGQKLYLFKLRETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKGSPSPTITWLKDGNAIEPNDRYVFFDAGRQLQISKTEGSDQGRYTCIATNSVGSDDLENTLEVIIPPVID--GERREAVAVIEGFSSELFCDSNSTGV-DVEWQKDGLTINQDTLRGDSF-IQIPSSGKKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSISDELSSANIQTIVPYYPVEINCVVSGSPHPKVYWLFDDKPLE-----PDS-AAYE----LTNNGETLKIVRSQVEHAGTYTCEAQNNVGKARKDFLVRVTAPPHFEKEREE--VVARVGDTMLLTCNAESSV-PLSSVYWHAHDESVQNGVITSKYAANEKTLNVTNIQLDDEGFYYCTAVNEAGITKKFFKLIVIETPYFLDQQKLYPI--ILGKRLTLDCSATGTPPPTILFMKDGKRLNESDE----VDII--GSTLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPPKLSKEWI---NVEVQAGDPLTLECPIEDTSGVH--ITWSRQFGKD--GQLDMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGGAEAVFQVTVNTPPKIFGDSFS----TTEIVADTTLEIPCRTEGIPPPEISWFLDGKPI--LEMPGVTYKQGDLSLRIDNIKPNQEGR-YTCVAENKAGRAEQDTYVEISEPPRVVMASEVMRVVEGRQTTIRCEVFGNPEPVVNWLKDGEPYTSDLLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQTTTDVEVLVPPRIEDEERVLQGKEGNTYMVHCQVTGRPVPYVTWKRNGK---------EIEQFNPVLHIRNATRADE-GKYSCIASNEAGTAVADFLIDVFTKP-TFETHETTFNIVEGESAKIECKI-DGHPKPTISWLKGGRPFNMDNIILSPRGDTLMILKAQRF-DGGLYTCVATNSYGDSEQDFKVNVYTKPYIDETIDQTPKAVAGGEIILKCPVLGNPTPTVTWKRGDDAVPN--DSRHTIVNNYDLKINSVTTEDAGQYSCIAVN---EAGNLTTHYAAEVIGKPTFVRKGGNLYEVIENDTITMDCGVTSRPLPSISWFRGDKPVYLYDRYSISPDGSHITINKAKLSDGGKYICRASNEAGTSDIDLILKILVPPKIDKSNIIGNPLAIVARTIYLECPISGIPQPDVIWTKNGMDINMTDSRVILAQNNETFGIENVQVTDQGRYTCTATNRGGKASHDFSLDVLSPPEFDIHGTQPTIKREGDTITLTCPIKLAEDIADQVMDVSWTKDSRALDGDLTDNVDISDDGRKLTISQASLENAGLYTCIALNRAGEA 3754          

HSP 7 Score: 642.884 bits (1657), Expect = 0.000e+0
Identity = 637/2549 (24.99%), Postives = 1058/2549 (41.51%), Query Frame = 1
Query: 1837 LKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDE----KEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRC--SATGVPQPKITWEFNGSPV---TIDGN--IIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTN-----IDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYF--INQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIE---YSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCII--TSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSS-ILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIV----GGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAIN-IGESL-NFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGR------VEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIX---XXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDF--RRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPA-----ITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHG-VPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKN--QLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDY-YLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKEGGIFKCIARNEVGSIMKVYKLEVIM-PALVRLDKIEVRERSGTSFSVLCTAEGYP------KPVIKWTRDGKGIFRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKR-TILMCKVEGKVDS--IVWLKNGV-IVQNSSRL-YINDFNLII---NQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPT-ISWYKNKKLIKYDFVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQGEV 9285
            LK  K  + + + K+ +A   KL +    E+D+ +Y C+A +E G  +     K   L A S DE    + I+    +  T  C A  +P PT +W  +G  ++P D  +         Q++IS  +  D G   C A NS G D++   L  I  P I          +EG    + C  ++TGV    + W+ +G  +   T+ G+  I I  +   +      K+  G++ C+  N AG +RK F+  +   P I D +++     I   Y   + I C V G P P+V WL       + P+      +   N   +L I    +E    Y C+AQN  GK ++   +R++   AP     + ++VV       ++ C    S P + + W  + + ++    +++  A + TL +  ++ +DE  Y C A N+ G  K   +L V   P  + D +       G  + L C   G P P I + K G+ L     + I+    GS L + +  +E  G +TC A N      K+  V V  PP++SKE I + E+ + + + L C I  TSG     I W +      ++  R + +  K+ L +     ++  SY C A N+       FQ+T+   PK                L + C+ +G P P   W      IL++     G+T    D + L I  ++   +G YTC   N  G A+    V I E P+++  ++   V      T+ C   GNP P + WL   +   P              L +       GG Y+C+A N+ G+ Q  + V V  P          I     ++    G      C +   P   + W +N  +I +  P            L +      D G Y C+A N  G ++ +F + V   PT     + ++  NI E     I C  +G+P P   W K       GGR      + ++  G TL+I K +R D  +Y C  TN  G+ +++F VNV+  P I+  ++ +TP+ + G    L C V G PTP + W   +      S   + NN  L   +V      +Y+CIA NEAG+    +   +   P  V    +    ++++  + + C   + P+ +I WF+  + +    R +I+  G+ + +  A+ SD G Y C  SN+ G       + I++PP I  ++  G     +   +YL C   G P+P + W K+G  I+    RV+L+ +     + +   TD GRY C A N  G+    F + V   P  D  G +     +  G T+ L C +      A     ++W KD   ++   +    I  + ++L I      +AG Y+C+A N  G+  +   V I +PP ID +R   +  + V     + C   G P P+I + K+G           K+ +  + + + ++ Q+L +       +G + C A N  G   +E  + V TPP     +  P       +T +L C   G  +P  ++ W + G +   S    RIS  G R+ + ++K+ D G+Y C A N         +V+V + P   ++   +  ++ A Q+ T+Q  C   G P P + W      +       P   +   ++ +QI N+   D   Y C A N  G+    + + V+  P I          +V E       C V  Y    P + W +  + +  G     Y+T  +G+ LTI+  +S +SG Y C A N AG     + L V   PK  T        +T   G+  +  C   G P P I W      I   D  N         L I    +   I++C A+N+ G+    + ++ I+ P +       +    GT   + C  E         K  +        IF    K      +++I   +  D G Y+CT  NK    ++  ++ +   PKI    ++ +V  G+QV L C   G     I WY   N  +++T + E     ++ +I   +    +GVY C A N     E  I L V++ P++       +T    TV  + C    GIP+PVI+W R+     +    Y    + L I N L  +D+G   CIAK+ AG+   T ++ V        PI V  DE          +GKPK T             + +R     +N   +     ED+     I  R      ++ T L +   P+F+ KPK             RC A   P P I W  +G+ IE          + +    + ++GEY C+A+N VGS   S  + V       +  +  PS + K   ++ C    +  S  + W  NGV + +N + + ++N+ +L+I   +  K  D  +Y C   N    +   +    +  P    +   +  N G+ ++L C     P+ T + W KN + +  D    ++ N SL ++ V+K   GVY CVAS++ G+ 
Sbjct: 2420 LKAGKPLQSDKFVKT-SANGQKLYLFKLRETDSSKYTCIATNEAGTDKR--DFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKGSPSPTITWLKDGNAIEPNDRYVFFD---AGRQLQISKTEGSDQGRYTCIATNSVGSDDLENTLEVIIPPVIDGERREAVAVIEGFSSELFCDSNSTGV---DVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSISDELSSANIQTIVPYYP--VEINCVVSGSPHPKVYWLFD-----DKPLEPDSAAYELTNNGETLKIVRSQVEHAGTYTCEAQNNVGKARKDFLVRVT---APPHFEKEREEVVARVGDTMLLTCNAESSVPLSSVYWHAHDESVQNGVITSKYAANEKTLNVTNIQLDDEGFYYCTAVNEAGITKKFFKLIVIETPYFL-DQQKLYPIILGKRLTLDCSATGTPPPTILFMKDGKRLNESDEVDII----GSTLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPPKLSKEWI-NVEVQAGDPLTLECPIEDTSG---VHITWSRQFGKDGQLDMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGGAEAVFQVTVNTPPKIFGDSFSTTEIVADTTLEIPCRTEGIPPPEISWFLDGKPILEMP----GVTYKQGDLS-LRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEPPRVVMASEVMRVVEGRQTTIRCEVFGNPEPVVNWLKDGE---PYTSDLLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQTTTDVEVLVP--------PRIEDEERVLQGKEGNTYMVHCQVTGRPVPYVTWKRNGKEIEQFNP-----------VLHIRNATRADEGKYSCIASNEAGTAVADFLIDVFTKPTF---ETHETTFNIVEGESAKIECKIDGHPKPTISWLK-------GGRPFNMDNIILSPRGDTLMILKAQRFDGGLYTCVATNSYGDSEQDFKVNVYTKPYIDE-TIDQTPKAVAGGEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNNYDLKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIGKPTFVRKGGNLYE-VIENDTITMDCGVTSRPLPSISWFRGDKPVYLYDRYSISPDGSHITINKAKLSDGGKYICRASNEAGTSDIDLILKILVPPKIDKSNIIGNPLAIVARTIYLECPISGIPQPDVIWTKNGMDINMTDSRVILAQNNETFGIENVQVTDQGRYTCTATNRGGKASHDFSLDVLSPPEFDIHGTQ--PTIKREGDTITLTCPIKLAEDIADQVMDVSWTKDSRALDGDLTDNVDISDDGRKLTISQASLENAGLYTCIALNRAGEASLEFKVEILSPPVIDISRNDVQPQVAVNQPTIMRCAVTGHPFPSIKWLKNG-----------KEVTDDENIRIVEQGQVLQILRTDSDHAGKWSCVAENDAGVKELEMVLDVFTPPVVSVKSDNPIKAL--GETITLFCNASG--NPYPQLKWAKGGSLIFDSPDGARISLKGARLDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVLVPPEINRDGIDMSPRLPAQQSLTLQ--CLAQGKPVPQMRWTLNGTAL---THSTPGITVASDSTFIQINNVSLSDKGVYTCYAENVAGSDNLMYNVDVVQAPVISNGG----TKQVIEGELAVIECLVEGY--PAPQVSWLRNGNRVETGVQGVRYVT--DGRMLTIIEARSLDSGIYLCSATNEAGSAQQAYTLEVLVSPKIITSTP---GVLTPSSGSKFSLPCAVRGYPDPIISWTLNGNDIK--DGENGHTIGADGTLHIEKAEERHLIYECTAKNDAGADTLEFPVQTIVAPKISTSGNRYINGSEGTETVIKCEIESESSEFSWSKNGVPLLPSNNLIFSEDYK------LIKILSTRLSDQGEYSCTAANKAGNATQKTNLNVGVAPKIMERPRTQVVHKGDQVTLWCEASGVPQPAITWYK-DNELLTNTGVDETATTKKKSVIFSSISPSQAGVYTCKAENWVASTEEDIDLIVMIPPEVVPERMNVSTNPRQTVF-LSCNAT-GIPEPVISWMRDSNIAIQNNEKYQILGTTLAIRNVLP-DDDGFYHCIAKSDAGQKIATRKLIVNKPSDRPAPIWVECDE----------KGKPKKT-----------EYMIDRGDTPDDNPQLLPWKDVEDSSLNGSIAYRCMPGPRSSRTVL-LHAAPQFIVKPK-NTTAAIGAIVELRCSAAGPPHPTITWAKDGKLIEDSKFEIAYSHLKVTLNSTSDSGEYTCMAQNSVGSSTVSAFINV----DNNILPTPKPSSNQKNVAVITCYERNQAYSRGLTWEYNGVPMPKNLAGIHFMNNGSLVILDTSSLKEGDLELYTCKVRNRRRHSIPHLTSAFEGVPEVKTI-DKVEVNNGDSVVLDCEVTSDPLTTHVVWTKNDQKMLDDDAIYVLPNNSLVLLNVEKYDEGVYKCVASNSIGKA 4828          

HSP 8 Score: 591.652 bits (1524), Expect = 9.090e-169
Identity = 610/2452 (24.88%), Postives = 1045/2452 (42.62%), Query Frame = 1
Query: 1900 KLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKE-ISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKIS--NVKPQDSGELICKAKNSAGIDEVRIKLSY-ISLPKILSLDLAKE--------IPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNII-INETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPP-PRVKWLRGIAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEW-RKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKA-SDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFID---NTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFA-PYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAIN-IGES-LNFTLVVLISPTI--LGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSI--NGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXXXXXXXXXQLHFMNVDKSHIT----------RYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDG-ELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFC---VSEGRPKP--KIEWRKDGSRID---FRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLS-SGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKE--RYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGR-YTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVN-KEGGIFKCIARNEVGSIMKVYKLEV-IMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRYG---TKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPK-VSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKP--KLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKL---NSNGRGSITLQSVRSENAGE---YKCIAKNR----VGSVEYSF--MLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGK--VDSIVWLKNGVIVQNSSRLYINDFN-LIINQAKSKDTGIYQCIASNSAGEAQGQVHLLV 9039
            +L I     SD G Y C+A +  G  +    ++    P    + +E ++ I+  S    C + ST      W  +G  ++    R      +  S  K+S  + +  DSG   C  +N AG  E R    + ++ P  +S +L+           P+E     + C  +G P PK+ W F+  P+  D     +     TL I R +    G + C A N+ G +RK F + +   P  +     +    G+ + + C  E   P   V W        N  I    +Y  N+  +L +  + ++D+  Y C A N+ G  ++  ++ +  I  P     Q    ++    K++ +       PP  I ++K+GK +  S+ +    +TLVI   + E E  YTCIA+N+ G ++ D+ ++V   P +  ++   ++ + GD + L+C  +      I W R+ G+   ++  +R   S D S+L +   T E A +++C A ND       F+V+V  PP+I  +  S  EI +   +E+ C  T G P P+I W+ +G+P++E+PG     G  + L++     ++ G Y C A N+     +   + I   P+    S+++++   EG + T+ C++ G P P   W     + D +     +       + L + +      G YTC  TN  G ++ + DV +L  P+I    D+  V      NT  + C  +G P P + W    K I           +    L +  A     G+YSC+A NE G    + ++ VF  P  +        T+N I+ G +    C ++  P   I W K      +    D   +S  G TL + + +  D G+Y C+A N  G+S  +F + V   P I      + K+V       ++ + C   GNP P   W + +  + +  R  I N    L I  V   D   Y C   NEAG    ++   V   P+    G ++ E    ++  T  + C V+  P P I W   +              + ++ D SHIT          +Y C A+NEAG++       +  PPKI   +       +    + L C     P   + W K+G ++   + RV +        + N Q +D G Y C  +N+ G     +++D++ PP    +      +   G  + L C   ++E        + W KD   +D      V +SDDG  LT++     +AG Y CIA N  G+  + F V++   P +D   +   + +  V    ++ C V+G P P+I WLK+G  +        RI+   + L+I+   +  AG++SCVA+N  G  E+ M + +  PP +      +  I  +G+ + L C A+G+P P + + K G SL +FD SP+          +S +   L +   K+TD G Y C A NA G      SV V  PPE +   ++        Q+ +L+C   G   P  ++ W  +G  L+ S   I ++ D T I + NV   D G Y C+A+N     +L++NV+V   P        TK + ++     + C   GYP P + W R    +    +  RY     +    ++ I   +  D+  Y C+ATN  G+ ++ + + V++ PKI+  +  P         + +  C+V  Y    P+I WT   + I  G+  + +    G   T+   K++E    Y C AKN AG D+  F +     PK  T  + +   I    GT    +C  E   +    W    +P+ P +  N + S + K++ I S    + G + C A N+ G+  +   L V + P ++   + +V  + G   ++ C A G P+P I W +D + +   G   T T  +  ++  +       G YTC   N ++   + +D++++ PP++   + ++     + V L C   G     I W    N  I +    +YQ L    L I  V  D  G Y C+A +DAG Q+I  T +++V     RP            + ++C   +G P+        G           T D    +     +ED      IA       R +  + +   P+ +  P + T   G+ V + C   G P PT+TW KDG+ +++   ++F   + + + +      D+G Y C+ + S   +ST S ++++        KP    KNV   T ++  R +A S     + W +NG  +   L   +    GS+ +    S   G+   Y C  +NR    +  +  +F  + EV    +V V   D         +L C+V        +VW KN   + +   +Y+   N L++   +  D G+Y+C+ASNS G+A     L V
Sbjct: 2533 QLQISKTEGSDQGRYTCIATNSVGSDDLENTLEVIIPPVIDGERREAVAVIEGFSSELFCDSNSTGV-DVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCIVRNPAG--EARKLFDFAVNDPPSISDELSSANIQTIVPYYPVE-----INCVVSGSPHPKVYWLFDDKPLEPDSAAYELTNNGETLKIVRSQVEHAGTYTCEAQNNVGKARKDFLVRVTAPPHFEKEREEVVARVGDTMLLTCNAESSVPLSSVYWHAHDESVQNGVIT--SKYAANE-KTLNVTNIQLDDEGFYYCTAVNEAGITKKFFKLIV--IETPYFLDQQKLYPIILG--KRLTLDCSATGTPPPTILFMKDGKRLNESDEVDIIGSTLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPPKLSKEWIN-VEVQAGDPLTLECPIEDTSGVHITWSRQFGKDGQLD--MRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGGAEAVFQVTVNTPPKIFGDSFSTTEIVADTTLEIPCR-TEGIPPPEISWFLDGKPILEMPGVTYKQGDLS-LRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEPPRVVMASEVMRVV--EGRQTTIRCEVFGNPEPVVNW-----LKDGEPYTSDLLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQTTTDVEVLVPPRI---EDEERVLQGKEGNTYMVHCQVTGRPVPYVTWKRNGKEIE----------QFNPVLHIRNATRADEGKYSCIASNEAGTAVADFLIDVFTKPTFE----THETTFN-IVEGESAKIECKIDGHPKPTISWLKGG----RPFNMDNIILSPRGDTLMILKAQRFDGGLYTCVATNSYGDSEQDFKVNVYTKPYIDETIDQTPKAVAG----GEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNN-YDLKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIGKPTFVRKGGNLYE---VIENDTITMDCGVTSRPLPSISWFRGD------KPVYLYDRYSISPDGSHITINKAKLSDGGKYICRASNEAGTSDIDLILKILVPPKIDKSNIIGNPLAIVARTIYLECPISGIPQPDVIWTKNGMDINMTDSRVILAQNNETFGIENVQVTDQGRYTCTATNRGGKASHDFSLDVLSPPEFDIHGTQPTIKRE-GDTITLTCPIKLAEDIADQVMDVSWTKDSRALDGDLTDNVDISDDGRKLTISQASLENAGLYTCIALNRAGEASLEFKVEILSPPVIDIS-RNDVQPQVAVNQPTIMRCAVTGHPFPSIKWLKNGKEVTD--DENIRIVEQGQVLQILRTDSDHAGKWSCVAENDAGVKELEMVLDVFTPPVVSVKS--DNPIKALGETITLFCNASGNPYPQLKWAK-GGSL-IFD-SPDG-------ARISLKGARLDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVLVPPEINRDGIDMSPRLPAQQSLTLQCLAQG--KPVPQMRWTLNGTALTHSTPGITVASDSTFIQINNVSLSDKGVYTCYAENVAGSDNLMYNVDVVQAPVISNGG--TK-QVIEGELAVIECLVEGYPAPQVSWLRNGNRVETGVQGVRY-----VTDGRMLTIIEARSLDSGIYLCSATNEAGSAQQAYTLEVLVSPKIITST--PGVLTPSSGSKFSLPCAVRGY--PDPIISWTLNGNDIKDGENGHTI----GADGTLHIEKAEERHLIYECTAKNDAGADTLEFPVQTIVAPKISTSGNRY---INGSEGTETVIKCEIESESS-EFSWSKNGVPLLPSN--NLIFSEDYKLIKILSTRLSDQGEYSCTAANKAGNATQKTNLNVGVAPKIMERPRTQVVHK-GDQVTLWCEASGVPQPAITWYKDNELLTNTGVDETATTKKKSVI-FSSISPSQAGVYTCKAENWVASTEEDIDLIVMIPPEVVPERMNVSTNPRQTVFLSCNATGIPEPVISWMRDSNIAIQNN--EKYQILGTT-LAIRNVLPDDDGFYHCIAKSDAG-QKIA-TRKLIVNKPSDRPAP----------IWVECD-EKGKPKKTEYMIDRG----------DTPDDNPQLLPWKDVEDSSLNGSIAYRCMPGPRSSRTVLLHAAPQFIVKPKNTTAAIGAIVELRCSAAGPPHPTITWAKDGKLIED---SKFEI-AYSHLKVTLNSTSDSGEYTCMAQNS-VGSSTVSAFINVDNNILPTPKPSSNQKNVAVITCYE--RNQAYSR---GLTWEYNGVPMPKNLAGIHFMNNGSLVILDTSSLKEGDLELYTCKVRNRRRHSIPHLTSAFEGVPEVKTIDKVEVNNGD-------SVVLDCEVTSDPLTTHVVWTKNDQKMLDDDAIYVLPNNSLVLLNVEKYDEGVYKCVASNSIGKAFDDTQLNV 4836          

HSP 9 Score: 562.762 bits (1449), Expect = 4.895e-160
Identity = 573/2397 (23.90%), Postives = 983/2397 (41.01%), Query Frame = 1
Query: 1735 ASIEPFKDAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFIDNDSITA------SCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSA-TGVPQPKITWEFNGSPV---TIDGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDN-------SLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKN-GKEIEYSNRIMAKDNT--LVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFA-PYIDMKTPNKNITYNP-IIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAINIGESL--NFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTY--ME---TIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPK--IVSLDPDKKRWILKDGELRLSC-----NSDAAPVATIEWFKDGELIRNNL--RVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRI-DFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSG-GSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPIL-----IGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFR-ETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVN-KEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNG--ITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISVTGDEGSSVTIICKVEGKPKPT--VTWKKDGQSL-QNVLGNRFRFNSENEI-NIYDLKPEDTGNYIC-IGERSGAEASTASTYLSIFTRPKFVYKPKLKN---VVQETRWKSFRCEATSHP-KPDIKWMFNGRAI--ESKLNSNGRGSITLQSVRSENAGEYKCIAKNRVG 8745
            A IE F  +EL C+  S S+ V ++W K        N    R + + + P++   K+  LSA +SD+G Y C+  +  G +  +     +  P+ S    E+S  +  +I        +C    +P P   W  + + L+P      + N+ +   +KI   + + +G   C+A+N+ G    +  L  ++ P     +  + +   GD   + C+A + VP   + W  +   V    I      NE   TL++  I+ + +G + C A N AG ++K F L +   P   D         G+ +T+ C   G PPP + +++             D   +N+ +       +L+I     E +  Y C A+N+ G+ ++ + + +  +  PK++  +   V V++     + C  +E      I+W +  GK+ +   R  +  +   L I     ED   Y+CIA N  G A+   ++ V T P I GD  +  +      + + C+T+G P P+I W   G+P+   PG  +        L + +I     G +TC A N      ++  V +  PP++         +       + C +  GNP P + W K+G+P       ++ + + + L +      + G+Y C ATN+         + +LV P+  D + + +  KEG    ++C++ G P P   W      ++ Q NP            L I       +G Y+C  +N  G+A   + + +   P          +    +  + C   G+P P I WL   +   P  +   ++    +TL++ +A    GG Y+C+A N  G  +++  V V+  PYID     + I   P  + GG I   C +   P   + W + +     ++P D     ++   L +  V   D+G Y C+A+N   +L  ++   V+  PT + K    ++  + E   + + C     P P   W++ +  +    R  I+  G  + I K + SD   Y C  +NEAG    +  + + VPP I+  ++   P  +   T  L C +SG P P + WT   M+   T +  +L  NN      NV  +   RYTC ATN  G A   F   +  PP+  I    P  KR   +   + L+C        A  V  + W KD   +  +L   V+I++ G +L +  A   + G+Y C+  N+ G     + V+I+ PP I  +      QVA+     + C   G P P I+W K+G  + D   + + + G  L +  T    AG++ C+AEN  G  ++   + V   P +        K    +G T+ L C  SG P P + W K G  I   P    RI     +L+I  ++ +D G Y+C A N  G  E  + V +  PP I+R+ I     +     L L C A G P P + +  +G +L                + V+ +   + + +   +D G+Y C A N  G D + Y+V V   P       +  +     +   +EC + G   P  +++W R+G  + +G   +R   DG  +T+   +  D+G Y C A NE       + +EV + P+   +     +     +   + C   GYP P + W     +I   +  +     +  +  + I   + +    Y CTA N  G    +F +  I+ PKI   + G       E  +    C + + +        +K   P+L     I   DY L       + IL+ +  + G Y+C A N AG  +    L V   PK      + R  T  V  G  V   C A G P P+I W YKD  +     ++   +   K +   S++  + G++ C A N V S  +   L V++P  V  +++ V      +  + C A G P+PVI W RD     +   K       L I +   +D G Y C   +   Q   +  +++  P    +P           + + C  +G      +    G+    +  L  ++ + +  L       + S  YRC+     G +  R  L       I +P    TT  +  +++++C    G P P ITW ++G  I  SK +  Y+     L   NS    D G  TC+A+N  G   ++  I V+      LP         +V +I   E     +  +TW+ +G  + +N+ G  F  N    I +   LK  D   Y C +  R        ++        K + K ++ N   VV         CE TS P    + W  N + +  +  +      S+ L +V   + G YKC+A N +G
Sbjct: 2581 AVIEGFS-SELFCD--SNSTGVDVEWQKDGLTI---NQDTLRGDSFIQIPSS-GKKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSIS---DELSSANIQTIVPYYPVEINCVVSGSPHPKVYWLFDDKPLEPDSAAYELTNNGE--TLKIVRSQVEHAGTYTCEAQNNVG-KARKDFLVRVTAPPHFEKEREEVVARVGDTMLLTCNAESSVPLSSVYWHAHDESVQNGVITSKYAANEK--TLNVTNIQLDDEGFYYCTAVNEAGITKKFFKLIVIETPYFLDQQKLYPIILGKRLTLDCSATGTPPPTILFMK-------------DGKRLNESDEVDIIGSTLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEV--LLPPKLS-KEWINVEVQAGDPLTLEC-PIEDTSGVHITWSRQFGKDGQLDMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGGAEAVFQVTVNTPPKIFGDSFSTTEIVADTTLEIPCRTEGIPPPEISWFLDGKPILEMPG--VTYKQGDLSLRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEPPRVVMAS-EVMRVVEGRQTTIRCEVF-GNPEPVVNWLKDGEPYTS--DLLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQTTTDVEVLVPPRIEDEERV-LQGKEGNTYMVHCQVTGRPVPYVTWKRNGKEIE-QFNPV-----------LHIRNATRADEGKYSCIASNEAGTAVADFLIDVFTKPTFETHETTFNIVEGESAKIECKIDGHPKPTISWLKGGR---PFNMDNIILSPRGDTLMILKAQRFDGGLYTCVATNSYGDSEQDFKVNVYTKPYID-----ETIDQTPKAVAGGEIILKCPVLGNPTPTVTWKRGD----DAVPNDSRHTIVNNYDLKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIGKPTFVRK--GGNLYEVIENDTITMDCGVTSRPLPSISWFRGDKPVYLYDRYSISPDGSHITINKAKLSDGGKYICRASNEAGTSDIDLILKILVPPKIDKSNIIGNPLAIVARTIYLECPISGIPQPDVIWTKNGMDINMTDSRVILAQNNETFGIENVQVTDQGRYTCTATNRGGKASHDFSLDVLSPPEFDIHGTQPTIKR---EGDTITLTCPIKLAEDIADQVMDVSWTKDSRALDGDLTDNVDISDDGRKLTISQASLENAGLYTCIALNRAGEASLEFKVEILSPPVIDISRNDVQPQVAVNQPTIMRCAVTGHPFPSIKWLKNGKEVTDDENIRIVEQGQVLQILRTDSDHAGKWSCVAENDAGVKELEMVLDVFTPPVVSVKSDNPIKA---LGETITLFCNASGNPYPQLKWAKGGSLIFDSPD-GARISLKGARLDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVLVPPEINRDGIDMSPRLPAQQSLTLQCLAQGKPVPQMRWTLNGTAL----------THSTPGITVASDSTFIQINNVSLSDKGVYTCYAENVAGSDNLMYNVDVVQAPVISNGGTKQVIE---GELAVIECLVEGY--PAPQVSWLRNGNRVETGVQGVRYVTDGRMLTIIEARSLDSGIYLCSATNEAGSAQQAYTLEVLVSPKIITSTPGV-LTPSSGSKFSLPCAVRGYPDPIISWTLNGNDIKDGENGH----TIGADGTLHIEKAE-ERHLIYECTAKNDAGADTLEFPVQTIVAPKI--STSGNRYINGSEGTETVIKCEIESESSEFSW---SKNGVPLLPSNNLIFSEDYKL-------IKILSTRLSDQGEYSCTAANKAGNATQKTNLNVGVAPKI-----MERPRTQVVHKGDQVTLWCEASGVPQPAITW-YKDNELLTNTGVDETATTKKKSVIFSSISPSQAGVYTCKAENWVASTEEDIDLIVMIPPEVVPERMNVSTNPRQTVFLSCNATGIPEPVISWMRDSNIAIQNNEKYQILGTTLAIRNVLPDDDGFYHCIAKSDAGQKIATRKLIVNKPSDRPAP-----------IWVECDEKGKPKKTEYMIDRGDTPDDNPQLLPWKDVEDSSL-------NGSIAYRCM----PGPRSSRTVLLHAAPQFIVKP--KNTTAAIGAIVELRCS-AAGPPHPTITWAKDGKLIEDSKFEIAYSHLKVTL---NS--TSDSGEYTCMAQNSVGSSTVSAFINVD---NNILPTPKPSSNQKNVAVITCYERNQAYSRGLTWEYNGVPMPKNLAGIHFMNNGSLVILDTSSLKEGDLELYTCKVRNRRRHSIPHLTSAFEGVPEVKTIDKVEVNNGDSVV-------LDCEVTSDPLTTHVVWTKNDQKMLDDDAIYVLPNNSLVLLNVEKYDEGVYKCVASNSIG 4826          

HSP 10 Score: 256.529 bits (654), Expect = 2.754e-67
Identity = 276/1092 (25.27%), Postives = 455/1092 (41.67%), Query Frame = 1
Query: 6199 ASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMS------CECTGYPPPTLLWYRQEQEIL--ADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDY-YLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPA-EGSPTPSIMWFY--KDMPISPYDMMNFVISNNAKVLTIPSVNKEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRYGTKTDSR-----TGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVI---ISPPKIESPKKSIMVRVGEQVLLPCIVE-GTRPFRIHWYT---PGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPK---------IFRPT----ETETTGVLNTV--------LQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPIS----VTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLNSNG---RGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILM--CKVEGKVDSI-VWLKNGVIVQNSSRLYIND--FNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPG---NISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIK-NGSLRIIGVQKEHSGVYFCVASSNQGEVHS 9291
            A  AIG      SV V  P  F    + P    F  +  +L CT+   +     I W + G  +  G     + D +  T+  +   DAGEY+C   +     S+   VE    P         +I  V+N +V +       C         + W R    +    + ER P       N  ++I ++   DA  Y C A N GG   +K  + ++ PP +    + P++  V  NM+   + S       KP + W  +   +L    DY Y    + + L I +    + G Y C A + AGQ   T  L + +PPK      I +  + V  G  V+F+C    G P P I WF   KD+ I P D   ++  N  ++  + + +++ G + C+  N  G  ++V  L V     +      VR       ++ C A G P P I+W    KG     T  + R      G L ITDA+ ED G++TC   N   Q S+S  +++   +SP     P +  ++  G+ + L C+V  GT    I W     P     +  I G    L  +G           G Y C+A + AG   + I ++++ +P+         +F+PT    + +   V+N+           + C ++ G P P+ITW  +G  ++     +T T     I         G  TC A N AG++     I +   P +S   S    V  D     TI C V G PKP +TW  D +     +      N +  + I ++     G + C  + + A   T +  L++ T P    + + K  +Q        C A + P P   W + G  I+S+L  +     G++ LQ+V+ EN G + C   N  G    S+ L V  KP++ + +     + +K   +   C+  G  + I  W KNG+ ++   + +  D    L I +A   D G Y C+ +N AG +Q   H+ V+ PP+  +LP    N +A +G+ + L C  E  P  +++W++    I  D    +++ +G+L I     E + +Y C AS+  G+  +
Sbjct:  418 APTAIG------SVIVGGPRAF----MSPIHQEFVGRDLNLSCTVESAS--AYTIYWVKTGEDIIGGPLFYHNTDTSVWTIPELSLKDAGEYECRVISNNGNYSVKTRVETRESP--------PEIFGVRNVSVPLGEAAFLHCSTRSAGEVEIRWTRYGATVFNGPNTERNPT------NGTLKIHHVTRADAGVYECMARNAGGMSTRKMRLDIMEPPSV---KVTPQD--VYFNMREGVNLSCEAMGDPKPEVHWYFKGRHLL---NDYKYQVGQDSKFLYIRDATHHDEGTYECRAMSQAGQARDTTDLMLATPPKV----EIIQNKMMVGRGDRVSFECKTIRGKPHPKIRWFKNGKDL-IKPDD---YIKINEGQLHIMGAKDEDAGAYSCVGENMAGKDVQVANLSVGRVPTIIESPHTVRVNIERQVTLQCLAVGIPPPEIEWQ---KGNVLLATLNNPRYTQLADGNLLITDAQIEDQGQFTCIARNTYGQQSQSTTLMVTGLVSPVLGHVPPEEQLIE-GQDLTLSCVVVLGTPKPSIVWIKDDKPVEEGPTIKIEGGGSLLRLRG-----GNPKDEGKYTCIAVSPAGNSTLHINVQLIKKPEFVYKPEGGIVFKPTISGMDEKHVAVVNSTHDVLDGEGFAIPC-VVSGTPPPIITWYLDGRPITPNSRDFTVTADNTLIVRKADKSYSGVYTCQATNSAGDNEQKTTIRIMNTPMISPGQSSFNMVVDD---LFTIPCDVYGDPKPVITWLLDDKPFTEGV-----VNEDGSLTIPNVNEAHRGTFTCHAQNA-AGNDTRTVTLTVHTTPTINAENQEKIALQNDDI-VLECPAKALPPPVRLWTYEGEKIDSQLIPHTIREDGALVLQNVKLENTGVFVCQVSNLAGEDSLSYTLTVHEKPKI-ISEVPGVVDVVKGFTIEIPCRATGVPEVIRTWNKNGIDLKMDEKKFSVDNLGTLRIYEADKNDIGNYNCVVTNEAGTSQMTTHVDVQEPPI--ILPSTQTNNTAVVGDRVELKCYVEASPPASVTWFRRGIAIGTDTKGYVVESDGTLVIQSASVEDATIYTCKASNPAGKAEA 1444          

HSP 11 Score: 217.238 bits (552), Expect = 2.083e-55
Identity = 239/995 (24.02%), Postives = 421/995 (42.31%), Query Frame = 1
Query: 1897 SKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEIS--FIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIINETIG-TLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDG----SYGENITIRCQVEGQPPPRVKW-LRG--IAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRIMAKDNTLVIK--TVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNA--VGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCV-MNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAINIGESLNFTLVVLISPTILGKHSSKSV--ININEETDLYITCWSEGNPAPRYL-WYKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVF 4827
            ++L I    ++D G+Y C A +  G SEA   +     P  + D  ++S       S+T  C A   P P   W LNG  L  + P I++ +D   + I+I+NV   D G   C A+N AG D +   +  +  P ++S    K++ +EG+   + C   G P P+++W  NG+ V      +   T G  L I        G ++C ATN AGS+++++ L++   P+I   +T+  G    S G   ++ C V G P P + W L G  I  G N        + I  D +L I+  + E    Y C A+N  G   ++++  +  I APKI+ + ++ +      + VI C +      +  SW KNG  +  SN ++  ++  +IK  + +  D+  Y+C A N+ G A     L+V   P I+   +T +  K GD + L C+  G P+P I W K    LT   G+    +     +   SI+   AG +TC A N  A+  ++  + V  PP++  E + +     ++ V L+C  T G P P I W ++    ++   + +I G    L +     D+ G Y C A ++     +      L+  K SD             + + C   G P  T+       ++D    P        D N  L+     E   +            + S  V++  +P+ I     +   I   + L C A+G P P I W    KLI  +   + Y         L V   ++   GEY+C+A+N  G    ++ + V    +    P+ N     +I       +C   N      + W  N + + K+L    F   ++  +L + +   L  G  +     +      ++  L S    G    K++  + +N    + + C    +P   ++ W K++ +++    + +     +L++  V + D+ VY+C  +N  G+   +  +NV+
Sbjct: 3913 ARLDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVLVPPEINRDGIDMSPRLPAQQSLTLQCLAQGKPVPQMRWTLNGTALTHSTPGITVASD--STFIQINNVSLSDKGVYTCYAENVAGSDNLMYNVDVVQAP-VISNGGTKQV-IEGELAVIECLVEGYPAPQVSWLRNGNRVETGVQGVRYVTDGRMLTIIEARSLDSGIYLCSATNEAGSAQQAYTLEVLVSPKI---ITSTPGVLTPSSGSKFSLPCAVRGYPDPIISWTLNGNDIKDGEN-------GHTIGADGTLHIEK-AEERHLIYECTAKNDAGA--DTLEFPVQTIVAPKISTSGNRYINGSEGTETVIKCEIESES--SEFSWSKNGVPLLPSNNLIFSEDYKLIKILSTRLSDQGEYSCTAANKAGNATQKTNLNVGVAPKIMERPRTQVVHK-GDQVTLWCEASGVPQPAITWYKDNELLT-NTGVDETATTKKKSVIFSSISPSQAGVYTCKAENWVASTEEDIDLIVMIPPEVVPERM-NVSTNPRQTVFLSCNAT-GIPEPVISWMRDSNIAIQNNEKYQILG--TTLAIRNVLPDDDGFYHCIAKSDAG---QKIATRKLIVNKPSDRPA---------PIWVECDEKGKPKKTEY------MIDRGDTP--------DDNPQLLPWKDVEDSSLNGSIAYRCMPGPRSSRTVLLHAAPQFIVKPKNTTAAIGAIVELRCSAAGPPHPTITWAKDGKLIEDSKFEIAYSH-------LKVTLNSTSDSGEYTCMAQNSVGSSTVSAFINVDNNILPTPKPSSNQKNVAVI-------TCYERNQAYSRGLTWEYNGVPMPKNLAGIHF---MNNGSLVILDTSSLKEGDLELYTCKVRNRRRHSIPHLTS-AFEGVPEVKTIDKVEVNNGDSVVLDCEVTSDPLTTHVVWTKNDQKMLDDDAIYVL-PNNSLVLLNVEKYDEGVYKCVASNSIGKAFDDTQLNVY 4837          

HSP 12 Score: 59.3066 bits (142), Expect = 8.816e-8
Identity = 36/96 (37.50%), Postives = 46/96 (47.92%), Query Frame = 1
Query: 11851 CKTGFTWTSD-RGCIDIDECTSYTNPHSCQHQCINTYGSYHCLCPQGFSLNPKTMKCLDVDECRTNLGICSEKKLCINTPGNYSCIEPKCPKSYHF 12135
            C  GF      R C D+DEC  Y     C  +CIN  G + C CP G+ L  +   C DV+EC +    C + K C N  G Y CI+  CP +Y  
Sbjct: 4981 CPEGFAMNPHTRICEDLDECAFY---QPCDFECINYDGGFQCNCPLGYELAEE--GCRDVNECESVR--CEDGKACFNQLGGYECIDDPCPANYSL 5069          

HSP 13 Score: 55.8398 bits (133), Expect = 1.201e-6
Identity = 34/85 (40.00%), Postives = 44/85 (51.76%), Query Frame = 1
Query: 11032 CPPGFTLIKSQRFCEDVNECKNAKFHKCDQICENTVPRFKCNCRSGFMLSSDGKSCQDINECSKNISPCSEPNHECINTPGSYMC 11286
            CP GF +    R CED++EC  A +  CD  C N    F+CNC  G+ L+ +G  C+D+NEC    S   E    C N  G Y C
Sbjct: 4981 CPEGFAMNPHTRICEDLDEC--AFYQPCDFECINYDGGFQCNCPLGYELAEEG--CRDVNECE---SVRCEDGKACFNQLGGYEC 5058          
BLAST of Hemicentin-1 vs. Ensembl Celegans
Match: unc-89 (Muscle M-line assembly protein unc-89 [Source:UniProtKB/Swiss-Prot;Acc:O01761])

HSP 1 Score: 434.106 bits (1115), Expect = 6.239e-121
Identity = 647/2792 (23.17%), Postives = 1089/2792 (39.00%), Query Frame = 1
Query: 1729 KNASIEPFKDAELECNVFSTSSNVVLKWFKS-IPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIK-THTLPAAS-VDEKEISFID-NDSITASCRALSTPPPTFSWFLNGRELDPTDPR--ISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEI-PLEGDQQ---TVRCSATGVPQPKITWEFNGSPVTIDGNIIINETIG----TLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDI---GFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQD-----NSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRI-SGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRIMAK------DNTLVIKTVKAEDEAIYTCIAKNQVGTAK-----------FDIELDVQTKPIIIGDFK-TFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGS-QLTVYSITEEHAGTFTCTATN--DHAAVVKEFKV--SVKAPPQISKEG-----ISDYEI-------------GSKENVEL--NCIITS-----------GNPSPKIEWYKNGQPLVEIPGRVEIAGQKN---ILKVYGKNEDETGSYECKATNEVSS--DSRFFQITILVAPK----ASD--SKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQ--FNDKSVVFIDNTIT--LTCIASGNPTPKIKWLFKK--KLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAINIGESLNFTLVVLIS--------PTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRW----TYMETIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSAR-------KLFDPVL-TYPPKIVS-LDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRID-FRRVLLSDDGY---HLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVE-RTVGGTVVLECLVSGIPTPAITWLKDG--IPINRLPSYRYRIIGNSKQ-LEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQE---RQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTL---MGVADPPAKITWERHGVPLSSGGSI---RISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQ----SLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTV----TSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVIS-NNAKVLTIPSVNKEG-GIFKCIARNEVGSIMKVYKLEVI----MPA----LVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRYGTKTDSRTGI---------LEITDAKEEDTGRYTCTGTNK-------------ISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHS--GVYRCVANNDAGYQEIRITLEVLV------------QPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITL---SKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLP------------ISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENE----INIYDLKPEDTGNYICIGERSGAEASTASTY-------------LSIFTRPKFVYK-----PKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAI--ESKLNSNGRGSITLQSVRSENA-----GEYKCIAKNRVGSVEY-----------SFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGK-VDSIVWLKNGVIVQNSSRLYIN-----DFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFT---------LLPGNISANLGEVL-----------ILPCAAEGYPIPTISWYKNKKLI----KYDFVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQGEVHS 9291
            K  S++  ++ ++E  V  ++ +V  +WFK   P  E  N         KK+P      L++  A+ +D G+Y   A +  G +E+    + T +L   + V E   + +  N++ T S      P P+  W  +G+ +  TD    I+ V       I I + + +DSG+  C+A N AG  E + + ++  +  ++  +  +++ PLE  ++   T+     G P+P + W  + +P++ID   +I +       +L IN   +   G + C A N AG +  + N  I      P     +  ++    E + ++  V G P P V+W +      + PI + + +   +D     ++L IK    ED   Y C A N+ G+ + +  + +   I AP   F Q  +       K   + + VE KP   + W K+G  I   N+ + +       +TLVIK     D   YTC A N+ G  +           F+ +   + KP+ I   K TF  A +GD +VL+C+   +  P+I++ K  +P+ +   +++ +  DG+ +LT+ +  +E  G + C A N    A    + K+  + K    ++ E      I  +E              G+ E VEL  +C +T            G P PKI+W K G+  VE+  RV    + +    L      + + G Y C+A NE  S        +T+  APK    A D    +       GE   L  KI G P P+ KW +K+       +   I N       L +T  + +    Y C+ +N  G       + + E  ++    F + S + +  T T    C  SG   P +KW FK    L     V ++   +  + L++E + +   G Y     N+ G       +TV  P   +K   K +T   +  G  I  S  +   P   +KW+K    +  S      +++     L +   +  D+G Y+ +      S+  +  V ++        P+     + +SV    + T L +    EG P     WYK+  ++  G   ++ NG   L I   +  D   Y     NEAGE +    VNV   P I  +S        +G T      V G P   ++W      +    +      +  L   N        Y  + +N+AG A        KL D       P+IVS L P      +K GE          PV  ++W+K+G+ I N    +  +    L + NAQ  D   YK +VSN  G    +  + + + P I         +V  G    L   +  +PK +I+W K+G  I    +     DG     L +    + DA  Y+ +  +  G T  S        P  +P   +  + +  ++G  + LE   SG P   + W K+G  +P     + + + I ++K  LEI +    D G Y     N  G       +T+   P I   + L +  I  G+        N  P   + ++K+G      ++ PN       R ++ Q+   +  L + +A R D+  Y+    N  G       + V+       + +   V    +Q  +    +   + +   P  + W R    +S+G +    +I     R+ + +    DAGEY     NE  K       EV  KP   +     +I    +   ++       P   + WY+ +QEI  +     K  I      + I   Q DD   Y    +N  G  +    ++V + P ++K   G ++  V+E   +     V        VI W K N   L  D D +      +    SLTI + K  + G Y     N  G+     V+ V    +S P    +F    +   V+ G  +  QC   G P P ++W    + +   D +   ++ +    L I S  K   G ++  A+NE GS     K+ V      P+    ++ L            F+V     G PKP ++W  +G  I     K D R  +         L I D +EED G   C   N+                D  S D +   PP+   P     + VG+ + + C V+      + W+  G  +I  T   E +   +    I  +  + S  GVY CVA N+ G  E + T +V +             PKI  P E +T       +++ CK+ + IP+  + W ++G+ L   S+    Y    +     N    ED G+  C+A N  G    +  + V+ +PK  +             + +  D G S T+ C V G P P + W ++GQ L+N  G R    +  +    + + +    D G Y C  E +  +A T +T              +     PKF+ +       L NV+         C+ T  P P +KW  +G  +  +S+   +   S  +  +R +NA     G Y+C+A N  GS              S ++     PR  +   D  +   +   L CKV+   +  +VW K+G IV  S R+ I+        L+I      D GIY+ IA+N +G AQ +    VK  P  +         +   N +  L E L            L C   G P PTI W+K+ + +    +   ++S      L +    ++ +G Y CVA +  G   +
Sbjct: 2623 KKTSVKEKEEIKMEVKVGGSAPDV--EWFKDDKPVSEDGN------HEMKKNPETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEAEVTQSLEKPTFVRELVTTEVKINETATLSVTVKGVPDPSVEWLKDGQPVQ-TDSSHVIAKVEGSGSYSITIKDARLEDSGKYACRATNPAG--EAKTEANFAVVKNLVPPEFVEKLSPLEVKEKESTTLSVKVVGTPEPSVEWFKDDTPISIDNVHVIQKQTAVGSFSLTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSIPPEFTQKLRPLEVREQETLDLKVTVIGTPVPNVEWFKD-----DKPINIDNSHIFAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAGEAKTTANMAVQEEIEAP--LFVQGLKPYEVEQGKPAELVVRVEGKPEPEVKWFKDGVPIAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEKQTAEEVKPLFIEPLKETF--AVEGDTVVLECKVNKESHPQIKFFKNDQPVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKEGKE-VEMSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEAPDFLQPVKPAVVTVGETAVLEGKISGKPKPSVKW-YKNGEELKPSDRVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVKEPAQVAPGFFKELSAIQVKETETAKFECKVSGT-KPDVKW-FKDGTPLKEDKRVHFESTDDGTQRLVIEDSKTDDQGNYRIEVSNDAGVANSKVPLTVV-PSETLKI-KKGLTDVNVTQGTKILLSVEVEGKPKT-VKWYKGTETVTSSQTTKIVQVTESEYKLEIESAEMSDTGAYRVVLSTDSFSVESSATVTVTKAAEKISLPSFKKGLADQSV---PKGTPLVLEVEIEGKPK-DVKWYKNGDEIKDGKVEDLGNGKYRLTIPDFQEKDVGEYSVTAANEAGEIESKAKVNVSAKPEI--VSGLVPTTVKQGETATFNVKVKG-PVKGVKWYKNGKEIPDAKTKDNGDGSYSLEIPNAQVEDAADYKVVVSNDAGDADSSAALTVKLADDGKDKVKPEIVSGLIPT----TVKQGETATFNVKVKGPVKQVKWYKNGKEIPNAKAKDNGDGSYSLEIPNAQLDDTADYKVVVSNDAGDADSSAALTVKL-PGIAIVKGLEDAEVPKGKKAVLQVETNKKPK-EIKWYKNGKEITPSDKAQPGSDGDNKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPAKEPKIIKGLEDQVVSIGSPIKLEIETSGSPK-TVKWYKNGKELPGAAAKTIKIQKIDDNKYVLEIPSSVVEDTGDYKVEVANEAGSANSSGKITV--EPKITFLKPLKDQSITEGENAEFSVETNTKPR-IVKWYKNGQ-----EIKPN------SRFIIEQKTDTKYQLVIKNAVRDDADTYKIVLENTAGEAESSAQLTVKKA----KAGLCKIVKGLEDQVVAKGAKMVFEVKIQGEPEDVRWLRDANVISAGANAIIEKIDDTTYRLIIPSADLKDAGEYTVEVINESGKAKSDAKGEVDEKPEIVRGLENIEIPEGDDDVFKVEVSA---PVRQVKWYKNDQEIKPNSHLEAK-KIGPKKYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTV-VKPNVLKIVDGLKDVDVEEPQPVELKVKVEGIPK---VIKWYK-NGQELKPDADGFKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHVKSAKSSEPTSGANFLSPLKDTEVEEGDMLTLQCTIAGEPFPEVIWEKDGVVLQKDDRITMRVALDGTATLRIRSAKKSDIGQYRVTAKNEAGSATSDCKVTVTEQGEQPSKPKFVIPLKTGAALPGDKKEFNV--KVRGLPKPTLQWFLNGIPI-----KFDDRITLDDMADGNYCLTIRDVREEDFGTLKCIAKNENGTDETVCEFQQGAGHDDGSRDDLRY-PPRFNVPLWDRRIPVGDPMFIECHVDANPTAEVEWFKDG-KKIEHTAHTEIRNTVDGACRIKIIPFEESDIGVYMCVAVNELGQAETQATYQVEILEHVEEEKRREYAPKINPPLEDKTVNG-GQPIRLSCKV-DAIPRASVVWYKDGLPLRADSRTSIQYEEDGTATLAINDSTEEDIGAYRCVATNAHGTINTSCSVNVK-VPKQEVKKEGEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKWYRNGQLLRN--GPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHVQMALGKTEKPKMDEGKPPKFILELSDMSVSLGNVI------DLECKVTGLPNPSVKWSKDGGPLIEDSRFEWSNEASKGVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDGLGSGVVTASQPPRFTLKMGDVRTTEGQPLKLECKVDASPLPEMVWYKDGAIVTPSDRIQISLSPDGVATLLIPSCVYDDDGIYRVIATNPSGTAQDKGTATVKKLPRDSGARRSADRDVFDANKAPKLMEPLENIRIPEKQSFRLRCKFSGDPKPTIKWFKDGERVFPYGRLQLIESPDGVCELVVDSATRQDAGGYRCVAENTYGSART 5326          

HSP 2 Score: 427.943 bits (1099), Expect = 3.856e-119
Identity = 632/2730 (23.15%), Postives = 1049/2730 (38.42%), Query Frame = 1
Query: 1900 KLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDE---KEISFIDNDSITASCRALSTPPP-----TFSWFLNGRELDPTDPRISIVNDVQESQIK--ISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIINET----IGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNI---DGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQ-----DNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRIMAKDNT------LVIKTVKAEDEAIYTCIAKNQVG----TAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGS---QLTVYSITEEHAGTFTCTATND--HAAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPL-VEIPGRVEIAGQ--KNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSK-------------MIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDL-QRNPFGITNSPIDKN-DLLITQMRSELQGIYTCDGTNVGGSAKMSYDVII----------------LE---------------------SPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNA-VGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVF---APYIDMKTPNKNITYNP--IIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKI-SLDGST--LTLFEVKHLDSGIYKCLAIN-IGESLNFTLVVLISPTIL--GKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEIT---NGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETP-EFLKGSTTNLWCNVSGFPTPQIRW-------TYMETIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKK----RWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRRVLLSDDG-YHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVE-------RTV--GGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGN-SKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLS-PNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDV-MEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADP----------PAKITWERHG--VPLSSGGSIRISP-DGTRITVENVKQY--DAGEYKCHAQNEVSKISLVFNVEV-----FLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEI------LADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSL-----GPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSD--ESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFR--ETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNF-VISNNAKVLTIPSVN-KEGGIFKCIARNEVGSIMKVYKLEVIMPALVR----LDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGI------FRYGTKTDSRTGILEITDAKEEDTGRYTCT-GTNKISQDSKSVDVVIISPPKIE--------SPKKSIMVRVGEQVLLPCIVEGTRPF-RIHWYTPGNN-QISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAG--YQEIRITL----EVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSG----LFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQIT------------VELLPKVSLP-----ISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFR--FNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYL-----SIFTRPKFVYKPKLKNVVQETRWKS-----FRCEATSHPKPDIKWMFNGRAIES------KLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDP----------SESIKRTILMCKVEGK-VDSIVWLKNGVIVQNSSRLYIN-----DFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVK--------------SPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNGS-----LRIIGVQKEHSGVYFCVASSNQG 9279
            ++ I S+  S  G+Y C+AE+  G S+   F+           E   KE+S    + +  SC    +P P     +FS          +  RI+I +D   +  +  IS +  +D       A NS G      K++      +    L K    E ++  +     G   P + W  +  PV+ DGN  + +     + TL + +      G++   A+N AG++  S   ++        FV  +   +    E  T+   V+G P P V+WL+        P+     + I +       S+ IK   +ED   Y C A N  G+ +      +     P     +   + V+      +   VV +  P+V  W K+   I   N  + +  T      L I   +  D  IY+C A+N+ G    TA F I  D    P      +  ++ ++ + + L+    G P P +EW K  +P+ ++    I    +GS    LT+     E  G +TC ATN+   A       V  +    +  +G+  YE+   +  EL  +   G P P+++W+K+G P+ ++    +E  G+   + L +   N  + G Y C+ATN+   D    ++ I   PK S  K             + + +  EG+ + L CK++    P  K+      +++ Q     +     D N  L I   + E  G Y C+  NV G A  + D+ I                LE                     +P+ ++      V       L C   G P PKIKW  + K +  +A V  +   +   TL  +       GEY C AENE G       + V    AP ID + P+      P  + VG        ++  P   +KW+KN  ++    P DR KI +LD  T  LT+   K  D   Y+C A N  G+  +   + +  P  +  G     S I + E       C   G   P   W+KD + L    RV      +G + L+I+  +  D   Y+  V+N+AG       + V VP     I    T     +G+   L   V G P   ++W       T  +T     +  +  +L   + + S    Y  + + ++ S        +T   + +SL   KK    + + K   L L    +  P   ++W+K+G+ I++    ++ N   +L + + QE D+G Y    +N+ G  +    V++   P I              G    F V    P   ++W K+G  I   +   + DG Y L + +    DA  Y+ +  N  G  D S  + V     L   GK   K E        TV  G T      V G P   + W K+G     +P+ + +  G+ S  LEI   Q  D   Y  V  N  G  +    +T+   P I   + L +  +  G +  L    N  P   I ++K+G  +   D + P  D   K +L++           A   D+  Y+   ++  G       ++ V+ P +      EPK+       + LE  ++ +  P          P  + W ++G  +P ++  +I+I   D  +  +E       D G+YK    NE    +    + V     FLKP   K+Q  T+ E       + S E T   P  + WY+  QEI      + +++   K+ ++  N+V        DDADTY     N  G  E   +++V    K  K  L     G E+  V +  ++ F   +         + W ++ + I  G  +  +   +  +  ++ P +D  ++G YT E  N +G+        V   P+      I R  E I +  G    F+     +P   + W+  D  I P   +    I      L I      +G  +K +  N  G       L V+ P +++    L  ++V E       V    EG PK VIKW ++G+ +      F++  K +S    L I  +K+ D G Y    G +K    S SV V + S    E        SP K   V  G+ + L C + G  PF  + W   G   Q    I           L I   +K   G YR  A N+AG    + ++T+    E   +PK   P +T    +     +   K+  G+P+P + W  NGI + K  +  T  D            ++ ED G+L CIAKN  G D    +              +   P+ ++P     I V    G  + I C V+  P   V W KDG+ +++      R   +    I I   +  D G Y+C+      +A T +TY       +    +  Y PK+   +++            C+  + P+  + W  +G  + +      +   +G  ++ +     E+ G Y+C+A N  G++  S  + V    +    + ++P          ++      L C V G     I W +NG +++N  R  I        +L +N++   D GIY+C A N+ G+A+ Q    V+               PP F L   ++S +LG V+ L C   G P P++ W K+   +  D         S     LRI        G Y CVA++  G
Sbjct: 2476 RVTITSSELSHQGKYTCIAENTEGTSKTEAFLTVQGEAPVFTKELQNKELSI--GEKLVLSCSVKGSPQPHVDFYSFSETTKVETKITSSSRIAIEHDQTNTHWRMVISQITKEDIVSYKAIATNSIGTATSTSKITTKVEAPVFEQGLKKTSVKEKEEIKMEVKVGGS-APDVEWFKDDKPVSEDGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEAEVTQSLEKPTFVRELVTTEVKINETATLSVTVKGVPDPSVEWLKD-----GQPVQTDSSHVIAKVEGSGSYSITIKDARLEDSGKYACRATNPAGEAKTEANFAVVKNLVPPEFVEKLSPLEVKEKESTTLSVKVVGTPEPSV-EWFKDDTPISIDNVHVIQKQTAVGSFSLTINDARQGDVGIYSCRARNEAGEALTTANFGIIRD-SIPPEFTQKLRP-LEVREQETLDLKVTVIGTPVPNVEWFKDDKPINID-NSHIFAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAGEAKTTANMAVQEEIEAPLFVQGLKPYEVEQGKPAEL-VVRVEGKPEPEVKWFKDGVPIAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKI---PKYSFEKQTAEEVKPLFIEPLKETFAVEGDTVVLECKVNKESHPQIKFFKNDQPVEIGQHMQLEVLE---DGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEAPDFLQPVKPAVVTVGETAVLEGKISGKPKPSVKWYKNGEELK---PSDRVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVKEPAQVAPGFFKELSAIQVKETETAKFECKVSGT-KPDVKWFKDGTPLKEDKRVHFESTDDGTQRLVIEDSKTDDQGNYRIEVSNDAGVANSKVPLTV-VPSETLKIKKGLTDVNVTQGTKILLSVEVEGKPK-TVKWYKGTETVTSSQTTKIVQVTESEYKLEIESAEMSDTGAYRVVLSTDSFSVESSATVTVTKAAEKISLPSFKKGLADQSVPKGTPLVLEVEIEGKP-KDVKWYKNGDEIKDGKVEDLGNGKYRLTIPDFQEKDVGEYSVTAANEAGEIESKAKVNVSAKPEI---VSGLVPTTVKQGETATFNVKVKGPVKGVKWYKNGKEIPDAKTKDNGDGSYSLEIPNAQVEDAADYKVVVSNDAGDADSSAALTV----KLADDGKDKVKPEIVSGLIPTTVKQGETATFNVKVKG-PVKQVKWYKNG---KEIPNAKAKDNGDGSYSLEIPNAQLDDTADYKVVVSNDAGDADSSAALTVKL-PGIAIVKGLEDAEVPKGKKAVLQVETNKKPK-EIKWYKNGKEITPSDKAQPGSDGDNKPQLVIP---------DAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPAK------EPKI------IKGLEDQVVSIGSPIKLEIETSGSPKTVKWYKNGKELPGAAAKTIKIQKIDDNKYVLEIPSSVVEDTGDYKVEVANEAGSANSSGKITVEPKITFLKP--LKDQSITEGE-----NAEFSVE-TNTKPRIVKWYKNGQEIKPNSRFIIEQKTDTKYQLVIKNAVR-------DDADTYKIVLENTAGEAESSAQLTV----KKAKAGLCKIVKGLEDQVVAKGAKMVFEVKIQGEPED---VRWLRDANVISAG-ANAIIEKIDDTTYRLIIPSADLKDAGEYTVEVINESGKAKSDAKGEVDEKPE------IVRGLENIEIPEGDDDVFKVEV-SAPVRQVKWYKNDQEIKPNSHLEAKKIGPKKYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVVKPNVLKIVDGLKDVDVEEPQPVELKV--KVEGIPK-VIKWYKNGQELKPDADGFKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYSGSV-VHVKSAKSSEPTSGANFLSPLKDTEVEEGDMLTLQCTIAG-EPFPEVIWEKDGVVLQKDDRITMRVALDGTATLRIRSAKKSDIGQYRVTAKNEAGSATSDCKVTVTEQGEQPSKPKFVIPLKT-GAALPGDKKEFNVKV-RGLPKPTLQWFLNGIPI-KFDDRITLDDMADGNYCLTIRDVREEDFGTLKCIAKNENGTDETVCEFQQGAGHDDGSRDDLRYPPRFNVPLWDRRIPV----GDPMFIECHVDANPTAEVEWFKDGKKIEHTAHTEIRNTVDGACRIKIIPFEESDIGVYMCVAVNELGQAETQATYQVEILEHVEEEKRREYAPKINPPLEDKTVNGGQPIRLSCKVDAIPRASVVWYKDGLPLRADSRTSIQYEEDGTATLAINDSTEEDIGAYRCVATNAHGTINTSCSVNVKVPKQEVKKEGEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKWYRNGQLLRNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHVQMALGKTEKPKMDEGKPPKFILELSDMSVSLGNVIDLECKVTGLPNPSVKWSKDGGPLIEDSRFEWSNEASKGVYQLRIKNATVHDEGTYRCVATNENG 5103          

HSP 3 Score: 399.438 bits (1025), Expect = 1.896e-110
Identity = 601/2691 (22.33%), Postives = 1072/2691 (39.84%), Query Frame = 1
Query: 2032 KEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKI--LSLDLAKEIPL-EGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNI--IINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIG---FGPRIKDFVTNIDGSYGENITIRCQVEG-QPPPRVKWLRGIAGGYNIPIALGDRYFI--NQDNS--LIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRIMAK------DNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFID---AKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVK----------------------APPQISKEG-------------------------------ISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPL---VEIPGRVEIAGQKNILKVYGK------NEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVII---LESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNA--VGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIV--GGNITFSCVMNSTPPAEIKWFKNE----IDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAIN-IGESLNFTLVVLISPTILGKHSSK-SVININEETDLYITCWSEGNPAPRYLWYKDNSQL-ISGGRV---EITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNV----FVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRW--------TYMETIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKL---------FDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIR--NNLRVNITNRGT-QLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNL-----------------------------------------YLFCVSEGRPKPKIEWRKDGSRIDFR---RVLLSDDG-YHLTVNSTMETDAGRYQCIAENTHGQ--TDISFDVQVTYGPTLDPGGKRYYKVER----TVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIG---NSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRN--RILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTL-MGVADPPAKITWERHGVPLSSGGS---IRISPDGTRITVENVKQYDAGEYKC------HAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPV--ILWTKENSPILIGDTDYYLTFNNGQ---SLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTV--TSPPKFPTDFSIFRETI--TVQLGTSVNFQCPAEGSPTPSIMWFY--KDMPISPYDMMNFVISNNAK---VLTIPSVN-KEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGI-----FRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVII----SPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNN---QISSTILGEYQFLSEQGLIID---RVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKI--FRPTETET-TGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYY----TTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISVTGDE------GSSVTIICKVEGKPKPTVTWKKDGQS--------LQNVLGNRFRFNSENEINIYDLKPEDTGNY-ICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNV-VQETRWKSFRCEATSHPKPDIKWMFNGRAI------ESKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQ--SDDPSESIKRTILMCKVEGKVDSIVWLKNGVIVQNSSRLY-------INDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPG--------NISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYD----FVKSLIKNGSLRIIGVQKEHSGVYFCVASSNQGEVHS 9291
            +++     D++     AL +P   + W+ NG  L+     ++I N+  +S + I N   QDSG++  +A N  G  E   +L+ ++ P    + +D  K + + E +    + + +G P P + W  N   V     I  I  E + TL I+  +    G     A NSAG   K  +L +      P+ K  +T+     GE +    +++G  P   V WL         P+   D   +  + D +  + I     E        A+N  G+ + S ++ ++G    K  F Q+ Q    +  + V    +V  KP   ++W  N K++  S  +  K        ++ I+    E        A+N  G  +   +L V  K   +  F T +D    K+G+ +      +G P+P + W   G P++  P + +        + + ++T E AG  +C ATN   +  ++ +++VK                         ++S +G                               + + E+   E + L+C +  G+P P +++Y   +      +I     IA + +    + +       +++  SY+  ATN + + +   +IT  V     +  + K   KE E++ +  K+ G   P  +W      +    N     N       L++ Q  +   G YT   +N  G+A+ S +  +   LE P  ++    + V I+ T TL+    G P P ++WL   + +  ++  V  K+ G    ++ ++ A     G+Y+C A N  G+ +  +    FA   ++  P      +P+ V    + T S  +  TP   ++WFK++    ID    + K   + ++   +LT+ + +  D GIY C A N  GE+L      +I  +I  + + K   + + E+  L +     G P P   W+KD+  + I    +   +  +G  TL IK+ R  D  VY C  TNEAGE K   ++ V      P  + G+   E  +   G    L   V G P P+++W           + +      + +  L   + + +   +YTC ATN+AG    +         F+       K + ++P K+ + ++   + L C  +      I++FK+ + +    ++++ +   G  +L + NA++ D+G Y+C   N  G  K     D+     I+F +K   H     G L                                          L C  +G P+PKI+W K+G  ++     R    DDG   LT ++  + DAG Y+C AEN +G   T+    V +   P +D     + +  +    TVG T VLE  +SG P P++ W K+G  +   PS R +I      +++L +   +  D   Y C A N FG +   + +T+  P  +     + L+   +K  +  +  C  +G+  P++ +FKDG       L  +K   ++         Q L +  +K  D G Y+   SN  G  V    V +   P  +T  ++  +    N T+  +  L + V   P  + W +    ++S  +   ++++    ++ +E+ +  D G Y+        +    + +++    E    P F K      +   + T + +  E  G  P  + WY+   EI   K      D+  G   + I + Q  D   Y+ TA N  G IE K +++V   P+I+   L P    VK+    TF     N  +  PV  + W K    I    T      +NG    SL I N + +++  Y     N AG    +  LTV      K      I    I  TV+ G +  F    +G P   + W+   K++P       N    +N      L IP+    +   +K +  N+ G       L V +P +  +  +E  E      +VL          IKW ++GK I      + G+  D++  ++ I DA ++D   Y    T++    + S   + +      PKI    +  +V +G  + L     G+ P  + WY  G       + TI  + Q + +   +++    V +D +G Y+    N+AG      + ++ V+PKI   +P + ++ T   N    ++      I    + W +NG  +     +     T T   L I N+++ +D  +   + +N AGE   + Q+TV+   K  L   V G E      G+ +    K++G+P+  V W +D           ++ +    +R      I   DLK  D G Y + +   SG   S A     +  +P+ V    L+N+ + E     F+ E  S P   +KW  N + I      E+K     +  + +   + ++  +YK +  N  G  + S  L V+    +++     D   E  +   L  KVEG    I W KNG  ++  +  +         +F+L I  +K  D G Y+ +  N  GE      + VKS        G        +     G++L L C   G P P + W K+  +++ D       +L    +LRI   +K   G Y   A +  G   S
Sbjct: 1989 RDMEVTKGDTVQMDVIALHSP--LYKWYQNGNLLEDGKNGVTIKNEENKSSLIIPNA--QDSGKITVEASNEVGSSESSAQLT-VNPPSTTPIVVDGPKSVTIKETETAEFKATISGFPAPTVKWTINEKIVEESRTITTIKTEDVYTLKISNAKIEQTGTVKVTAQNSAGQDSKQADLKVEPNVKAPKFKSQLTDKVADEGEPLRWNLELDGPSPGTEVSWLLN-----GQPLTKSDTVQVVDHGDGTYHVTIAEAKPEMSGTLTAKAKNAAGECETSAKVTVNG-GNKKPEFVQAPQNHETTLEESVKFSAIVTGKPMPNVTWYLNNKKLIQSEEVKVKYVHETGKTSIRIQKPLMEHNGTIRVEAENVSGKVQATAQLKVDKK-TEVPKFTTNMDDRQVKEGEDVKFTANVEGYPEPSVAWTLNGEPVSKHPNITVTDKDGEHTIEISAVTPEQAGELSCEATNPVGSKKRDVQLAVKKKTITQESITVESVEGVERVTITSSELSHQGKYTCIAENTEGTSKTEAFLTVQGEAPVFTKELQNKELSIGEKLVLSCSV-KGSPQPHVDFYSFSETTKVETKITSSSRIAIEHDQTNTHWRMVISQITKEDIVSYKAIATNSIGTATSTSKITTKVEAPVFEQGLKKTSVKEKEEIKMEVKVGG-SAPDVEWFKDDKPVSEDGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEAEVTQSLEKPTFVRELVTTEVKINETATLSVTVKGVPDPSVEWLKDGQPVQTDSSHVIAKVEGSGSYSITIKDARLEDSGKYACRATNPAGEAKTEA---NFAVVKNLVPPEFVEKLSPLEVKEKESTTLSVKVVGTPEPSVEWFKDDTPISIDNVHVIQK---QTAVGSFSLTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSIPPEFTQKLRPLEVREQETLDLKVTVIGTPVPNVEWFKDDKPINIDNSHIFAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAGEAKTTANMAVQEEIEAPLFVQGLKPYEVEQ---GKPAELVVRVEGKPEPEVKWFKDGVPIAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEKQTAEEVKPLFIEPLKETFAVEGDTVVLECKVNKESHPQIKFFKNDQPVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAG--KANTNADL----KIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEAPDFLQPVKPAVVTVGETAVLEGKISGKPKPSVKWYKNGEELK--PSDRVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVKEPAQVAPGFFKELSAIQVKETETAKFECKVSGT-KPDVKWFKDGTP-----LKEDKRVHFES---TDDGTQRLVIEDSKTDDQGNYRIEVSNDAG--VANSKVPLTVVPS-ETLKIKKGLT-DVNVTQGTKILLSVEVEGKPKTVKWYKGTETVTSSQTTKIVQVTESEYKLEIESAEMSDTGAYRVVLSTDSFSVESSATVTVTKAAEKISLPSFKKGLADQSVP--KGTPLVLEVEIEGK-PKDVKWYKNGDEIKDGKVE----DLGNGKYRLTIPDFQEKDVGEYSVTAANEAGEIESKAKVNVSAKPEIVS-GLVPTT--VKQGETATF-----NVKVKGPVKGVKWYKNGKEIPDAKTK-----DNGDGSYSLEIPNAQVEDAADYKVVVSNDAGDADSSAALTVKLADDGKDKVKPEIVSGLIPTTVKQGETATFNVKVKG-PVKQVKWYKNGKEIP-------NAKAKDNGDGSYSLEIPNAQLDDTADYKVVVSNDAGDADSSAALTVKLPGIAIVKGLEDAEVPKGKKAVLQVETNKKPKEIKWYKNGKEITPSDKAQPGSDGDNKPQLV-IPDAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPAKEPKIIKGLEDQVVSIGSPIKLEIETSGS-PKTVKWYKNGKELPGAAAKTI--KIQKIDDNKYVLEIPSSVVED-TGDYKVEVANEAG--SANSSGKITVEPKITFLKPLKDQSITEGENAEFSVETNTKPRI----VKWYKNGQEIKPNSRFIIEQKTDTKYQLVIKNAVR-DDADTYKIVLENTAGEAESSAQLTVKKA-KAGLCKIVKGLEDQVVAKGAKMVFEVKIQGEPE-DVRWLRDANVISAGANAIIEKIDDTTYRLI----IPSADLK--DAGEYTVEVINESGKAKSDAKG--EVDEKPEIVR--GLENIEIPEGDDDVFKVEV-SAPVRQVKWYKNDQEIKPNSHLEAKKIGPKKYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVVKPNVLKIVDGLKDVDVEEPQPVELKVKVEGIPKVIKWYKNGQELKPDADGFKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHVKSAKSSEPTSGANFLSPLKDTEVEEGDMLTLQCTIAGEPFPEVIWEKDGVVLQKDDRITMRVALDGTATLRIRSAKKSDIGQYRVTAKNEAGSATS 4582          

HSP 4 Score: 383.259 bits (983), Expect = 1.391e-105
Identity = 591/2618 (22.57%), Postives = 1030/2618 (39.34%), Query Frame = 1
Query: 2056 DSITASCRALSTPPPTFSWFLNGRELDPTDP-RISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSY---ISLPKILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIINETIG--TLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISW-----LKNGKEIEYSNRI-MAKDNT-----LVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGS--QLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAP---PQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPL----VEIPGRVEIAGQKNILKVYGKNEDETGSYECKATN---EVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILES---PKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLI--PPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIV--GGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGS-TLTLFEVKHLDSGIYKCLAIN-------IGE------SLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEIT---NGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGI--------------------------SMRETPEF---LKGSTTN------LWCNVSGFPTPQIRWT-------YMETIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTY--PPKIVSLDPD----KKRWILKDGELR-LSCNSDAAPVATIEWFKDGELIRNNLRVNITN--RGTQ-LHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIK--FNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRI-DFRRVLL--SDDGYH-LTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSK-QLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAP------PSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGT-RITVENVKQYDAGEYKCHAQNEVSK--------ISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLT-FNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTF-VLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFY--KDMPISPYDMMNFV-ISNNAKVLTIPS-VNKEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIE---VRERSGTSFSVLCTAEGYPKP-VIKWTRDGKGI-----FRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPP----KIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGN--NQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTET-ETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSG----LFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITV---ELLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDL-----KPEDTGNYICI-----GE-RSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIES------KLNSNGRGSITLQSVRSENAGEYKCIAKNRVGS------VEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEG-KVDSIVWLKNGVIVQNSSRLYIND-----FNLIINQAKSKDTGIYQCIASNSAGE-------AQGQVHLL-----VKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNG-----SLRIIGVQKEHSGVYFCVASSNQGEVHSQPIY 9303
            +S+  S      P P  +W+LN ++L  ++  ++  V++  ++ I+I     + +G +  +A+N +G  +   +L       +PK  + ++      EG+      +  G P+P + W  NG PV+   NI + +  G  T++I+ +     G+  C ATN  GS ++   L +      K  +T       E+IT+   VEG                                 + I    +  Q  Y C A+N  G  +    + + G A       Q+K++ +   L  V+ C V  S  P V  +      K   +I  S+RI +  D T     +VI  +  ED   Y  IA N +GTA    ++  + +  +          K+ + I ++ +  G   P +EW K  +P++ +    +  +P+     L V       AG +T  A+N         +  V      P   +E ++  E+   E   L+  +  G P P +EW K+GQP+      +  +VE +G  +I     + ED +G Y C+ATN   E  +++ F  +  LV P+  + K+  +  KE E  TL+ K+ G P P+ +W    + + +         + +    L I   R    GIY+C   N  G A  + +  I+     P+  Q      V    T+ L     G P P ++W    K I    + +  K  G    TL +++A     G Y+C A NE G+ +  + + V     +++ P       P  V  G        +   P  E+KWFK+ + I         K   +GS TL + +  + D G Y C A N       +GE      S        + P  +     K    +  +T + + C       P+  ++K++  +  G  +++    +G   L I+  ++ D   Y+C   N AG+   N D+ +     +                             + R  PEF   L+  T        L C V G P P+I+WT           + +         L F NV ++    Y C A NE GSA      ++T    PKI    PD     K  ++  GE   L       P  +++W+K+GE ++ + RV I N   GTQ L + NA+  D+  Y+C  SN+ G      T+ +  P  +   F  +  A QV         C   G  KP ++W KDG+ + + +RV    +DDG   L +  +   D G Y+    N  G  +    + V    TL    K    V  T G  ++L   V G P   + W K    +    + +   +  S+ +LEI + + SD G Y  V       +E    VT+         PS  +   L +  +  G  L L     G P  ++ ++K+G+ +    +    +  Y+           LT+   +  D G Y   A+N  G    +  V V   PE  +  V   V     +T +    + G   P   + W ++G  +    + + + DG+  + + N +  DA +YK    N+           + L  + +  +KP      + T ++  Q  T   + +  G P   + WY+  +EI   K +    D   G+  ++I N Q DD   Y    +N  G  +    ++V +P   + + L  E+  V +  +          N     I W K    I   D     +  +N   L I +   D++  Y     +  G  + +   LTV  P K P       + + V +G+ +  +    GSP  ++ W+   K++P +    +    I +N  VL IPS V ++ G +K    NE GS     K+  + P +  L  ++   + E     FSV    E   KP ++KW ++G+ I     F    KTD++  ++ I +A  +D   Y     N   +   S  + +        KI    +  +V  G +++    ++G  P  + W    N  +  ++ I+ +    + + LII       +G Y     N++G  +     EV  +P+I R  E  E     + V +++       P   + W +N   + K  ++      G        N  +++D      +  N AG+   +  +TV    +L  V     V  +E   V +  KVEG PK  + W K+GQ L+    + F+F  + E   + L     K  D G Y  +     GE  SG+     S   S  T       P     V+E    + +C     P P++ W  +G  ++       ++  +G  ++ ++S +  + G+Y+  AKN  GS      V  +   E  +KP+  +      +    +     KV G    ++ W  NG+ ++   R+ ++D     + L I   + +D G  +CIA N  G         QG  H       ++ PP F +   +    +G+ + + C  +  P   + W+K+ K I++    + I+N       ++II  ++   GVY CVA +  G+  +Q  Y
Sbjct: 2284 ESVKFSAIVTGKPMPNVTWYLNNKKLIQSEEVKVKYVHETGKTSIRIQKPLMEHNGTIRVEAENVSGKVQATAQLKVDKKTEVPK-FTTNMDDRQVKEGEDVKFTANVEGYPEPSVAWTLNGEPVSKHPNITVTDKDGEHTIEISAVTPEQAGELSCEATNPVGSKKRDVQLAVK-----KKTITQ------ESITVES-VEGV------------------------------ERVTITSSELSHQGKYTCIAENTEGTSKTEAFLTVQGEAPVFTKELQNKELSIGEKL--VLSCSVKGSPQPHVDFYSFSETTKVETKITSSSRIAIEHDQTNTHWRMVISQITKEDIVSYKAIATNSIGTATSTSKITTKVEAPVFEQGLKKTSVKEKEEIKMEVKVGGS-APDVEWFKDDKPVSEDGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEAEVTQSLEKPTFVRELVT-TEVKINETATLSVTV-KGVPDPSVEWLKDGQPVQTDSSHVIAKVEGSGSYSITIKDARLED-SGKYACRATNPAGEAKTEANFAVVKNLVPPEFVE-KLSPLEVKEKESTTLSVKVVGTPEPSVEWFKDDTPISIDNVHVIQKQTAVGSFSLTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSIPPEFTQKLRPLEVREQETLDLKVTVIGTPVPNVEWFKDDKPINIDNSHIFAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAGEAKTTANMAVQE---EIEAPLFVQGLKPYEVEQGKPAELVVRVEGKPEPEVKWFKDGVPIAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEKQTAEEVKPLFI--EPLKETFAVEGDT-VVLECKVNKESHPQIKFFKNDQPVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEAPDFLQPVKPAVVTVGETAVLEGKISGKPKPSVKWYKNGEELKPSDRVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVKEPAQVAPGFFKELSAIQVKETETAKFECKVSGT-KPDVKWFKDGTPLKEDKRVHFESTDDGTQRLVIEDSKTDDQGNYRIEVSNDAGVANSKVPLTVVPSETLKIK-KGLTDVNVTQGTKILLSVEVEGKPK-TVKWYKGTETVTSSQTTKIVQVTESEYKLEIESAEMSDTGAYRVVLSTDSFSVESSATVTVTKAAEKISLPSFKKG--LADQSVPKGTPLVLEVEIEGKPK-DVKWYKNGDEIKDGKVEDLGNGKYR-----------LTIPDFQEKDVGEYSVTAANEAGEIESKAKVNVSAKPEIVSGLVPTTVK--QGETATFNVKVKG---PVKGVKWYKNGKEIPDAKT-KDNGDGSYSLEIPNAQVEDAADYKVVVSNDAGDADSSAALTVKLADDGKDKVKPEIVSGLIPTTVK--QGETATFNVKVKG-PVKQVKWYKNGKEIPNAKAK----DNGDGSYSLEIPNAQLDDTADYKVVVSNDAGDADSSAALTVKLPGIAIVKGL--EDAEVPKGKKAVLQVET---NKKPKEIKWYKNGKEITPSDKAQPGSDGDNKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPAKEPKIIKGLEDQV-VSIGSPIKLEIETSGSPK-TVKWYKNGKELPGAAAKTIKIQKIDDNKYVLEIPSSVVEDTGDYKVEVANEAGSANSSGKI-TVEPKITFLKPLKDQSITEGENAEFSV----ETNTKPRIVKWYKNGQEIKPNSRFIIEQKTDTKYQLV-IKNAVRDDADTYKIVLENTAGEAESSAQLTVKKAKAGLCKIVKGLEDQVVAKGAKMVFEVKIQG-EPEDVRWLRDANVISAGANAIIEKIDDTTYR-LIIPSADLKDAGEYTVEVINESGKAKSDAKGEVDEKPEIVRGLENIEIPEGDDDVFKVEV----SAPVRQVKWYKNDQEI-KPNSHLEAKKIGPKKYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVVKPNVLKIVDGLKDVDVEEPQPVELKVKVEGIPK-VIKWYKNGQELKPD-ADGFKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHVKSAKSSEPTSGANFLSPLKDTEVEEGDMLTLQCTIAGEPFPEVIWEKDGVVLQKDDRITMRVALDGTATLRIRSAKKSDIGQYRVTAKNEAGSATSDCKVTVTEQGEQPSKPKFVIPLKTGAALPGDKKEFNVKVRGLPKPTLQWFLNGIPIKFDDRITLDDMADGNYCLTIRDVREEDFGTLKCIAKNENGTDETVCEFQQGAGHDDGSRDDLRYPPRFNVPLWDRRIPVGDPMFIECHVDANPTAEVEWFKDGKKIEH-TAHTEIRNTVDGACRIKIIPFEESDIGVYMCVAVNELGQAETQATY 4792          

HSP 5 Score: 363.229 bits (931), Expect = 1.538e-99
Identity = 649/2934 (22.12%), Postives = 1103/2934 (37.59%), Query Frame = 1
Query: 1498 INWYKNDAKIINTKTDNVQF--KRTS--NVTLEIYRANEVSQGVYAAEMVPVLPKQLTVK--GNTRDQVIXXXXXXXXXXXXXKNASIEPFKDAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHT---LPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPR-ISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEV--RIKLSYISLPKILSLD--------LAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTI----------DGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGE-------------------------------------NITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNSLII--KGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIA-----FTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRIMAKD-----NTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDV-QTKPIIIGDFKTF--IDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQ-LTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQIS---KEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLV--EIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTK--------EGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNST---------PPAEIKWFKNEIDIYKSLPKDRFKISLDGS-TLTLFEVKHLDSGIYKCLAIN-IGESLNFTLVVLISPTI-LGKHSSKSVININEETDLYITCWSEGNPAPRYL-WYKDNSQLISGGRVEITNGGKT---LLIKKVRRSDDSVYQCHVTNEAGEDKKNF-DVNVFVP---PSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRW---------TYMETIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNI---TNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAG--------AHQVALGGNLYLFCVS-EGRPKPKIEWRKDGSRIDFRRVLL----SDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSK-QLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFT---------NQTRSLECTLMGVADPPAKITWERHGVPLSSGGSI--RISPDGTR-ITVENVKQYDAGEYKCHAQNEVS------KISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEI------------SVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPI-LIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVT--------SPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPI--SPYDMMNFVISNNAKVLTIPSVNKEGGIFKCIARNEVGSI-------MKVYKLEVIMPA---LVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRYGTKTDSRTG-----ILEITDAKEEDTGRYTCTGTNKISQ-DSKSVDVVIISPPKIESPK-------------KSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRK---DHSGVYRCVANNDAGYQEIRITLEV----------LVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLS---KVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLP--------------------KVSLPI-SVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSEN---EINIYDLKPEDTGNYICIGERSGAEASTASTYLSI--------------------FTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWM------FNGRAIESKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIA-------------------KPRVR--VYQSDDPSESIKRTILMCKVEGKVDSIVWLKNGVIV----QNSSRLYIND----FNLIINQAKSKDTGIYQCIASNSAGEA--QGQVHLL-------------VKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKN-KKLIKYDFVKSLIKNG---SLRIIGVQKEHSGVYFCVASSNQGEVHSQPIYLTVQIP 9321
            + W+K+D  I     DNV    K+T+  + +L I  A +   G+Y+        + LT    G  RD +          + V +  +++      L+  V  T    V +WFK      + N+  F      K   +    L I  A   D G Y C A +E G ++    +        P      K              R    P P   WF +G  +   +   I    +     + I +    D G+  C+A N AG DE    +K+   S  K  + +        L +   +EGD   + C       P+I +  N  PV I          DGNI        L I   +K   G + C A N AG +  + +L I F  ++++ VT+  G   E                                        ++C+V+G+P P++KW +    G  + ++   R     D +L +    ++  D   Y C+A+N++G       I ++   APKI      F Q  +  V +  +  ++   +  KP   + W KNG+E++ S+R+  ++       L +   K +D   Y C A N+ G    D+ L V +   +  G FK    I  K+ +    +C+  G  KP ++W K G PL  +  +    + DG+Q L +     +  G +    +ND  A V   KV +   P  +   K+G++D  +     + L+  +  G P   ++WYK  + +   +    V++   +  L++      +TG+Y    + +  S      +T+    KA++   +  + K        +G  L L  +I+G P   K +     I D +    G       K  L I   + +  G Y+    N  G  +    V +   P+I+     + V    T T      G P   +KW    K IP      K  G+   +L +  A      +Y  +  N+ G    ++ +TV      +    K+    P IV G I  +     T         P  ++KW+KN     K +P  + K + DGS +L +   +  D+  YK +  N  G++ +   + +  P I + K    + +   ++  L +    E N  P+ + WYK+  ++    + +  + G     L+I      D + Y+  +T+E G    +   + V +P   P I  I   E      GS   L    SG P   ++W            +TI    +  N   L   +        Y     NEAGSA       +T  PKI  L P K + I +      S  ++  P   ++W+K+G+ I+ N R  I   T+   QL + NA   D   YK ++ N  G  + +  + +         +KAG          QV   G   +F V  +G P+  + W +D + I      +     D  Y L + S    DAG Y     N  G+       +V   P +  G      +E   G   V +  VS  P   + W K+   I        + IG  K +L I   Q  D   Y  V  N  G  +    +T+  P  +     L +  ++    + L     G P   I ++K+G      +L P+ D  +K           LT+ S+K++D G Y+    N  G       V V++     +S      N+ +             +L+CT+ G  +P  ++ WE+ GV L     I  R++ DGT  + + + K+ D G+Y+  A+NE        K+++    E   KP+F    L T   A+     + + +  G P PTL W+     I  D +R    D+  GN  + I +++ +D  T  C A N  GT E   E              +  PP+    ++   + R+     +   C V + N T  V  W K+   I     T+   T +    + I+  +  + G Y C A N  GQ        V            ++    +   E  TV  G  +   C  +  P  S++W+   +P+       + +     A +    S  ++ G ++C+A N  G+I       +KV K EV             +++    G SF++ C   G P P IKW R+G+ + R G +T   T       L + ++   D G Y C   N   +  +++   V ++  K E PK               + V +G  + L C V G     + W   G   I  +   E+   + +G+   R++       G YRCVA N+ G    +  + +            QP  F     +        L+++CK+ +  P P + W ++G  ++   +++   +       +  S   +D+G    IA N +G  +     TV+ LP                    K+  P+ ++   E  S  + CK  G PKPT+ W KDG+ +    G      S +   E+ +     +D G Y C+ E +   A T+     I                    FT P  + + K  + V      +F C    +P P IKW+      F+   I+ +  ++G   + L  V   + G ++C+A N  G+      L +                     KPR+R  +Y       ++   I+ C       ++ W K+G  +     +  R+   D     +L+I  A   D G Y   A+N  G A  +G ++++             +  PP F     N         I  C   G+P P + W+ N KK++    +K     G   +L I+    E +G Y   A ++ G   S  + L V +P
Sbjct: 2842 VEWFKDDTPI---SIDNVHVIQKQTAVGSFSLTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSIPPEFTQKLRPLEVREQETLD------LKVTVIGTPVPNV-EWFKDDKPINIDNSHIF-----AKDEGSGHHTLTIKQARGEDVGVYTCKATNEAGEAKTTANMAVQEEIEAPLFVQGLKPYEVEQGKPAELVVRVEGKPEPEVKWFKDGVPIAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEKQTAEEVKPLFIEPLKETFAVEGDTVVLECKVNKESHPQIKFFKNDQPVEIGQHMQLEVLEDGNI-------KLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKE---GKEVEMSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEAPDFLQPVKPAVVTVGETAVLEGKISGKPKPSVKWYKNGEELKPSDRVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVKEPAQVAPGFFKELSAIQVKETETAKFECKVSGT-KPDVKWFKDGTPLKEDKRVHFESTDDGTQRLVIEDSKTDDQGNYRIEVSND--AGVANSKVPLTVVPSETLKIKKGLTDVNVTQGTKILLSVEV-EGKPK-TVKWYKGTETVTSSQTTKIVQVTESEYKLEIESAEMSDTGAYRVVLSTDSFSVESSATVTVT---KAAEKISLPSFKKGLADQSVPKGTPLVLEVEIEGKPKDVKWYKNGDEIKDGKVEDLGNG-----KYRLTIPDFQEKDVGEYSVTAANEAGEIESKAKVNVSAKPEIVSGLVPTTVKQGETATFNVKVKG-PVKGVKWYKNGKEIP--DAKTKDNGDGSYSLEIPNAQVEDAADYKVVVSNDAGDADSSAALTV-----KLADDGKD-KVKPEIVSGLIPTTVKQGETATFNVKVKGPVKQVKWYKN----GKEIPNAKAKDNGDGSYSLEIPNAQLDDTADYKVVVSNDAGDADSSAALTVKLPGIAIVKGLEDAEVPKGKKAVLQV----ETNKKPKEIKWYKNGKEITPSDKAQPGSDGDNKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPAKEPKI--IKGLEDQVVSIGSPIKLEIETSGSPK-TVKWYKNGKELPGAAAKTIKIQKIDDNKYVLEIPSSVVEDTGDYKVEVANEAGSANSSGK--ITVEPKITFLKPLKDQSITEGENAEFSVETNTKP-RIVKWYKNGQEIKPNSRFIIEQKTDTKYQLVIKNAVRDDADTYKIVLENTAGEAESSAQLTVK-------KAKAGLCKIVKGLEDQVVAKGAKMVFEVKIQGEPE-DVRWLRDANVISAGANAIIEKIDDTTYRLIIPSADLKDAGEYTVEVINESGKAKSDAKGEVDEKPEIVRG---LENIEIPEGDDDVFKVEVSA-PVRQVKWYKNDQEIKPNSHLEAKKIGPKKYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVVKPNVLKIVDGLKDVDVEEPQPVELKVKVEGIPK-VIKWYKNGQ-----ELKPDADG-FKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHVKS---AKSSEPTSGANFLSPLKDTEVEEGDMLTLQCTIAG--EPFPEVIWEKDGVVLQKDDRITMRVALDGTATLRIRSAKKSDIGQYRVTAKNEAGSATSDCKVTVTEQGEQPSKPKFVI-PLKTGA-ALPGDKKEFNVKVRGLPKPTLQWFLNGIPIKFD-DRITLDDMADGNYCLTIRDVREEDFGTLKCIAKNENGTDETVCEFQQGAGHDDGSRDDLRYPPRF---NVPLWDRRIPVGDPMFIECHV-DANPTAEV-EWFKDGKKIEHTAHTEIRNTVDGACRIKIIPFEESDIGVYMCVAVNELGQAETQATYQVEILEHVEEEKRREYAPKINPPLEDKTVNGGQPIRLSCKVDAIPRASVVWYKDGLPLRADSRTSIQYEEDGTATLAINDSTEEDIGAYRCVATNAHGTINTSCSVNVKVPKQEVKKEGEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKWYRNGQ-LLRNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHVQMALGKTEKPKMDEGKPPKFILELSDMSVSLGNVIDLECKVTGLPNPSVKWSKDGGPLIEDSRF-EWSNEASKGVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDGLGSGVVTASQPPRFTLKMGDVRTTEGQPLKLECKV-DASPLPEMVWYKDGAIVTPSDRIQISLSPDGVATLLIPSCVYDDDGIYRVIATNPSGTAQDKGTATVKKLPRDSGARRSADRDVFDANKAPKLMEPLENIRIPEKQSFRLRCKFSGDPKPTIKWFKDGERV-FPYGRLQLIESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNVIRGDRKPRDIDSSIREGKAPGFTTPLTIRRAKPGDSV------TFECLPFGNPFPSIKWLKDGLELFSDEKIKMEAAADGTQRLILSDVTFLSEGYFRCVATNEHGTASTKAELVIEGDRTIGSRPLPEVNGEPEECKPRIRRGLYNMSIHEGNVVEMIV-CATGIPTPTVKWYKDGQEIVGDGPDGKRVIFTDERGIHHLVIVNASPDDEGEYSLEATNKLGSAKTEGSLNIIRPRHIADADERGGMPFPPGFVRQLKNKHVFNHMPTIFDCLVVGHPAPEVEWFHNGKKIVPGGRIKIQSCGGGSHALIILDTTLEDAGEYVATAKNSHGSASSSAV-LDVTVP 5670          

HSP 6 Score: 359.762 bits (922), Expect = 1.689e-98
Identity = 609/2682 (22.71%), Postives = 1016/2682 (37.88%), Query Frame = 1
Query: 1333 SGKDSRGNEMQ--RYSRIAIFSRDPLPVSVSCPAKIQVKRGHGIKVNCLVQSEIPYLINWYKNDAKIINTKTDNVQFKRTSNVTLEIYRANEVSQGVYAAEMVPVLPK------------------------------QLTVKGNTRDQVIXXXXXXXXXXXXXKNASIEPFKDAELECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEKEISFID---------NDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVN-DVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPL----EGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIINET-IGT--LDINRIEKNMKGQWVCVATNSAGSSRKSFNLDI--GFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRG---IAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKK---VIVCLVVESKPPAVISWLKNGKEIEYSNRIMAKDN---TLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKP-IIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGS-QLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSV--------KAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIP-GRVEIAGQKNI-LKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTC-----DGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNA---VGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHL---DSGIYKCLAINIGESLNFTLVVLISPTILGKHSSKSVININEE-----TDLYITCWSEGNPAPRYLWYKDNSQLISGGRV---EITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSI-NGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXXXXXXXXXQL----HFMNVDKSHI---TRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIR---NNLRVNITNRGTQLHLL--NAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPS------IKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDG------SRIDFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTV-----VLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQ-----LEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGA------------PPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLD---MFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIG-------YDV-----------MEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPL--SSGGSIRISPDGTR-ITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQ----LYTK----IEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVII--------------PPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQS-----LTILNPKSDESGRYTCEAKNLAGQ-DSHTF----------VLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVIS-NNAKVLTIPS-VNKEGGIFKCIARNEVGSIMK-----VYKL------------EVI----MPALVR-LDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRYGTKT--DSRTGILE--ITDAKEEDTGRYTCTGTNKISQDSKSVDVVII----------------SPPKIESPKKSIMVRVGEQVLLPCIVEGTRPF-RIHWYTPGNNQIS-STILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEV-------------------LVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITL----SKVKNYYTTTDSGL--FIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPISVTGDEGS--------------------SVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNS----ENEINIYDLKPEDTGNYICIGERSGAEASTAS 8493
            +GKD    E++  +YS     + +  P+ +    +     G  + + C V  E    I ++KND  +   +   ++     N+ L I  A +   G Y  E V V  K                              Q    G+T      T    P  V + ++ ++   + A L+C V        +KW K     E+  + R R EH     +  +  L   + +++D GEY C AE+E G +   G I      A  +D +   F+           ++     +    P P+  W+ NG EL P+D R+ I N D    ++ ++N K  D  E  C+A N  G     + L+ +  P  ++    KE+      E +     C  +G  +P + W  +G+P+  D  +    T  GT  L I   + + +G +    +N AG +     L +      +IK  +T+++ + G  I +  +VEG+ P  VKW +G   +       I          +  L I+   M D  AY          V+ S  + ++  AA KI+    K+ + + ++ K   +++ + +E KP  V  W KNG EI+   ++    N    L I   + +D   Y+  A N+ G  +   +++V  KP I+ G   T +  K G+      + KG P   ++W K G+ +   P  +   + DGS  L + +   E A  +    +ND         ++V        K  P+I   G+    +   E    N  +    P  +++WYKNG+   EIP  + +  G  +  L++     D+T  Y+   +N+         +T+ +   A    +      +G+K  L  + +  P   K +     I    +   G      +K  L+I     +    Y       DG     S  ++  +   E PKII+  +  VV I + I L    SG+P   +KW    K +P  A   +  + + +N+  L +  +     G+Y     NE G    +  +TV  P I    P K+ +   I  G N  FS   N T P  +KW+KN  +I    P  RF I     T     +K+    D+  YK +  N       +  + +     G    K V  + ++       +      +G P     W +D + + +G      +I +    L+I      D   Y   V NE+G+ K +    V   P I  G+   E PE   G        VS  P  Q++W   +    P       ++    + + ++++ +     Y  + +N AG         +  P  +  +D  K   + +   + L    +  P   I+W+K+G+ ++   +  +        +  L   ++++SD G Y+ ++ N  G       V +    S        F S     +V  G  L L C   G P P++ W KDG       RI  R  L  D    L + S  ++D G+Y+  A+N  G    + D +VT     +   K  + +    G  +          V G+P P + W  +GIPI     +  RI  +        L I  ++  D G   C+AKN  G  E   +   GA            PP    N  L +  I VGD + + C  + +P   + +FKDG  ++     ++    D + + +++  +E           +D G+Y C A N +G       Y V            EY+ ++  P E  T N          Q   L C +  +  P A + W + G+PL   S  SI+   DGT  + + +  + D G Y+C A N    I+   +V V +  +  K +     +TK    + A +  +  + C  TG P P + WYR  Q +L +  R        G+  + +      D   Y C A N  G  + +    V +              PPK +   L   +  V     I   C V    +  P + W+K+  P++    D    ++N  S     L I N    + G Y C A N  G   + +F          V+T + PP+F       R T     G  +  +C  + SP P ++W+     ++P D +   +S +    L IPS V  + GI++ IA N  G+        V KL            +V      P L+  L+ I + E+   SF + C   G PKP IKW +DG+ +F YG     +S  G+ E  +  A  +D G Y C   N       S DV +I                  P   +P      + G+ V   C+  G  PF  I W   G    S   I  E      Q LI+  V     G +RCVA N+ G    +  L +                     +P+I R     +    N V  + C    GIP P + W ++G  +       K    T + G+   +  +   +DEG  +  A N  G  +    + + + P+    I+   + G                          C V G P P V W  +G+ +  V G R +  S     + + I D   ED G Y+   + S   AS+++
Sbjct: 3087 AGKDETVGELKIPKYSFEKQTAEEVKPLFIEPLKETFAVEGDTVVLECKVNKESHPQIKFFKNDQPVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKV-KGEPRPKIKWTKEGKEVEM--SARVRAEHK----DDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEAPDFLQPVKPAVVTVGETAVLEGKISGKPKPSVKWYKNGEELKPSD-RVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLT-VKEPAQVAPGFFKELSAIQVKETETAKFECKVSGT-KPDVKWFKDGTPLKEDKRVHFESTDDGTQRLVIEDSKTDDQGNYRIEVSNDAGVANSKVPLTVVPSETLKIKKGLTDVNVTQGTKILLSVEVEGK-PKTVKWYKGTETVTSSQTTKIV----QVTESEYKLEIESAEMSDTGAYRVVLSTDSFSVESSATVTVTK-AAEKISLPSFKKGLADQSVPKGTPLVLEVEIEGKPKDV-KWYKNGDEIK-DGKVEDLGNGKYRLTIPDFQEKDVGEYSVTAANEAGEIESKAKVNVSAKPEIVSGLVPTTV--KQGETATFNVKVKG-PVKGVKWYKNGKEI---PDAKTKDNGDGSYSLEIPNAQVEDAADYKVVVSNDAGDADSSAALTVKLADDGKDKVKPEIVS-GLIPTTVKQGETATFNVKVK--GPVKQVKWYKNGK---EIPNAKAKDNGDGSYSLEIPNAQLDDTADYKVVVSNDAGDADSSAALTVKLPGIAIVKGLEDAEVPKGKKAVLQVETNKKPKEIKWYKNGKEITPSDKAQPGSDGD--NKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPAKE-PKIIKGLEDQVVSIGSPIKLEIETSGSPK-TVKWYKNGKELPGAAAKTIKIQKIDDNKYVLEIPSSVVEDTGDYKVEVANEAGSANSSGKITV-EPKITFLKPLKDQS---ITEGENAEFSVETN-TKPRIVKWYKNGQEIK---PNSRFIIEQKTDTKYQLVIKNAVRDDADTYKIVLENTAGEAESSAQLTVKKAKAG--LCKIVKGLEDQVVAKGAKMVFEVKIQGEPE-DVRWLRDANVISAGANAIIEKIDDTTYRLIIPSADLKDAGEYTVEVINESGKAKSDAKGEVDEKPEIVRGLENIEIPE---GDDDVFKVEVSA-PVRQVKWYKNDQEIKPNSHLEAKKIGPKKYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVVKPNVLKIVDGLKDVDVEEPQPVELKVKVEGIP-KVIKWYKNGQELKPDADGFKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHVKSAKSSEPTSGANFLSPLKDTEVEEGDMLTLQCTIAGEPFPEVIWEKDGVVLQKDDRITMRVAL--DGTATLRIRSAKKSDIGQYRVTAKNEAGSA--TSDCKVTVTEQGEQPSKPKFVIPLKTGAALPGDKKEFNVKVRGLPKPTLQWFLNGIPIK----FDDRITLDDMADGNYCLTIRDVREEDFGTLKCIAKNENGTDETVCEFQQGAGHDDGSRDDLRYPPRF--NVPLWDRRIPVGDPMFIECHVDANPTAEVEWFKDGKKIEHTAHTEIRNTVDGACRIKIIPFEE-----------SDIGVYMCVAVNELGQAETQATYQVEILEHVEEEKRREYAPKINPPLEDKTVN--------GGQPIRLSCKVDAI--PRASVVWYKDGLPLRADSRTSIQYEEDGTATLAINDSTEEDIGAYRCVATNAHGTINTSCSVNVKVPKQEVKKEGEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKWYRNGQ-LLRNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHVQMALGKTEKPKMDEGKPPKFI---LELSDMSVSLGNVIDLECKV--TGLPNPSVKWSKDGGPLI---EDSRFEWSNEASKGVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDGLGSGVVTASQPPRFTLKMGDVRTT----EGQPLKLECKVDASPLPEMVWYKDGAIVTPSDRIQISLSPDGVATLLIPSCVYDDDGIYRVIATNPSGTAQDKGTATVKKLPRDSGARRSADRDVFDANKAPKLMEPLENIRIPEKQ--SFRLRCKFSGDPKPTIKWFKDGERVFPYGRLQLIESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNVIRGDRKPRDIDSSIREGKAPGFTTPLTIRRAKPGDSVTFECLPFGN-PFPSIKWLKDGLELFSDEKIKMEAAADGTQRLILSDVTFLSEGYFRCVATNEHGTASTKAELVIEGDRTIGSRPLPEVNGEPEECKPRIRRGLYNMSIHEGNVVEMIVCAT--GIPTPTVKWYKDGQEIVGDGPDGKRVIFTDERGIHHLVIVNASPDDEGEYSLEATNKLGSAKTEGSLNI-IRPRH---IADADERGGMPFPPGFVRQLKNKHVFNHMPTIFDCLVVGHPAPEVEWFHNGKKI--VPGGRIKIQSCGGGSHALIILDTTLEDAGEYVATAKNSHGSASSSA 5663          

HSP 7 Score: 335.109 bits (858), Expect = 5.228e-91
Identity = 468/2075 (22.55%), Postives = 811/2075 (39.08%), Query Frame = 1
Query: 3619 TGSYECKATNEVSSDSRFFQITILVAPKASD-----SKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDV---------IILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNS-TPPAEIKWFKNEIDIYKSLPKDRFKISLDGS---TLTLFEVKHLDSGIYKCLAINIGESLNFTLVVLISPTILGKHSSKSVINI--NEETDL----YITCWSEGNPAPRYLWYKDNSQLISGGRVEIT----NGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKN----FDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSAR-KLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRK--DGSRIDFR-----RVLLSDD----GYHLTVNSTMETDAGRYQCIAENTHG-QTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQAS--DAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYI---IKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYS---VRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGT----RITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVF---LKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVI--IPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLT---FNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKF-----------PTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKV-LTIPSVNKEG-GIFKCIARNEVGSIMKVYKLEVIMPALV---------RLDKIEVRERSGTSFS----------------------------VLCTAEGYPKPVIKWTRDGKGI-----FRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQ--DSKSVDVVIISPPKIE-------SPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNN-QISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAG--YQEIRITLE--VLVQPKIFRP------TETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKN-YYTTTDSGL--FIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPKVSLPI-----SVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENE--INIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKS----FRCEATSHPKPDIKWMFNGRAI-ESKLNS--NGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGKVDSIVWLKNGVIVQNSSRLYIND--FNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVK---------SPPVFT-LLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNG----SLRIIGVQKEHSGVYFCVASSNQGEVHSQPIYLTVQIPG 9324
            +G+    A+N   S     ++ +L  PK +       K+  +   +G+  T+   +    +P  KW    ++L+  +N   I N   +K+ L+I   +    G  T + +N  GS++ S  +         I+++ PK +   +        TI      SG P P +KW   +K++  +     +  E+  TL +  A     G     A+N  G+D K + + V  P +        +T      G  + ++  ++  +P  E+ W  N   + KS   D  ++   G     +T+ E K   SG     A N       +  V    T+ G +     +    N ET L      +    G P P   WY +N +LI    V++      G  ++ I+K     +   +    N +G+ +       D    VP     +  R+  E   G       NV G+P P + WT      +   +S +  +   + D  H    + +   +AG    +  +PV +           KKR    D +L +   +      T+E  +  E      RV IT+         ++ S  G Y C+  N  G  K    + +     + F  +    ++++G  L L C  +G P+P +++    + ++++ +     R+ +  D     + + ++   + D   Y+ IA N+ G  T  S        P  + G K+    E+     + +E  V G   P + W KD  P++   ++  +    +    ++  QA+  DAG+Y+  A N  G  E   +  +    S+++   + E +   +K+ +   L     G P+P++ + KDG  +         D+S+    +       +T+  A+  DSG Y C A+N  G    E +   V+   PPEF    VE        +  S   ++  V  P   + W +   P+S      I          +T+ + +Q D G Y C A+NE  +     N  +    + P F   Q    +E  +  T+ +     G P P + W++ ++ I  D       D   G+  + I   + +D   Y C ATN  G  +    ++V   I   +  + L P  + V++         V      +P + W K+  PI I D  + +     N   +L I +  + + G+YTC+A N AG+D     L +   PK+           P      +ET  V+ G +V  +C       P I +F  D P+     M   +  +  + LTI +  KE  G ++C A N  G       L++   A V         +L++I   E  G + S                            + C  +G P+P IKWT++GK +      R   K D  T  L   +  + D G Y C   N+         + V +   PKI+        P K  +V VGE  +L   + G     + WY  G   + S  +  E      Q L +   + D    YRC A+N+ G  + ++ +T++    V P  F+        ETET        + +CK+     +P + W ++G  L + K  ++ +TD G    +    K +D+G+      N AG       +TV  +P  +L I      V   +G+ + +  +VEGKPK TV W K  +++ +    +    +E+E  + I   +  DTG Y  +         +++T        K       K +  ++  K        E    PK D+KW  NG  I + K+    NG+  +T+   + ++ GEY   A N  G +E    + V AKP +         +  +      KV+G V  + W KNG  + ++      D  ++L I  A+ +D   Y+ + SN AG+A     L VK          P + + L+P  +    GE        +G P+  + WYKN K I     K    NG    SL I   Q + +  Y  V S++ G+  S    LTV++PG
Sbjct: 1950 SGTVSVVASNAAGSVETKTELKVLETPKETKKPEFTDKLRDMEVTKGD--TVQMDVIALHSPLYKWYQNGNLLEDGKNGVTIKNEE-NKSSLIIPNAQD--SGKITVEASNEVGSSESSAQLTVNPPSTTPIVVDGPKSVTIKETETAEFKATI------SGFPAPTVKWTINEKIVEESRTITTIKTEDVYTLKISNAKIEQTGTVKVTAQNSAGQDSKQADLKV-EPNVKAPKFKSQLTDKVADEGEPLRWNLELDGPSPGTEVSWLLNGQPLTKS---DTVQVVDHGDGTYHVTIAEAKPEMSGTLTAKAKNAAGECETSAKV----TVNGGNKKPEFVQAPQNHETTLEESVKFSAIVTGKPMPNVTWYLNNKKLIQSEEVKVKYVHETGKTSIRIQKPLMEHNGTIRVEAENVSGKVQATAQLKVDKKTEVPKFTTNMDDRQVKE---GEDVKFTANVEGYPEPSVAWTL-----NGEPVSKHPNITVTDKDGEHTIEISAVTPEQAGELSCEATNPVGS-----------KKR----DVQLAVKKKTITQESITVESVEGVE------RVTITS---------SELSHQGKYTCIAENTEGTSKTEAFLTVQGEAPV-FTKELQNKELSIGEKLVLSCSVKGSPQPHVDFYSFSETTKVETKITSSSRIAIEHDQTNTHWRMVISQITKEDIVSYKAIATNSIGTATSTSKITTKVEAPVFEQGLKKTSVKEKE---EIKMEVKVGG-SAPDVEWFKDDKPVSEDGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEAEVTQ--SLEKPTFVRELVTTEVKINETATLSVTVKGVPDPSVEWLKDGQPVQT-------DSSHVIAKVEGSGSYSITIKDARLEDSGKYACRATNPAGEAKTEANFAVVKNLVPPEF----VEKLSPLEVKEKESTTLSVKVVGTPEPSVEWFKDDTPISIDNVHVIQKQTAVGSFSLTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSIPPEF--TQKLRPLEVREQETLDLKVTVIGTPVPNVEWFKDDKPINIDNSHIFAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAGEAKTTANMAVQEEIEAPLFVQGLKP--YEVEQGKPAELVVRV--EGKPEPEVKWFKDGVPIAI-DNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKI---PKYSFEKQTAEEVKPLFIEPLKETFAVE-GDTVVLECKVNKESHPQIKFFKNDQPVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDG-TLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEAPDFLQPVKPAVVTVGETAVLEGKISGKPKPSVKWYKNGEELKPSDRVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVKEPAQVAPGFFKELSAIQVKETETA-------KFECKV--SGTKPDVKWFKDGTPLKEDKRVHFESTDDGTQRLVIEDSKTDDQGNYRIEVSNDAGVANSKVPLTV--VPSETLKIKKGLTDVNVTQGTKILLSVEVEGKPK-TVKWYKGTETVTSSQTTKIVQVTESEYKLEIESAEMSDTGAYRVVLSTDSFSVESSATVTVTKAAEKISLPSFKKGLADQSVPKGTPLVLEVEIEGKPK-DVKWYKNGDEIKDGKVEDLGNGKYRLTIPDFQEKDVGEYSVTAANEAGEIESKAKVNVSAKPEIVSGLVPTTVKQGETATFNVKVKGPVKGVKWYKNGKEIPDAKTKDNGDGSYSLEIPNAQVEDAADYKVVVSNDAGDADSSAALTVKLADDGKDKVKPEIVSGLIPTTVKQ--GETATFNVKVKG-PVKQVKWYKNGKEIPNAKAKD---NGDGSYSLEIPNAQLDDTADYKVVVSNDAGDADSS-AALTVKLPG 3917          

HSP 8 Score: 325.865 bits (834), Expect = 2.796e-88
Identity = 487/2175 (22.39%), Postives = 828/2175 (38.07%), Query Frame = 1
Query: 3337 AGTFTCTATNDHAAVVKEFKVSVKAPPQISK-----EGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMI----KIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVII---LESPKI-IQFNDKSVVFIDNTITLTCIASGNPTP--KIKWLFK-KKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFA----PYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLD-SGIYKCLAINIGESLNFTLVVLIS-----PTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEIT--NGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETIXXXXXXXXXXQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGE-LRLSCNSDAAPVATIEWFKDGEL------IRNNLRVNITNRGTQLH----LLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRRVLLSDDGYH------------LTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQA--SDAGRYSCVAKNTFGQMEI---FMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYS---VRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPD----GTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEV---FLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPEN-----HRVKENMQITFHCSVYNYNMTK---PVILWTKENSPILIGDTDYYLTFNNGQ-SLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPK-----------------FPT----------------DFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKV-LTIPSVNK-EGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTAE---------GYPKPVIKWTRDGKGIFRYG----TKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPK-----KSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNN-QISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETE--TTGVLNTVLQMQCKIL-----EGIPQPVITWER--NGITLSKVKNYYTTTDSGLFI-FNSLKIEDEGSLTCI--AKNVAGEDRLTFQITVELLPKVSLPISVTG------DEGSSVTIICKVEGKPKPTVTWKKDGQSLQN----VLGN-RFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAI-ESKLNSNGRGSITLQ--SVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILM----------------CKVEGKVDSIVWLKNGVIVQNSSRLYIND--FNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANL--GEVLILPCAAEGYPIPTISWYKNKKLIKYDFVKSLIKNGS----LRIIGVQKEHSGVYFCVASSNQGEVHSQPIYLTVQIPG 9324
            +GT +  A+N   +V  + ++ V   P+ +K     + + D E+   + V+++ I      SP  +WY+NG  L +    V I  ++N   +   N  ++G    +A+NEV S     Q+T  V P ++   ++     +  KE E       I GFP PT KW+    I++  R    I     D   L I+  + E  G       N  G      D+ +   +++PK   Q  DK  V  +       +    P+P  ++ WL   + L   + V     G+    + +  A     G  +  A+N  G+ + ++ VTV      P       N   T        ++ FS ++   P   + W+ N   + +S       +   G T    +   ++ +G  +  A N+   +  T  + +      P        + V    E  D+  T   EG P P   W  +   +     + +T  +G  T+ I  V         C  TN  G  K++  + V                                     + T  +   +   +    ++   + + SH  +YTCIA N  G+++   +  LT   +      + +   L  GE L LSC+   +P   ++++   E       I ++ R+ I +  T  H    +    + DI  YK + +N +G       +   +   + F        V     + +  V  G   P +EW KD   +       S+DG H            L V     TDAG+Y   A N  G  + S + +VT         +     E  +  T  L   V G+P P++ WLKDG P+    S+    +  S    I    A   D+G+Y+C A N  G+ +    F  V    PP       L+   +K  +   L     G+P P++ +FKD   + + ++        +K+  V      LT+  A++ D G+Y C A N  G  +   +   +R   PPEF T  + P +     +T  L+ T++G   P   + W +   P++   S   + D       +T++  +  D G Y C A NE  +     N+ V      P F   Q     E  Q    ++     G P P + W++    I  D +   +     G+  + I +    D   Y C ATN  G  E   E+   IP    ++    E        +KE   +     V    + K   P I + K + P+ IG         +G   LTI N K ++ G Y CEA N+AG+ +    L +    K                 F T                +F     + TV        +C  +G P P I W  +   +     +     ++  + LT  +V + + G ++C A NE GS      + V +    ++D            +V+   E         G PKP +KW ++G+ +           D  T  L +T+AK +D   Y C  +N+       V + +  P ++ +P       +I V+  E     C V GT+P  + W+  G   +    +  E      Q L+I+  + D  G YR   +NDAG    ++ L V+       P+ET     G+ +  +    KIL     EG P+  + W +    +T S+       T+S   +   S ++ D G+   +    + + E   T  +T +   K+SLP    G       +G+ + +  ++EGKPK  V W K+G  +++     LGN ++R      + I D + +D G Y         E  + +  +++  +P+ V    +   V++    +F  +    P   +KW  NG+ I ++K   NG GS +L+  + + E+A +YK +  N  G  + S  L         V  +DD  + +K  I+                  KV+G V  + W KNG  + N+      D  ++L I  A+  DT  Y+ + SN AG+A     L VK P +  ++ G   A +  G+  +L       P   I WYKN K I          +G     L I     + +  Y  V +   G        LTV++P 
Sbjct: 1950 SGTVSVVASNAAGSVETKTELKVLETPKETKKPEFTDKLRDMEVTKGDTVQMDVIALH---SPLYKWYQNGNLLEDGKNGVTIKNEENKSSLIIPNAQDSGKITVEASNEVGSSESSAQLT--VNPPSTTPIVVDGPKSVTIKETETAEFKATISGFPAPTVKWTINEKIVEESRTITTIKTE--DVYTLKISNAKIEQTGTVKVTAQNSAGQDSKQADLKVEPNVKAPKFKSQLTDK--VADEGEPLRWNLELDGPSPGTEVSWLLNGQPLTKSDTVQVVDHGDGTYHVTIAEAKPEMSGTLTAKAKNAAGECETSAKVTVNGGNKKPEFVQAPQNHETTLE-----ESVKFSAIVTGKPMPNVTWYLNNKKLIQSEEVKVKYVHETGKTSIRIQKPLMEHNGTIRVEAENVSGKVQATAQLKVDKKTEVPKFTTNMDDRQV---KEGEDVKFTANVEGYPEPSVAWTLNGEPVSKHPNITVTDKDGEHTIEISAVTPEQAGELSCEATNPVGSKKRDVQLAV------------------------------------KKKTITQESITVESVEGVERVTITSSELSHQGKYTCIAENTEGTSKT--EAFLTVQGEAPVFTKELQNKELSIGEKLVLSCSVKGSPQPHVDFYSFSETTKVETKITSSSRIAIEHDQTNTHWRMVISQITKEDIVSYKAIATNSIGTATSTSKITTKVEAPV-FEQGLKKTSVKEKEEIKM-EVKVGGSAPDVEWFKDDKPV-------SEDGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEAEVTQSLEKPTFVRELVTTEVKINETATLSVTVKGVPDPSVEWLKDGQPVQTDSSHVIAKVEGSGSYSITIKDARLEDSGKYACRATNPAGEAKTEANFAVVKNLVPPEFVEK--LSPLEVKEKESTTLSVKVVGTPEPSVEWFKDDTPISIDNVH-----VIQKQTAVGS--FSLTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSIPPEF-TQKLRP-LEVREQETLDLKVTVIGT--PVPNVEWFKDDKPINIDNSHIFAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAGEAKTTANMAVQEEIEAPLFV--QGLKPYEVEQGKPAELVVRVEGKPEPEVKWFKDGVPIAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELK--IPKYSFEKQTAEEVKPLFIEPLKETFAVEGDTVVLECKVNKESHPQIKFFKNDQPVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEAPDFLQPVKPAVVTVGETAVLEGKISGKPKPSVKWYKNGEELKPSDRVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVKEPAQV-APGFFKELSAIQVKETETAKFECKVSGTKP-DVKWFKDGTPLKEDKRVHFESTDDGTQRLVIEDSKTDDQGNYRIEVSNDAGVANSKVPLTVV-------PSETLKIKKGLTDVNVTQGTKILLSVEVEGKPK-TVKWYKGTETVTSSQTTKIVQVTESEYKLEIESAEMSDTGAYRVVLSTDSFSVESSATVTVT-KAAEKISLPSFKKGLADQSVPKGTPLVLEVEIEGKPK-DVKWYKNGDEIKDGKVEDLGNGKYR------LTIPDFQEKDVGEYSVTAANEAGEIESKAK-VNVSAKPEIVSG-LVPTTVKQGETATFNVKVKG-PVKGVKWYKNGKEIPDAKTKDNGDGSYSLEIPNAQVEDAADYKVVVSNDAGDADSSAAL--------TVKLADDGKDKVKPEIVSGLIPTTVKQGETATFNVKVKGPVKQVKWYKNGKEIPNAKAKDNGDGSYSLEIPNAQLDDTADYKVVVSNDAGDADSSAALTVKLPGI-AIVKGLEDAEVPKGKKAVLQVETNKKP-KEIKWYKNGKEITPSDKAQPGSDGDNKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPA 4012          

HSP 9 Score: 196.052 bits (497), Expect = 5.238e-49
Identity = 310/1349 (22.98%), Postives = 515/1349 (38.18%), Query Frame = 1
Query: 1486 IPYLINWYKNDAKIINTKTDNVQFKR---TSNVTLEIYRANEVSQGVYAAEMVPVLPKQLTVKGNTRDQVIXXXXXXXXXXXXXKNAS----IEPFKDAE--------LECNVFSTSSNVVLKWFKS--IPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFI------KTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQ--IKISNVKPQDSGELICKAKNSAGIDEV--------------RIKLSYISLPKILSLDL-AKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIINETIG---TLDINRIEKNMKGQWVCVATNSAGSS--RKSFNLDI----------GFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDN----SLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCL------------VVESKPPAVISWLKNGKEIEYSNRIMAKDN-----TLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQT------KPIII-GDFKTFI-DAKD-----GDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGS----QLTVYSITEEHAGTFTCTATNDH-AAVVKEFK----------VSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIA----GQKNILK---VYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSK-------------------MIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQR-NPFG---ITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSV----------------VFIDNTITLTCIASGNPTPKIKWLFKK-KLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNIT--------------YNPIIVGGNITFSCV-MNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDG---STLTLFEVKHLDSGIYKCLAIN-IGE-----SLNFTLVVLIS-----------PTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITN---GGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVP--PSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWTYMETI 4959
            IP +I WYKN  + +    D  +F+    +   +L I  + +   G Y             V GN + +V    +         +  S    + P KD E        L+C +       V+ W K   + + + + T R  ++         ++ L I SA +SD G+Y   A++E G + +   +      +  + P   +  K  + +  D    + +    P PT  WFLNG  +   D RI++ +D+ +    + I +V+ +D G L C AKN  G DE               R  L Y   P   ++ L  + IP+ GD   + C     P  ++ W  +G  +    +  I  T+     + I   E++  G ++CVA N  G +  + ++ ++I           + P+I   + +   + G+ I + C+V+  P   V W +       +P+    R  I  +     +L I   + ED  AY C A N HG +  S  + +      K+   + K+   E    K +V L             V   P   I W +NG+ +    R + + +     +L +      DE IY C A+N  G AK      VQ       KP +  G    FI +  D     G+VI L+C+  G P P ++W K G PL  +   R   S + S    QL + + T    GT+ C ATN++ +A  K F           V+   PP+ + + + D      + ++L C +   +P P++ WYK+G  +V    R++I+    G   +L    VY    D+ G Y   ATN   +       T+   P+ S ++                   +  I   E +   L CK  G P PT KW       D +R  P+G   +  SP    +L++     +  G Y C   N  GSA+ S DV ++   +  +  D S+                    +++T  C+  GNP P IKWL    +L     +  +   +  + LI+     +  G + C+A NE G     + + +         P   +               YN  I  GN+    V     P   +KW+K+  +I    P  +  I  D      L +      D G Y   A N +G      SLN      I+           P  + +  +K V N          C   G+PAP   W+ +  +++ GGR++I +   G   L+I      D   Y     N  G    +  ++V VP   SI      +   +L         N +  PTP  R  +++ +
Sbjct: 4421 IPKVIKWYKN-GQELKPDADGFKFEEKPESGEFSLTIPSSKKSDGGAYRV-----------VLGNDKGEVYSGSVVHVKSAKSSEPTSGANFLSPLKDTEVEEGDMLTLQCTIAGEPFPEVI-WEKDGVVLQKDDRITMRVALDG--------TATLRIRSAKKSDIGQYRVTAKNEAGSATSDCKVTVTEQGEQPSKPKFVIPLKTGAALPGDKKEFNVKVRGLPKPTLQWFLNGIPIK-FDDRITL-DDMADGNYCLTIRDVREEDFGTLKCIAKNENGTDETVCEFQQGAGHDDGSRDDLRY---PPRFNVPLWDRRIPV-GDPMFIECHVDANPTAEVEWFKDGKKIEHTAHTEIRNTVDGACRIKIIPFEESDIGVYMCVAVNELGQAETQATYQVEILEHVEEEKRREYAPKINPPLEDKTVNGGQPIRLSCKVDAIPRASVVWYKD-----GLPLRADSRTSIQYEEDGTATLAINDSTEEDIGAYRCVATNAHGTINTSCSVNV------KVPKQEVKKEGEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKWYRNGQLLRNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHVQMALGKTEKPKMDEGKPPKFILELSDMSVSLGNVIDLECKVTGLPNPSVKWSKDGGPLIEDS--RFEWSNEASKGVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDGLGSGVVTASQPPRFTLK-MGDVRTTEGQPLKLECKV-DASPLPEMVWYKDGA-IVTPSDRIQISLSPDGVATLLIPSCVY----DDDGIYRVIATNPSGTAQDKGTATVKKLPRDSGARRSADRDVFDANKAPKLMEPLENIRIPEKQSFRLRCKFSGDPKPTIKW-----FKDGERVFPYGRLQLIESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNVIRGDRKPRDIDSSIREGKAPGFTTPLTIRRAKPGDSVTFECLPFGNPFPSIKWLKDGLELFSDEKIKMEAAADGTQRLILSDVTFLSEGYFRCVATNEHGTASTKAELVIEGDRTIGSRPLPEVNGEPEECKPRIRRGLYNMSIHEGNVVEMIVCATGIPTPTVKWYKDGQEIVGDGPDGKRVIFTDERGIHHLVIVNASPDDEGEYSLEATNKLGSAKTEGSLNIIRPRHIADADERGGMPFPPGFVRQLKNKHVFN---HMPTIFDCLVVGHPAPEVEWFHNGKKIVPGGRIKIQSCGGGSHALIILDTTLEDAGEYVATAKNSHGSASSSAVLDVTVPFLDSIKFNGEIDVTPYLTEEYGFKKLNTASLPTPPDRGPFIKEV 5714          

HSP 10 Score: 185.652 bits (470), Expect = 7.006e-46
Identity = 301/1364 (22.07%), Postives = 536/1364 (39.30%), Query Frame = 1
Query: 5482 EWRKDGSRIDFRR-VLLSDDG---YHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGP--TLDPG-GKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYR--YRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPS----IDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVR---TPPEFDTSNVEPKVNWFTNQTRSLECTL-MGVADPPAKITWERHGVPLSSGGSIRI--SPDGT-RITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVF---LKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERS-GTSFSVLCTAEGYPKPVI-------------KWTRDGK-GIFRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVI-ISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQG---LIIDRVRKDHSGVYRCVANNDAGYQEIRITLEV---LVQPKIFRPTETETTGV-LNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSG----LFIFNSLKIEDEGSLTCIAKNVAGEDR--LTFQITVELLP-----KVSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQ----NVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNV-VQETRWKSFRCEATSHPKPDIKWMFNGRAIE-------SKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVY-QSDDP--SESIKRTILMCKVEGKVD-SIVWLKNGVIVQNSSRLYIN------DFNLIINQAKSKDTGIYQCIASNSAG--EAQGQVHLLVKS---------PPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIK--YDFVKSLIKNGSLR--IIGVQKEHSGVYFCVASSNQGEVHS 9291
            +W  DG  I   + V +S D    +  ++++TM   +G    +A N  G  +   +++V   P  T  P    +   +E T G TV ++ +   + +P   W ++G   N L   +    I     +  +I   A D+G+ +  A N  G  E    +T+  P +    +D  + +    IK  +        +G P P + +  +   ++          S     + +++   L + +AK   +G  +  A N+ G D  +  ++V      P+F  S +  KV    ++   L   L +    P  +++W  +G PL+   ++++    DGT  +T+   K   +G     A+N   +      V V     KP F   Q     E     +V+ S   TG P P + WY   ++++  +E   K+    G + ++I     +   T    A N  G ++   ++ V    ++ K +   ++ +VKE   + F  +V  Y   +P + WT    P+           +   ++ I     +++G  +CEA N  G       L V          +I +E+ITV+    V                                     +V    S     G + CIA N  G+      L V   A V   +++ +E S G    + C+ +G P+P +             K T   +  I    T T  R  I +IT   +ED   Y    TN I   + +  +   +  P  E   K   V+  E++ +   V G+ P  + W+   +  +S     E +   E G   L++ +     +G Y   A+N AG  E     EV   L +P   R  E  TT V +N    +   + +G+P P + W ++G  +    ++      G           ++ED G   C A N AGE +    F +   L+P     K+S P+ V   E  S T+  KV G P+P+V W KD   +     +V+  +    S + + I D +  D G Y C       EA T + +  I       +  KL+ + V+E      +      P P+++W  + + I        +K   +G  ++T++  R E+ G Y C A N  G  + +  + V  +    ++ Q   P   E  K   L+ +VEGK +  + W K+GV +   ++  I          L+I    + D G Y C A+N AG  E  G++ +   S          P+F        A  G+ ++L C       P I ++KN + ++        ++++G+++  I   +KE  G Y C A +  G+ ++
Sbjct: 1915 KWFLDGKEITTAQGVTVSKDDQFEFRCSIDTTM-FGSGTVSVVASNAAGSVETKTELKVLETPKETKKPEFTDKLRDMEVTKGDTVQMDVI--ALHSPLYKWYQNG---NLLEDGKNGVTIKNEENKSSLIIPNAQDSGKITVEASNEVGSSESSAQLTVNPPSTTPIVVDGPKSVT---IKETETAEFKATISGFPAPTVKWTINEKIVE---------ESRTITTIKTEDVYTLKISNAKIEQTGTVKVTAQNSAGQDSKQADLKVEPNVKAPKF-KSQLTDKV---ADEGEPLRWNLELDGPSPGTEVSWLLNGQPLTKSDTVQVVDHGDGTYHVTIAEAKPEMSGTLTAKAKNAAGECETSAKVTVNGGNKKPEFV--QAPQNHETTLEESVKFSAIVTGKPMPNVTWYLNNKKLIQSEEVKVKYVHETGKTSIRIQKPLMEHNGTIRVEAENVSGKVQATAQLKVDKKTEVPKFTTNMDDRQVKEGEDVKFTANVEGY--PEPSVAWTLNGEPVSKHPNITVTDKDGEHTIEISAVTPEQAGELSCEATNPVGSKKRDVQLAVKKK-------TITQESITVESVEGVE------------------------------------RVTITSSELSHQGKYTCIAENTEGTSKTEAFLTVQGEAPVFTKELQNKELSIGEKLVLSCSVKGSPQPHVDFYSFSETTKVETKITSSSRIAIEHDQTNTHWRMVISQIT---KEDIVSYKAIATNSIGTATSTSKITTKVEAPVFEQGLKKTSVKEKEEIKMEVKVGGSAP-DVEWFK-DDKPVSEDGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEAEVTQSLEKPTFVR--ELVTTEVKINETATLSVTV-KGVPDPSVEWLKDGQPVQTDSSHVIAKVEGSGSYSITIKDARLEDSGKYACRATNPAGEAKTEANFAVVKNLVPPEFVEKLS-PLEVK--EKESTTLSVKVVGTPEPSVEWFKDDTPISIDNVHVIQKQTAVGSFS-LTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSIPPEFTQKLRPLEVREQETLDLKVTVIGTPVPNVEWFKDDKPINIDNSHIFAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAGEAKTTANMAVQEEIEAPLFVQGLKPYEVEQGKPAELVVRVEGKPEPEVKWFKDGVPIAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEKQTAEEVKPLFIEPLKETFAVEGDTVVLECKVNKESHPQIKFFKNDQPVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANT 3197          

HSP 11 Score: 164.466 bits (415), Expect = 1.557e-39
Identity = 250/1059 (23.61%), Postives = 422/1059 (39.85%), Query Frame = 1
Query: 1765 LECNVFSTSSNVVLKWFKSIPRYELKNTKRFRIEHYKKSPNAFSSKLIILSASESDNGEYVCVAEHEGGVSEAVGFIKTHTLPAASVDEK------------EISFIDNDSITASCRALSTPPPTFSWFLNGRELDPTDPRISI-VNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPK----------ILSLDLAKEIPLEGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNIIINETIG---TLDINRIEKNMKGQWVCVATNSAGSSRKSFN--------------LDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNS-----LIIKGLSMEDQSAYICDAQNQHGKVQESVQIRI-----SGI--AAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRI---MAKDN--TLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKT----FIDAKDGDVIV---------------LQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDG-SQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSV----KAPPQIS---KEG--------ISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPG-RVEIAG---QKNILK-VYGKNEDETGSYECKATNEVSSDSRFFQITIL------------VAPKASDSK------MIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFG---ITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKS---------------VVFIDNTITLTCIASGNPTPKIKWLFK-KKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPNKNITYNPIIVG--GNITFSCVMNSTPPAEIKWFKNEIDIYKSL---PKDRFKISLDGSTLTLFEVKHLDSGIYKCLAINIGESL 4524
            +EC+V +  +  V +WFK   + E  +T    I +        + ++ I+   ESD G Y+CVA +E G +E     +   L     +++            + +      I  SC+  + P  +  W+ +G  L   D R SI   +   + + I++   +D G   C A N+ G       ++ + +PK            +  L       GD  T++C+ TG P P+I W  NG  +      +I  +     +L +N    + +G + C A N+ G ++                  +D G  P+    ++++  S G  I + C+V G P P VKW +   GG   P+    R+  + + S     L IK  ++ D+  Y C A N++G       +R+     SG+  A+    FT     V  +  + + +   V++ P   + W K+G  +  S+RI   ++ D   TL+I +   +D+ IY  IA N  GTA+      V+  P   G  ++      DA     ++               L+C+  GDPKP I+W K G  +     L+++ SPDG  +L V S T + AG + C A N + +      V+V    + P  I    +EG        ++       ++V   C+   GNP P I+W K+G  L      ++E A    Q+ IL  V   +E   G + C ATNE  + S   ++ I             V  +  + K      +  +   EG  + +     G PTPT KW +K     +   P G   I       + L+I     + +G Y+ + TN  GSAK    + I+    I   +++                 VF        C+  G+P P+++W    KK++P   +  +  G     LI+        GEY   A+N  G    ++++ V  P++D    N  I   P +    G    +     TPP    + K     Y +L   P  R        T  + E++ L    +  L  NI E +
Sbjct: 4723 IECHVDANPTAEV-EWFKDGKKIE--HTAHTEIRNTVDG----ACRIKIIPFEESDIGVYMCVAVNELGQAETQATYQVEILEHVEEEKRREYAPKINPPLEDKTVNGGQPIRLSCKVDAIPRASVVWYKDGLPLR-ADSRTSIQYEEDGTATLAINDSTEEDIGAYRCVATNAHGTINTSCSVN-VKVPKQEVKKEGEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKWYRNGQLLRNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHVQMALGKTEKPKMDEGKPPKFILELSDMSVSLGNVIDLECKVTGLPNPSVKWSKD--GG---PLIEDSRFEWSNEASKGVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDGLGSGVVTASQPPRFTLKMGDVRTTEGQPLKLECKVDASPLPEMVWYKDGAIVTPSDRIQISLSPDGVATLLIPSCVYDDDGIYRVIATNPSGTAQDKGTATVKKLPRDSGARRSADRDVFDANKAPKLMEPLENIRIPEKQSFRLRCKFSGDPKPTIKWFKDGERVFPYGRLQLIESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNVIRGDRKPRDIDSSIREGKAPGFTTPLTIRRAKPGDSVTFECL-PFGNPFPSIKWLKDGLELFSDEKIKMEAAADGTQRLILSDVTFLSE---GYFRCVATNEHGTASTKAELVIEGDRTIGSRPLPEVNGEPEECKPRIRRGLYNMSIHEGNVVEMIVCATGIPTPTVKW-YKDGQEIVGDGPDGKRVIFTDERGIHHLVIVNASPDDEGEYSLEATNKLGSAKTEGSLNIIRPRHIADADERGGMPFPPGFVRQLKNKHVFNHMPTIFDCLVVGHPAPEVEWFHNGKKIVPGGRIKIQSCGGGSHALIILDTTLEDAGEYVATAKNSHGSASSSAVLDVTVPFLDSIKFNGEIDVTPYLTEEYGFKKLNTASLPTPPDRGPFIKEVTGHYLTLSWIPTKRAPPRYPQVTY-VIEIRELPEKQWSLLEYNIPEPV 5761          

HSP 12 Score: 144.436 bits (363), Expect = 1.844e-33
Identity = 163/644 (25.31%), Postives = 267/644 (41.46%), Query Frame = 1
Query: 6583 VQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGP------ENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQS--LTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPP---KFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKE-GGIFKCIARNEVGSIMKVYKLEVIMPAL-----VRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGK---------------GIFRYG---TKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGN--NQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTE------TETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSG--LFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVE---LLPKVSL-PISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQN 8367
            +Q ++ +M  + TGYP P + WY+ + ++  D ER+  +    G   M I  +Q  D   Y C ATN  G         V+   K+ K +  P       +   KE   I F C V  +   +P ++W  ++ P L    D+ L ++ GQ+  L I + + D++G YT + +N  G       L V + P       +F    E +    G  V F+    G P P I+WF    P+S  + + F+  +   +LTI  V +   G+  C   N +GS     +L+V +P         L+   V+E+S   F V  +  G+P+P + +T  GK               G +R     T  D   G  EI    + + G         + Q+ +       S P      +   V+ GE  +    V G     + W+  G+  +Q S  +  E     +  L ID  +  ++G   C A N  G  E +  L VL   K  +P +       +T  V NTV+  + ++ EG P+P +TW   G  L +          G       ++KIED G +  +A N  G D    ++TV+     P+  L P+S+T ++GS         G P PT  W  +G+ +++
Sbjct:  560 LQESSAKMCLKVTGYPLPDITWYKDDVQLHED-ERHTFYSDEDGFFAMTIDPVQVTDTGRYTCMATNEYGQASTSAFFRVL---KVEKEAAPPAFVTKLRDKECKEGDVIDFECEVEGW--PEPELVWLVDDQP-LRPSHDFRLQYD-GQTAKLEIRDAQPDDTGVYTVKIQNEFGSIESKAELFVQADPDKNHVAPEFQATIEYVECDEGEEVRFKSVITGDPNPEIIWFINGKPLSESEKVKFISEDGICILTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVPPAPPTFNKPLEDKTVQEKSTVVFEVDVS--GWPEPTLTFTLCGKELKNGEEGVEIVGHDGFYRISIPNTSMDKHDG--EIVAKAQNEHGTAESRARLTVEQEEEESR----SAPTFLKDIEDQTVKTGEFAVFETTVRGNPNPEVTWFINGHKMDQGSPGVKIEAHN-HDHKLTIDSAQ--YAGTVLCRAENAVGRFETKARLVVLAPEKQKKPPKFVEILVDKTETVDNTVV-FEVRV-EGEPKPTVTWYLKGEELKQSDRVEIREFDGSIKISIKNIKIEDAGEIRAVATNSEGSDETKAKLTVQKKPFAPEFDLRPVSLTVEKGSEAVFSAHAFGIPLPTYEWSVNGRKVRD 1182          

HSP 13 Score: 144.436 bits (363), Expect = 2.074e-33
Identity = 175/629 (27.82%), Postives = 258/629 (41.02%), Query Frame = 1
Query: 5461 GRPKPKIEWRKDGSRI--DFRRVLLSD-DGYH-LTVNSTMETDAGRYQCIAENTHGQTDIS--FDVQVTYGPTLDPGGKRYYKVERTVGGTVV-LECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKV-------GDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSN--VEPKVNWFTNQTRS---LECTLMGVADPPAKITWERHGVPLSSG--GSIRISPDG-TRITVEN--VKQYDAGEYKCHAQNE----VSKISLVFNV---EVFLKPRFYKN----QLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVK-ENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMW 7239
            G P P I W KD  ++  D R    SD DG+  +T++    TD GRY C+A N +GQ   S  F V         P      + +    G V+  EC V G P P + WL D  P+     +R +  G + +LEI   Q  D G Y+   +N FG +E   ++ + A P  D+N +  E+   +       G+E+R      G PNP I +F +G  L           S K + +      +LT+    R   G+  C  SN +G    +  ++VR PP   T N  +E K    T Q +S    E  + G  +P   +T+   G  L +G  G   +  DG  RI++ N  + ++D GE    AQNE     S+  L       E    P F K+     + T   AV  TTV+      G P P + W+    ++    +  P   I   N   ++T      A T  C A N  G  E K  + V+ P K  K     E    K E +  T    V      KP + W  +   +   D      F+    ++I N K +++G     A N  G D     LTV   P F  +F +   ++TV+ G+   F   A G P P+  W
Sbjct:  573 GYPLPDITWYKDDVQLHEDERHTFYSDEDGFFAMTIDPVQVTDTGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLRDKECKEGDVIDFECEVEGWPEPELVWLVDDQPLRPSHDFRLQYDGQTAKLEIRDAQPDDTGVYTVKIQNEFGSIESKAELFVQADP--DKNHVAPEFQATIEYVECDEGEEVRFKSVITGDPNPEIIWFINGKPL---------SESEKVKFISEDGICILTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVPPAPPTFNKPLEDK----TVQEKSTVVFEVDVSGWPEP--TLTFTLCGKELKNGEEGVEIVGHDGFYRISIPNTSMDKHD-GEIVAKAQNEHGTAESRARLTVEQEEEESRSAPTFLKDIEDQTVKTGEFAVFETTVR------GNPNPEVTWFINGHKM---DQGSPGVKIEAHNHDHKLTIDSAQYAGTVLCRAENAVGRFETKARLVVLAPEKQKKPPKFVEILVDKTETVDNTVVFEVRVEGEPKPTVTWYLKGEELKQSDRVEIREFDGSIKISIKNIKIEDAGEIRAVATNSEGSDETKAKLTVQKKP-FAPEFDLRPVSLTVEKGSEAVFSAHAFGIPLPTYEW 1173          

HSP 14 Score: 112.849 bits (281), Expect = 6.400e-24
Identity = 167/684 (24.42%), Postives = 270/684 (39.47%), Query Frame = 1
Query: 5647 TYGPTLDPGGKRYYKVE---RTVGGTVVLECL-VSGIPTPAITWLKDGIPINRLPSYRYRIIGNSK---QLEIIAMQASDAGRYSCVAKNTFGQME---IFMDVTI---GAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLEC--------TLMGVADPPAKITWERHGVPLSSGGSIR-ISPDGTRI-TVENVKQYDAGEYKCHAQNEVSKISL--VFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFDILRGNSVMQI----TNIQPDDADTYACTATNGGGTIEKKFEISV-------IIPPKIMKRSLGPENHRVKENMQITFHCSVY-NYNMTKPVILW------TKENSP---ILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPP--KFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNF-VISNNAKVLTIPSVNKEGGIFKCIARNEVGSIMKVYKLEV----IMPAL-VRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGI 7536
            T G TL+  G R  + +   RT+  +    CL V+G P P ITW KD + ++     R+    +      + I  +Q +D GRY+C+A N +GQ      F  + +    APP+      L +   K GD +   C   G P P + +  D   L           S+  RL    +   L +  A+  D+G+Y     N  G    +  + V+  P  D ++V P+   F      +EC          +   DP  +I W  +G PLS    ++ IS DG  I T+++V ++  G   C   N +   S      V V   P  +   L  K    + +TV    + +G+P PTL +    +E+   +E     +I+  +   +I    T++   D +  A  A N  GT E +  ++V          P  +K     E+  VK      F  +V  N N   P + W        + SP   I   + D+ LT ++ Q           +G   C A+N  G+      L V +P   K P  F       T  +  +V F+   EG P P++ W+ K   +   D +       + K+       ++ G  + +A N  GS     KL V      P   +R   + V + S   FS    A G P P  +W+ +G+ +
Sbjct:  538 TTGTTLEMQGTRVTRTQYGFRTLQESSAKMCLKVTGYPLPDITWYKDDVQLHE--DERHTFYSDEDGFFAMTIDPVQVTDTGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTK--LRDKECKEGDVIDFECEVEGWPEPELVWLVDDQPL---------RPSHDFRLQYDGQTAKLEIRDAQPDDTGVYTVKIQNEFGSIESKAELFVQADP--DKNHVAPE---FQATIEYVECDEGEEVRFKSVITGDPNPEIIWFINGKPLSESEKVKFISEDGICILTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVPPAPPTFNKPLEDKT-VQEKSTVVFEVDVSGWPEPTLTFTLCGKELKNGEE---GVEIVGHDGFYRISIPNTSMDKHDGEIVA-KAQNEHGTAESRARLTVEQEEEESRSAPTFLKDI---EDQTVKTGEFAVFETTVRGNPN---PEVTWFINGHKMDQGSPGVKIEAHNHDHKLTIDSAQY----------AGTVLCRAENAVGRFETKARLVVLAPEKQKKPPKFVEILVDKTETVDNTVVFEVRVEGEPKPTVTWYLKGEELKQSDRVEIREFDGSIKISIKNIKIEDAGEIRAVATNSEGSDETKAKLTVQKKPFAPEFDLRPVSLTVEKGSEAVFS--AHAFGIPLPTYEWSVNGRKV 1180          

HSP 15 Score: 108.612 bits (270), Expect = 1.101e-22
Identity = 150/626 (23.96%), Postives = 258/626 (41.21%), Query Frame = 1
Query: 7489 GYPKPVIKWTRDGKGIFRYGTKT--DSRTGILEIT--DAKEEDTGRYTCTGTNKISQDSKSVDVVII------SPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQG-LIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQP-KIFRPTETETTGVLNTVLQMQC---------KILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIED-----EGSLTCIAKNVAGEDRLTFQITVELLPK---VSLPIS-VTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQN------VLGNR--FRFNSEN-EINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPK-LKNVVQET----RWKSFRCEATSHPKPDIKWMFNGRAIES-----KLNS-NGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIA-----KPRVRVYQSDDPSESIKRTILM-CKVEGKVD-SIVWLKNGVIVQNSSRLYINDFN----LIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPV---FTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIK 9174
            GYP P I W +D   +      T      G   +T    +  DTGRYTC  TN+  Q S S    ++      +PP   +  +    + G+ +   C VEG     + W    +  +  +     Q+  +   L I   + D +GVY     N+ G  E +  L V   P K     E + T     +  ++C          ++ G P P I W  NG  LS+ +     ++ G+ I   L I+D     +G +TC   N  G      ++ V + P     + P+   T  E S+V     V G P+PT+T+   G+ L+N      ++G+   +R +  N  ++ +D      G  +   +     A + +         +    P  LK++  +T     +  F      +P P++ W  NG  ++      K+ + N    +T+ S  ++ AG   C A+N VG  E    L V+A     KP   V    D +E++  T++   +VEG+   ++ W   G  ++ S R+ I +F+    + I   K +D G  + +A+NS G  + +  L V+  P    F L P +++   G   +    A G P+PT  W  N + ++
Sbjct:  573 GYPLPDITWYKDDVQLHEDERHTFYSDEDGFFAMTIDPVQVTDTGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLRDKECKEGDVIDFECEVEGWPEPELVWLV-DDQPLRPSHDFRLQYDGQTAKLEIRDAQPDDTGVYTVKIQNEFGSIESKAELFVQADPDKNHVAPEFQAT-----IEYVECDEGEEVRFKSVITGDPNPEIIWFINGKPLSESEKVKFISEDGICI---LTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVPPAPPTFNKPLEDKTVQEKSTVVFEVDVSGWPEPTLTFTLCGKELKNGEEGVEIVGHDGFYRISIPNTSMDKHD------GEIVAKAQNEHGTAESRARLTVEQEEEESRSAPTFLKDIEDQTVKTGEFAVFETTVRGNPNPEVTWFINGHKMDQGSPGVKIEAHNHDHKLTIDS--AQYAGTVLCRAENAVGRFETKARLVVLAPEKQKKPPKFVEILVDKTETVDNTVVFEVRVEGEPKPTVTWYLKGEELKQSDRVEIREFDGSIKISIKNIKIEDAGEIRAVATNSEGSDETKAKLTVQKKPFAPEFDLRPVSLTVEKGSEAVFSAHAFGIPLPTYEWSVNGRKVR 1181          

HSP 16 Score: 103.99 bits (258), Expect = 3.027e-21
Identity = 141/607 (23.23%), Postives = 229/607 (37.73%), Query Frame = 1
Query: 3211 GDPKPKIEWRKGGRPLTMEPGLRIVISPDGS-QLTVYSITEEHAGTFTCTATNDH-----AAVVKEFKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPG-RVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKAS------DSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFN---DKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASM--HGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPN---KNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAIN-IGESLNFTLVVLISPTILGKHSS--KSVININEETD--LYITCWSEGNPAPRYLWYKDNSQLISGGRVEIT--NGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFL-KGSTTNLWCNVSGFPTPQIRWT 4944
            G P P I W K    L  +         DG   +T+  +     G +TC ATN++     +A  +  KV  +A P      + D E    + ++  C +  G P P++ W  + QPL      R++  GQ   L++     D+TG Y  K  NE  S     ++ +   P  +       + +  +   EGE++     I G P P   W      L        I+   I    L I  +     G+ TC G+N  GSA     + +   P    FN   +   V   +T+      SG P P + +    K +     G ++VG +    I     SM  H GE    A+NE G  +  + +TV     + ++     K+I    +  G    F   +   P  E+ WF N   + +  P  + +       LT+   ++  +G   C A N +G       +V+++P    K     + +++  E  D  +      EG P P   WY    +L    RVEI   +G   + IK ++  D    +   TN  G D+    + V   P      +R     + KGS      +  G P P   W+
Sbjct:  573 GYPLPDITWYKDDVQLHEDERHTFYSDEDGFFAMTIDPVQVTDTGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLRDKECKEGDVIDFECEV-EGWPEPELVWLVDDQPLRPSHDFRLQYDGQTAKLEIRDAQPDDTGVYTVKIQNEFGSIESKAELFVQADPDKNHVAPEFQATIEYVECDEGEEVRFKSVITGDPNPEIIWFINGKPLSESEKVKFISEDGI--CILTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVPPAPPTFNKPLEDKTVQEKSTVVFEVDVSGWPEPTLTFTLCGKELKNGEEGVEIVGHDGFYRISIPNTSMDKHDGEIVAKAQNEHGTAESRARLTVEQEEEESRSAPTFLKDIEDQTVKTGEFAVFETTVRGNPNPEVTWFINGHKMDQGSPGVKIEAHNHDHKLTIDSAQY--AGTVLCRAENAVGRFETKARLVVLAPEKQKKPPKFVEILVDKTETVDNTVVFEVRVEGEPKPTVTWYLKGEELKQSDRVEIREFDGSIKISIKNIKIEDAGEIRAVATNSEGSDETKAKLTVQKKPFAPEFDLRPVSLTVEKGSEAVFSAHAFGIPLPTYEWS 1174          

HSP 17 Score: 101.293 bits (251), Expect = 1.799e-20
Identity = 136/655 (20.76%), Postives = 256/655 (39.08%), Query Frame = 1
Query: 2923 VCLVVESKPPAVISWLKNGKEIEYSNRIMAKDN-----TLVIKTVKAEDEAIYTCIAKNQVG---TAKFDIELDVQTK---PIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPP---QISKE---GISDYEIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEIPGRVEIAGQKN--ILKVYGKNEDETGSYECKATNEVSS---DSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSW--------KSSILDLQRNPF---GITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILE-------SPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPYIDMKTPN--KNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKI-SLDGSTLTLFEVKHL-DSGIYKCLAINI--GESLNFTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQLISGG------RVEITNGGKTLL 4731
            +CL V   P   I+W K+  ++    R     +      + I  V+  D   YTC+A N+ G   T+ F   L V+ +   P  +   +   + K+GDVI  +C+ +G P+P++ W    +PL      R+      ++L +     +  G +T    N+  ++  + ++ V+A P    ++ E    I   E    E V    +IT G+P+P+I W+ NG+PL E   +V+   +    IL +        G   C+ +N + S   D R  ++ +  AP   +  +     +E   +     + G+P PT  ++         +  +  +  + F    I N+ +DK+D           G       N  G+A+    + + +       +P  ++  +   V             GNP P++ W      +   + G K+   N +  +   +A  + G   C AEN  G+ +  + + V AP    K P   + +      V   + F   +   P   + W+    ++ +S   DR +I   DGS     +   + D+G  + +A N    +     L V   P           + + + ++   +  + G P P Y W  +  ++  G       R E T  G ++L
Sbjct:  567 MCLKVTGYPLPDITWYKDDVQLHEDERHTFYSDEDGFFAMTIDPVQVTDTGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLRD-KECKEGDVIDFECEVEGWPEPELVWLVDDQPLRPSHDFRLQYDGQTAKLEIRDAQPDDTGVYTVKIQNEFGSIESKAELFVQADPDKNHVAPEFQATIEYVECDEGEEVRFKSVIT-GDPNPEIIWFINGKPLSE-SEKVKFISEDGICILTIKDVTRHFDGMVTCQGSNRLGSASCDGR-LKVRVPPAPPTFNKPLEDKTVQEKSTVVFEVDVSGWPEPTLTFTLCGKELKNGEEGVEIVGHDGFYRISIPNTSMDKHD-----------GEIVAKAQNEHGTAESRARLTVEQEEEESRSAPTFLKDIEDQTVKTGEFAVFETTVRGNPNPEVTWFINGHKMDQGSPGVKIEAHNHDHKLTIDSA-QYAGTVLCRAENAVGRFETKARLVVLAPEKQKKPPKFVEILVDKTETVDNTVVFEVRVEGEPKPTVTWYLKGEELKQS---DRVEIREFDGSIKISIKNIKIEDAGEIRAVATNSEGSDETKAKLTVQKKPFAPEFDLRPVSLTVEKGSEAVFSAHAFGIPLPTYEWSVNGRKVRDGQEGARVTRDESTVDGASIL 1202          

HSP 18 Score: 99.3673 bits (246), Expect = 7.780e-20
Identity = 151/647 (23.34%), Postives = 250/647 (38.64%), Query Frame = 1
Query: 4876 LKGSTTNLWCNVSGFPTPQIRWTYMETIXXXXXX-----XXXXQLHFMNVDKSHIT---RYTCIATNEAGSAR-KLFDPVL-----TYPPKIVSLDPDKKRWILKDGE-LRLSCNSDAAPVATIEWFKDGELIR--NNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPP-----SIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRI-DFRRV-LLSDDGY-HLTVNSTMETDAGRYQCIAENTHGQTDISFDVQVTYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITW------LKDGIP----INRLPSYRYRIIGNS---KQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRV--------RTPPEFDTSNVEPKVNWFTNQTRSLECTLMG----VADPPAKITWERHGVPLSSGGSIRISP-DGTRITVENVKQY-DAGEYKCHAQN----EVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLW 6648
            L+ S+  +   V+G+P P I W Y + +           S+      M +D   +T   RYTC+ATNE G A    F  VL       PP  V+   DK+    K+G+ +   C  +  P   + W  D + +R  ++ R+    +  +L + +AQ  D G+Y   + N+ G  +    + +   P     + +F +     +   G  +    V  G P P+I W  +G  + +  +V  +S+DG   LT+        G   C   N  G       ++V   P      K           TVV E  VSG P P +T+      LK+G      +     YR  I   S      EI+A   ++ G     A+ T  Q E   + +  AP  +   + + +  +K G+         G+PNP + +F +G+ +D          S   ++        LT+ SA+   +G   C A NA+G    E   R+        + PP+F        V    ++T +++ T++       +P   +TW   G  L     + I   DG+        +  DAGE +  A N    + +K  L    + F  P F    +   +E  + +    S    G P PT  W
Sbjct:  560 LQESSAKMCLKVTGYPLPDITW-YKDDVQLHEDERHTFYSDEDGFFAMTIDPVQVTDTGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLRDKE---CKEGDVIDFECEVEGWPEPELVWLVDDQPLRPSHDFRLQYDGQTAKLEIRDAQPDDTGVYTVKIQNEFGSIESKAELFVQADPDKNHVAPEFQATIEYVECDEGEEVRFKSVITGDPNPEIIWFINGKPLSESEKVKFISEDGICILTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVPPAPPTFNKPLEDKTVQEKSTVVFEVDVSGWPEPTLTFTLCGKELKNGEEGVEIVGHDGFYRISIPNTSMDKHDGEIVAKAQNEHGTAESRARLTVEQEE---EESRSAPTFL---KDIEDQTVKTGEFAVFETTVRGNPNPEVTWFINGHKMDQ--------GSPGVKIEAHNHDHKLTIDSAQY--AGTVLCRAENAVGR--FETKARLVVLAPEKQKKPPKF--------VEILVDKTETVDNTVVFEVRVEGEPKPTVTWYLKGEELKQSDRVEIREFDGSIKISIKNIKIEDAGEIRAVATNSEGSDETKAKLTVQKKPFA-PEFDLRPVSLTVE--KGSEAVFSAHAFGIPLPTYEW 1173          

HSP 19 Score: 97.4413 bits (241), Expect = 2.776e-19
Identity = 116/522 (22.22%), Postives = 214/522 (41.00%), Query Frame = 1
Query: 2368 TGVPQPKITWEFNGSPVTIDGNIII---NETIGTLDINRIEKNMKGQWVCVATNSAGSSRKS-----FNLDIGFGPRIKDFVTNI---DGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDNS---LIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISG-----IAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSNRI--MAKDN--TLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTFID--AKDGDVIVLQCQTKGDPKPKIEWRKGGRPL-TMEPGLRIVISPDGSQLTVYSIT-EEHAGTFTCTATNDHAAVVKEFKVSVKAPPQISKEG---ISDYEIGSKENVELNCIITS--GNPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASD-SKMIKIYTKEGE----KLTLNCKIDGFPTPTKKWSWKSSIL 3822
            TG P P ITW  +   +  D         +    + I+ ++    G++ C+ATN  G +  S       ++    P    FVT +   +   G+ I   C+VEG P P + WL       + P+     + +  D     L I+    +D   Y    QN+ G ++   ++ +         AP+  F  + + V     ++V    V+   P   I W  NGK +  S ++  +++D    L IK V    + + TC   N++G+A  D  L V+  P      K   D   ++   +V +    G P+P + +   G+ L   E G+ IV      ++++ + + ++H G     A N+H       +++V+   + S+     + D E  + +  E     T+  GNP+P++ W+ NG  + +    V+I    +  K+   +    G+  C+A N V       ++ +L   K     K ++I   + E     +    +++G P PT  W  K   L
Sbjct:  572 TGYPLPDITWYKDDVQLHEDERHTFYSDEDGFFAMTIDPVQVTDTGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPA--FVTKLRDKECKEGDVIDFECEVEGWPEPELVWLVD-----DQPLRPSHDFRLQYDGQTAKLEIRDAQPDDTGVYTVKIQNEFGSIESKAELFVQADPDKNHVAPE--FQATIEYVECDEGEEVRFKSVITGDPNPEIIWFINGKPLSESEKVKFISEDGICILTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVPPAPPTFNKPLEDKTVQEKSTVVFEVDVSGWPEPTLTFTLCGKELKNGEEGVEIVGHDGFYRISIPNTSMDKHDGEIVAKAQNEHGTAESRARLTVEQEEEESRSAPTFLKDIEDQTVKTGEFAVFETTVRGNPNPEVTWFINGHKMDQGSPGVKIEAHNHDHKLTIDSAQYAGTVLCRAENAVGRFETKARLVVLAPEKQKKPPKFVEILVDKTETVDNTVVFEVRVEGEPKPTVTWYLKGEEL 1084          

HSP 20 Score: 93.9745 bits (232), Expect = 3.533e-18
Identity = 136/583 (23.33%), Postives = 231/583 (39.62%), Query Frame = 1
Query: 1927 SDNGEYVCVAEHEGGVSEAVGFI------KTHTLPAASVDEKEISFIDNDSITASCRALSTPPPTFSWFLNGRELDPT-DPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLP--KILSLDLAKEIPL----EGDQQTVRCSATGVPQPKITWEFNGSPVTIDGNI--IINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNI-DGSYGENITI--RCQVEGQPPPRV------KWLRGIAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYI-CDAQNQHGKVQESVQIRIS-----GIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEIEYSN---RIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDV-----QTKPI----IIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSV-KAP--PQISKEGIS-DYEIGSKENVELNCIITSGNPSPKIEWYKNGQ 3537
            +D G Y C+A +E G +    F       K    PA     ++    + D I   C     P P   W ++ + L P+ D R+    D Q ++++I + +P D+G    K +N  G  E + +L   + P    ++ +    I      EG++   +   TG P P+I W  NG P++    +  I  + I  L I  + ++  G   C  +N  GS+     L +   P    F   + D +  E  T+     V G P P +      K L+   G   + I   D ++      + I   SM+     I   AQN+HG  +   ++ +        +AP        Q V   T +  +    V   P   ++W  NG +++  +   +I A ++   +    A+      C A+N VG  +    L V     Q KP     I+ D    +D    + +V + + +G+PKP + W   G  L     + I       ++++ +I  E AG     ATN   +   + K++V K P  P+     +S   E GS+     +     G P P  EW  NG+
Sbjct:  614 TDTGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLRDKECKEGDVIDFECEVEGWPEPELVWLVDDQPLRPSHDFRLQY--DGQTAKLEIRDAQPDDTGVYTVKIQNEFGSIESKAELFVQADPDKNHVAPEFQATIEYVECDEGEEVRFKSVITGDPNPEIIWFINGKPLSESEKVKFISEDGICILTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVPPAPPTFNKPLEDKTVQEKSTVVFEVDVSGWPEPTLTFTLCGKELKN--GEEGVEIVGHDGFY-----RISIPNTSMDKHDGEIVAKAQNEHGTAESRARLTVEQEEEESRSAPTFLKDIEDQTV--KTGEFAVFETTVRGNPNPEVTWFINGHKMDQGSPGVKIEAHNHDHKLTIDSAQYAGTVLCRAENAVGRFETKARLVVLAPEKQKKPPKFVEILVDKTETVD----NTVVFEVRVEGEPKPTVTWYLKGEELKQSDRVEIREFDGSIKISIKNIKIEDAGEIRAVATNSEGSDETKAKLTVQKKPFAPEFDLRPVSLTVEKGSEAVFSAHAF---GIPLPTYEWSVNGR 1178          

HSP 21 Score: 80.1073 bits (196), Expect = 5.425e-14
Identity = 119/547 (21.76%), Postives = 216/547 (39.49%), Query Frame = 1
Query: 7831 YQFLSEQ----GLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVL-----VQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTD--SGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVE-------LLPKVSLPIS-VTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEI---NIYDLKPEDTGNYICIGE-RSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESK------LNSNGRGSITL-QSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPR----VRVYQSDDPSESIKR---TILMCKVEGKVD-SIVWLKNGVIVQNSS-----RLYINDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLV------KSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWY-KNKKLIKYDFVKSLIKNG--SLRIIGVQKEHSGVYFCVASSNQGEVHSQPIYLTVQ 9315
            + F S++     + ID V+   +G Y C+A N+ G         VL       P  F     +       V+  +C++ EG P+P + W  +   L    ++    D  +        + +D G  T   +N  G      ++ V+       + P+    I  V  DEG  V     + G P P + W  +G+ L      + +F SE+ I    I D+     G   C G  R G+ +      + +   P    KP     VQE     F  + +  P+P + +   G+ +++       +  +G   I++  +   ++ GE    A+N  G+ E    L V  +         +  D   +++K     +    V G  +  + W  NG  +   S       + +D  L I+ A+    G   C A N+ G  + +  L+V      K PP F  +  + +  +   ++     EG P PT++WY K ++L + D V+    +G   + I  ++ E +G    VA++++G   ++   LTVQ
Sbjct:  594 HTFYSDEDGFFAMTIDPVQVTDTGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLRDKECKEGDVIDFECEV-EGWPEPELVWLVDDQPLRPSHDFRLQYDGQTAKLEIRDAQPDDTGVYTVKIQNEFGSIESKAELFVQADPDKNHVAPEFQATIEYVECDEGEEVRFKSVITGDPNPEIIWFINGKPLSE--SEKVKFISEDGICILTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVPPAPPTFNKPLEDKTVQEKSTVVFEVDVSGWPEPTLTFTLCGKELKNGEEGVEIVGHDGFYRISIPNTSMDKHDGEIVAKAQNEHGTAESRARLTVEQEEEESRSAPTFLKDIEDQTVKTGEFAVFETTVRGNPNPEVTWFINGHKMDQGSPGVKIEAHNHDHKLTIDSAQY--AGTVLCRAENAVGRFETKARLVVLAPEKQKKPPKFVEILVDKTETVDNTVVFEVRVEGEPKPTVTWYLKGEELKQSDRVEIREFDGSIKISIKNIKIEDAGEIRAVATNSEGSDETK-AKLTVQ 1134          

HSP 22 Score: 68.9366 bits (167), Expect = 1.099e-10
Identity = 47/153 (30.72%), Postives = 76/153 (49.67%), Query Frame = 1
Query: 8602 PKPDIKWMFNGRAIES-------KLNSNGRGSITLQ--SVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTILMCKVEGK-VDSIVWLKNGVIVQNSSRL-YIND----FNLIINQAKSKDTGIYQCIASNSAGEA 9015
            P PDIKW F G  I++       K+ + G    TL       EN G+Y+C AKN  G  + + M+++  +P       +    S +   +  +V+G+    + W+K    +  SSR+ ++ D     +LIIN    +D+GIY C+A N AG+A
Sbjct: 5864 PDPDIKWKFRGWDIDTSSPTSKCKVYTYGGSETTLAITGFSKENVGQYQCFAKNDYGDAQQNIMVDLATRPNFIQPLVNKTFSSAQPMRMDVRVDGEPFPELKWMKEWRPIVESSRIKFVQDGPYLCSLIINDPMWRDSGIYSCVAVNDAGQA 6016          

HSP 23 Score: 61.2326 bits (147), Expect = 2.551e-8
Identity = 48/182 (26.37%), Postives = 74/182 (40.66%), Query Frame = 1
Query: 2335 EGDQQTVRCSATGVPQPKITWEFNG------SPVTIDGNIIINETIGTLDINRIEKNMKGQWVCVATNSAGSSRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGQPPPRVKWLRGIAGGYNIPIALGDRYFINQDN----SLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISG 2850
            E D  T+  + +G P P I W+F G      SP +         +  TL I    K   GQ+ C A N  G ++++  +D+   P     + N   S  + + +  +V+G+P P +KW++        PI    R    QD     SLII      D   Y C A N  G+   S  + +  
Sbjct: 5850 ENDTLTIVLNVSGFPDPDIKWKFRGWDIDTSSPTSKCKVYTYGGSETTLAITGFSKENVGQYQCFAKNDYGDAQQNIMVDLATRPNFIQPLVNKTFSSAQPMRMDVRVDGEPFPELKWMKEWR-----PIVESSRIKFVQDGPYLCSLIINDPMWRDSGIYSCVAVNDAGQATTSCTVTVEA 6026          

HSP 24 Score: 59.6918 bits (143), Expect = 6.457e-8
Identity = 56/215 (26.05%), Postives = 89/215 (41.40%), Query Frame = 1
Query: 3694 APKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDK----------NDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVVFIDNTITLTCIASGNPTPKIKWLFK-KKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAP--YIDMKTPNKNIT 4299
            AP  S   + K Y  E + LT+   + GFP P  KW ++   +D        T+SP  K            L IT    E  G Y C   N  G A+ +  V +   P  IQ            + +     G P P++KW+ + + ++  + + +   G    +LI+        G YSC+A N+ G+   +  VTV A   Y D++ P + +T
Sbjct: 5835 APWFSPGVVEKRYCAENDTLTIVLNVSGFPDPDIKWKFRGWDID--------TSSPTSKCKVYTYGGSETTLAITGFSKENVGQYQCFAKNDYGDAQQNIMVDLATRPNFIQPLVNKTFSSAQPMRMDVRVDGEPFPELKWMKEWRPIVESSRIKFVQDGPYLCSLIINDPMWRDSGIYSCVAVNDAGQATTSCTVTVEAEGDYNDVELPRRRVT 6041          

HSP 25 Score: 58.151 bits (139), Expect = 2.323e-7
Identity = 44/166 (26.51%), Postives = 74/166 (44.58%), Query Frame = 1
Query: 8845 MC-KVEG-KVDSIVWLKNGVIVQNSSR--LYIND---FNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLV------KSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWYKNKKLIK--YDF-VKSLIKNGSLRIIGVQKEHSGVYFCVASSNQGEVHSQ 9294
            MC KV G  +  I W K+ V +    R   Y ++   F + I+  +  DTG Y C+A+N  G+A       V       +PP F     +     G+V+   C  EG+P P + W  + + ++  +DF ++   +   L I   Q + +GVY     +  G + S+
Sbjct:  567 MCLKVTGYPLPDITWYKDDVQLHEDERHTFYSDEDGFFAMTIDPVQVTDTGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLRDKECKEGDVIDFECEVEGWPEPELVWLVDDQPLRPSHDFRLQYDGQTAKLEIRDAQPDDTGVYTVKIQNEFGSIESK 732          

HSP 26 Score: 57.7658 bits (138), Expect = 2.985e-7
Identity = 61/256 (23.83%), Postives = 99/256 (38.67%), Query Frame = 1
Query: 8593 TSHPKPDIKWMFNGRAIESK------LNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVI------AKPRVRVYQSDDPSESIKRTILMCKVEGKVD-SIVWLKNGVIVQNSSRLYI----NDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANL-------GEVLILPCAAEGYPIPTISWYKN-KKLIKYDFVKSLIKNG--SLRIIGVQKEHSGVYFCVASSNQG 9279
            T +P PDI W  +   +          + +G  ++T+  V+  + G Y C+A N  G    S    V+      A P       D   +        C+VEG  +  +VWL +   ++ S    +        L I  A+  DTG+Y     N  G  + +  L V++ P    +     A +       GE +       G P P I W+ N K L + + VK + ++G   L I  V +   G+  C  S+  G
Sbjct:  572 TGYPLPDITWYKDDVQLHEDERHTFYSDEDGFFAMTIDPVQVTDTGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLRDKECKEGDVIDFECEVEGWPEPELVWLVDDQPLRPSHDFRLQYDGQTAKLEIRDAQPDDTGVYTVKIQNEFGSIESKAELFVQADPDKNHVAPEFQATIEYVECDEGEEVRFKSVITGDPNPEIIWFINGKPLSESEKVKFISEDGICILTIKDVTRHFDGMVTCQGSNRLG 827          

HSP 27 S