DNA-directed RNA polymerase subunit

Overview
NameDNA-directed RNA polymerase subunit
Smed IDSMED30020370
Length (bp)6202
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA-directed RNA polymerase subunit (SMED30020370) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA-directed RNA polymerase subunit (SMED30020370) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA-directed RNA polymerase subunit (SMED30020370) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA-directed RNA polymerase subunit (SMED30020370) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020370

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30020370h1SMcG0020592 SmedASXL_061233SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30020370h1SMcG0020592 SmedASXL_006325SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30020370h1SMcG0020592 SmedASXL_006325SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30020370h1SMcG0020592 dd_Smed_v4_1965_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020370h1SMcG0020592 dd_Smed_v4_1965_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020370h1SMcG0020592 dd_Smed_v4_1965_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020370h1SMcG0020592 dd_Smed_v4_1965_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020370h1SMcG0020592 dd_Smed_v4_1965_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Human
Match: POLR2A (RNA polymerase II subunit A [Source:HGNC Symbol;Acc:HGNC:9187])

HSP 1 Score: 1230.31 bits (3182), Expect = 0.000e+0
Identity = 592/897 (66.00%), Postives = 716/897 (79.82%), Query Frame = 3
Query:   54 SVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDRDEMDLK------------TQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQPLRAYQ-VLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
            + PLR +KRVQFG+LS  E+KR+SV  E GI Y E T+ G+PK  GLMDPRQG  ++   CQTC G++ ECPGHFGHI LA+PVFH+GF  K +K+LR VCF CSKLL D N+  +K+IL K++  P+KR   +YD C+   +C       +EMD K            T+E    GCG  QP  RR+GLE +   K  + DS  K+ L + + V EIF+RI++E+C ++G  P+Y+RPE MI+TVL VPPL+VRPAVVM  + ++ DDLTHKL ++VK+NN++R  E+NG A+ ++ E    LQ+HVAT +DNE P LP A+QKSGRPLK+LKQRLKGK GR+R NLMGKR D+SARTVIT DPNL++DQVGVPR IA N+TF E VTPFN   LQ+LV+ G + YPGA ++IR+NGDRIDL+  P  SD+ LQ G  VERHM + D V+FNRQPTLHKMSMM HRV++LP+STFRLNLSVT+PYNADFDGDEMNLHLPQSLET+AE+ +LA V ++I+TPQSN+PVM IVQDTLTA  K T RDVFL R EVM+LLM+L TW+G++P+PAI KP  LWTGKQIFSLIIPG +NCIRTHSTHP+ E++GPYK ISPGDTKV++E+GELI GILCKK+LG+SAGSL+HI  LE   D    F++N+QTV+NNWLLIEGHTIGI D++ D+KT ++I+ TI +AK+ V E I+KAHN EL+ TPGNTLRQTFE  VN+ILNDARDKTGS AQKSLS+YNNF  MV+SGAKGSKINISQVIA VGQQNVEGKRIPFGF+ RTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIK+MESVM+KYD+TVRN I+Q++Q RYGEDGL G  VEF
Sbjct:   12 ACPLRTIKRVQFGVLSPDELKRMSVT-EGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICE----GGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEF 903          

HSP 2 Score: 705.286 bits (1819), Expect = 0.000e+0
Identity = 375/729 (51.44%), Postives = 497/729 (68.18%), Query Frame = 2
Query: 2645 SIDSVPIRRGWARWGICG----IQSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETG-GRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNL-NLVLRIXXXXXXXXXXXXXXXXXXXX----YLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALP-----MMSGVAHNLYMVGGATPMNSASPQLTPWTTLSSPY--TFSPKPNS----FGASFSPIAHSEI-GMSPNPALAFSP--------------MMSPKTPMDYGFGRYSPSMNPISPAG 4723
            SI+ V ++  +   G+ G     Q+L T KP+   FEK+FRFD +NE  L R L E  V+++ + A    +L+ E++++ +DRE++R I    TG  +VVLPCN+ R++ N QKIF I+    +D+ P+ ++E V+ L   L++V GDD +S+ A ENATLLF   +RS LC +++ +E+RLS EAFDW+LGEI+++FNQ++  PGEMVGALAA+SLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKE+IN+S+ PKTPSLTVFL G +A+DAE AK I  RLEHTTLRK+   + IYYDP P+S+V+  D+EWV  YYE+PDFD+ + SP+LLR+ L RK MTD+KLT++ IAEKI   F +D+ C   DDN   LVLRIR++  ++ K  E+ E+ D+     +L  +E+ +L ++ LQGI QISKVY+H P+TD+KKKI+I  DG F+   EWILETDG  L +VL+E+DVD   T SN I EIF   GIEA R A+ERE++HVISFDGSYVNYRHLALLC+ MT +G LM+I RHG+NRQ+TG L + SFEETVD+LMEA AH E DPMKGVSE+IMLGQLA  GTGCFD+L++ EKC     +P     + +     ++     +PM   SP +TPW   ++P    +SP   S      A FSP A S+  G SP  + A+SP              + SP   M   +   SP+  P SP G
Sbjct:  882 SINQV-VQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFP--TGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGG 1607          

HSP 3 Score: 61.6178 bits (148), Expect = 2.006e-8
Identity = 36/80 (45.00%), Postives = 47/80 (58.75%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYS-GNMSYSPTSPQYSPATSGYVANSPSY------GQQNTNSNSGYSPQSP 5695
            Y+PTSP +SP+   Y+P SP T    SPVY+  +  YSPTSP YSP +  Y   SP+Y      G   + ++ GYSP SP
Sbjct: 1874 YSPTSPTYSPTTPKYSPTSP-TYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSP 1952          

HSP 4 Score: 54.299 bits (129), Expect = 3.626e-6
Identity = 32/74 (43.24%), Postives = 45/74 (60.81%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYS-GNMSYSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP 5695
            Y+PTSP +SP+   Y+P SP T    +P YS  + +YSPTSP Y+P +  Y   SP+Y    + ++  YSP SP
Sbjct: 1860 YSPTSPKYSPTSPKYSPTSP-TYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTY----SPTSPKYSPTSP 1928          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Human
Match: POLR2A (RNA polymerase II subunit A [Source:HGNC Symbol;Acc:HGNC:9187])

HSP 1 Score: 1230.31 bits (3182), Expect = 0.000e+0
Identity = 592/897 (66.00%), Postives = 716/897 (79.82%), Query Frame = 3
Query:   54 SVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDRDEMDLK------------TQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQPLRAYQ-VLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
            + PLR +KRVQFG+LS  E+KR+SV  E GI Y E T+ G+PK  GLMDPRQG  ++   CQTC G++ ECPGHFGHI LA+PVFH+GF  K +K+LR VCF CSKLL D N+  +K+IL K++  P+KR   +YD C+   +C       +EMD K            T+E    GCG  QP  RR+GLE +   K  + DS  K+ L + + V EIF+RI++E+C ++G  P+Y+RPE MI+TVL VPPL+VRPAVVM  + ++ DDLTHKL ++VK+NN++R  E+NG A+ ++ E    LQ+HVAT +DNE P LP A+QKSGRPLK+LKQRLKGK GR+R NLMGKR D+SARTVIT DPNL++DQVGVPR IA N+TF E VTPFN   LQ+LV+ G + YPGA ++IR+NGDRIDL+  P  SD+ LQ G  VERHM + D V+FNRQPTLHKMSMM HRV++LP+STFRLNLSVT+PYNADFDGDEMNLHLPQSLET+AE+ +LA V ++I+TPQSN+PVM IVQDTLTA  K T RDVFL R EVM+LLM+L TW+G++P+PAI KP  LWTGKQIFSLIIPG +NCIRTHSTHP+ E++GPYK ISPGDTKV++E+GELI GILCKK+LG+SAGSL+HI  LE   D    F++N+QTV+NNWLLIEGHTIGI D++ D+KT ++I+ TI +AK+ V E I+KAHN EL+ TPGNTLRQTFE  VN+ILNDARDKTGS AQKSLS+YNNF  MV+SGAKGSKINISQVIA VGQQNVEGKRIPFGF+ RTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIK+MESVM+KYD+TVRN I+Q++Q RYGEDGL G  VEF
Sbjct:   12 ACPLRTIKRVQFGVLSPDELKRMSVT-EGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICE----GGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEF 903          

HSP 2 Score: 705.286 bits (1819), Expect = 0.000e+0
Identity = 375/729 (51.44%), Postives = 497/729 (68.18%), Query Frame = 2
Query: 2645 SIDSVPIRRGWARWGICG----IQSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETG-GRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNL-NLVLRIXXXXXXXXXXXXXXXXXXXX----YLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALP-----MMSGVAHNLYMVGGATPMNSASPQLTPWTTLSSPY--TFSPKPNS----FGASFSPIAHSEI-GMSPNPALAFSP--------------MMSPKTPMDYGFGRYSPSMNPISPAG 4723
            SI+ V ++  +   G+ G     Q+L T KP+   FEK+FRFD +NE  L R L E  V+++ + A    +L+ E++++ +DRE++R I    TG  +VVLPCN+ R++ N QKIF I+    +D+ P+ ++E V+ L   L++V GDD +S+ A ENATLLF   +RS LC +++ +E+RLS EAFDW+LGEI+++FNQ++  PGEMVGALAA+SLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKE+IN+S+ PKTPSLTVFL G +A+DAE AK I  RLEHTTLRK+   + IYYDP P+S+V+  D+EWV  YYE+PDFD+ + SP+LLR+ L RK MTD+KLT++ IAEKI   F +D+ C   DDN   LVLRIR++  ++ K  E+ E+ D+     +L  +E+ +L ++ LQGI QISKVY+H P+TD+KKKI+I  DG F+   EWILETDG  L +VL+E+DVD   T SN I EIF   GIEA R A+ERE++HVISFDGSYVNYRHLALLC+ MT +G LM+I RHG+NRQ+TG L + SFEETVD+LMEA AH E DPMKGVSE+IMLGQLA  GTGCFD+L++ EKC     +P     + +     ++     +PM   SP +TPW   ++P    +SP   S      A FSP A S+  G SP  + A+SP              + SP   M   +   SP+  P SP G
Sbjct:  882 SINQV-VQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFP--TGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGG 1607          

HSP 3 Score: 61.6178 bits (148), Expect = 2.006e-8
Identity = 36/80 (45.00%), Postives = 47/80 (58.75%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYS-GNMSYSPTSPQYSPATSGYVANSPSY------GQQNTNSNSGYSPQSP 5695
            Y+PTSP +SP+   Y+P SP T    SPVY+  +  YSPTSP YSP +  Y   SP+Y      G   + ++ GYSP SP
Sbjct: 1874 YSPTSPTYSPTTPKYSPTSP-TYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSP 1952          

HSP 4 Score: 54.299 bits (129), Expect = 3.626e-6
Identity = 32/74 (43.24%), Postives = 45/74 (60.81%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYS-GNMSYSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP 5695
            Y+PTSP +SP+   Y+P SP T    +P YS  + +YSPTSP Y+P +  Y   SP+Y    + ++  YSP SP
Sbjct: 1860 YSPTSPKYSPTSPKYSPTSP-TYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTY----SPTSPKYSPTSP 1928          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Human
Match: POLR2A (RNA polymerase II subunit A [Source:HGNC Symbol;Acc:HGNC:9187])

HSP 1 Score: 665.226 bits (1715), Expect = 0.000e+0
Identity = 326/552 (59.06%), Postives = 410/552 (74.28%), Query Frame = 3
Query:   54 SVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDRDEMDLK------------TQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQPLRA-YQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRA 1667
            + PLR +KRVQFG+LS  E+KR+SV  E GI Y E T+ G+PK  GLMDPRQG  ++   CQTC G++ ECPGHFGHI LA+PVFH+GF  K +K+LR VCF CSKLL D N+  +K+IL K++  P+KR   +YD C+   +C       +EMD K            T+E    GCG  QP  RR+GLE +   K  + DS  K+ L +  +V EIF+RI++E+C ++G  P+Y+RPE MI+TVL VPPL+VRPAVVM  + ++ DDLTHKL ++VK+NN++R  E+NG A+ ++ E    LQ+HVAT +DNE P LP A+QKSGRPLK+LKQRLKGK GR+R NLMGKR D+SARTVIT DPNL++DQVGVPR IA N+TF E VTPFN   LQ+LV+ G + YPGA ++IR+NGDRIDL+  P  SD+ LQ G  VERHM + D V+FNRQPTLHKMSMM HRV++LP+STFRLNLSVT+PYNADFDGDEMNLHLPQSLET+AE+ +LA V ++I+TPQSN+PVM IVQDTLTA  K T RDVFL R 
Sbjct:   12 ACPLRTIKRVQFGVLSPDELKRMSVT-EGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICE----GGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERV 558          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Human
Match: POLR3A (RNA polymerase III subunit A [Source:HGNC Symbol;Acc:HGNC:30074])

HSP 1 Score: 597.43 bits (1539), Expect = 0.000e+0
Identity = 347/906 (38.30%), Postives = 529/906 (58.39%), Query Frame = 3
Query:   66 REVKRVQFGILSASEIKR---LSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSK-LLADVNSSNVKEILKK---TEINPRKRFDFMYDECRRNKVC---SVPNSDRDEMDLK--TQEMSRSGCGYVQPIFRRNGLEYFVTL-----KXXXXXXXXKQPLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMN-HTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKRRPDSSDI--QLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNG-----RLPKPAIYKPLRLWTGKQIFSLII-PGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGS-SAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVE 2699
            +++  + FG+ S  E+++   + VV +N  +Y++  Q   P   G++D R G  +K   C+TCG ++A+C GH+G+I+L  P FH+G+   +I IL+ +C  C   +L+        + LK+   T +  R     + D+CR+  +C      N    +  L     E  ++    V PI   N L+ F T      + +     +++ L    VL +F+RI  ED  L+  NP+  +P  +I+T L VPPL +RP+VV +  +G + DDLT KLTE++ +N+ I+    +G  + +++E  + LQ   A +I++E   +P  +    +  +   QRLKGK GR R NL GKR D+S RTVI+ DPNL +D+V VP  +A+ LTFPEKV   N ++L++LV+NG  ++PGA F+ + +       +  +   +  +L+YG+ VERH+++ D V+FNRQP+LHK+S+M H  +V P  TFR N  V +PYNADFDGDEMNLHLPQ+ E KAE   L      ++TP++ +P+++ +QD LT    +T +D F +RA+   ++  +          RLP P I KP+ LWTGKQIFS+I+ P   N +R +      +  G  + +   D+ V I++ EL+SG + K TLGS S  ++ +I+  +   +EA    + +  +   +L   G +IGI D        +   + ++   +   E I+  +  +LQ  PG T  +T E  + K L+  RD  GS   + L K N+   M + G+KGS INISQ+IACVGQQ + G R+P GF+ R+LPHF K    P ++GFV NS+ +GLTPTEFFFH M GREGL+DTAVKTAETGY+QRRL+K++E +  +YD TVR+    +IQF YG DGLD A +E
Sbjct:   13 KKISHICFGMKSPEEMRQQAHIQVVSKN--LYSQDNQHA-PLLYGVLDHRMGTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHIMLSQEEKKQFLDYLKRPGLTYLQKRGLKKKISDKCRKKNICHHCGAFNGTVKKCGLLKIIHEKYKTNKKVVDPIVS-NFLQSFETAIEHNKEVEPLLGRAQENLNPLVVLNLFKRIPAEDVPLLLMNPEAGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRISGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPK-KWTRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANINFLRKLVQNGPEVHPGANFIQQRHTQMKRFLKYGNREKMAQELKYGDIVERHLIDGDVVLFNRQPSLHKLSIMAHLARVKPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIAAIQDFLTGAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPTILKPVTLWTGKQIFSVILRPSDDNPVRANLRTKGKQYCGKGEDLCANDSYVTIQNSELMSGSMDKGTLGSGSKNNIFYILLRDWGQNEAADAMSRLARLAPVYLSNRGFSIGIGDVTPGQGLLKAKYELLNAGYKKCDEYIEALNTGKLQQQPGCTAEETLEALILKELSVIRDHAGSACLRELDKSNSPLTMALCGSKGSFINISQMIACVGQQAISGSRVPDGFENRSLPHFEKHSKLPAAKGFVANSFYSGLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSTGDIIQFIYGGDGLDPAAME 913          

HSP 2 Score: 183.726 bits (465), Expect = 1.022e-45
Identity = 125/416 (30.05%), Postives = 211/416 (50.72%), Query Frame = 2
Query: 3170 RLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLNLVLRIXXXXXXXXXXXXXXXXXXXXYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEK 4417
            R++P   +  L   + ++ ++ ++PG  VGAL A+S+GEP TQMTL TFH+AGV++ N+TLGVPR+KEIIN S+   TP +T  L  +   DA+ A+ +  R+E T L +++   E  + P+    +++   E +R    L   +++ ++   +R  +   K+  K   +    E +        +C  P +N                           Y+       L ++ +QGIP++S+  IH    D++            GK ++ L  +G  L+ V+A   V    T SN+  E+ +T GIEAAR  I  E+ + +   G  ++ RH+ LL ++MT+KG ++ I R G+ + +   L  +SFE+T D L +A    + D + GVSE I++G    IGTG F +L   ++
Sbjct: 1005 RITPTQVEKFLETCRDKYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKAISTPIITAQL--DKDDDADYARLVKGRIEKTLLGEISEYIEEVFLPDDCFILVKLSLERIR----LLRLEVNAET---VRYSICTSKLRVKPGDVAVHGEAV--------VCVTPREN---------------------SKSSMYYVLQFLKEDLPKVVVQGIPEVSRAVIH---IDEQ-----------SGKEKYKLLVEGDNLRAVMATHGVKGTRTTSNNTYEVEKTLGIEAARTTIINEIQYTMVNHGMSIDRRHVMLLSDLMTYKGEVLGITRFGLAKMKESVLMLASFEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADR 1368          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Human
Match: POLR1A (RNA polymerase I subunit A [Source:HGNC Symbol;Acc:HGNC:17264])

HSP 1 Score: 345.125 bits (884), Expect = 2.046e-95
Identity = 216/626 (34.50%), Postives = 324/626 (51.76%), Query Frame = 3
Query: 1011 LKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDR-----IDLKRR---------PDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFS-TFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMY-LPTWNGR--LPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYK-----------WIS------PG-------DTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWL-LIEGHTIGIVDALY----DAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPG--------------NTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
            ++Q L+ K G  R ++MGKR DY+AR+VI  D  +N +++G+P + A  LT+P+ VTP+N   L+Q V NG  ++PGA+ VI E+G R     +D+ +R         P +   + Q  + V RH+ N D ++ NRQPTLH+ S+  HR ++LP     RL+ +    YNADFDGDEMN H PQS   +AE   LA   +  + P+  +P+  ++QD + +   MTTR  F  R   M L+   L    GR  L  P+I KP  LWTGKQ+ S ++   +N I        PE++ P             W+       PG       +++V+I +GEL+ G+L K   GSSA  L+H        + +G     +  +   +L L  G T+G+ D L     D K +  I+++     +AV   ++           G              N +   F+  VN   N+                N+  +MV SGAKGS +N  Q+   +GQ  +EG+R P     ++LP F   ++ P + GFV   +L G+ P EFFFH M GREGL+DTAVKT+ +GY+QR +IK +E ++++YD TVR+    ++QF YGEDGLD    +F
Sbjct:  417 IRQILEKKEGLFRKHMMGKRVDYAARSVICPDMYINTNEIGIPMVFATKLTYPQPVTPWNVQELRQAVINGPNVHPGASMVINEDGSRTALSAVDMTQREAVAKQLLTPATGAPKPQGTKIVCRHVKNGDILLLNRQPTLHRPSIQAHRARILPEEKVLRLHYANCKAYNADFDGDEMNAHFPQSELGRAEAYVLACTDQQYLVPKDGQPLAGLIQDHMVSGASMTTRGCFFTREHYMELVYRGLTDKVGRVKLLSPSILKPFPLWTGKQVVSTLL---INII--------PEDHIPLNLSGKAKITGKAWVKETPRSVPGFNPDSMCESQVIIREGELLCGVLDKAHYGSSAYGLVHCCYEIYGGETSGKVLTCLARLFTAYLQLYRGFTLGVEDILVKPKADVKRQRIIEESTHCGPQAVRAALNLPEAASYDEVRGKWQDAHLGKDQRDFNMIDLKFKEEVNHYSNEINKACMPFGLHRQFPENSLQMMVQSGAKGSTVNTMQISCLLGQIELEGRRPPLMASGKSLPCFEPYEFTPRAGGFVTGRFLTGIKPPEFFFHCMAGREGLVDTAVKTSRSGYLQRCIIKHLEGLVVQYDLTVRDSDGSVVQFLYGEDGLDIPKTQF 1031          

HSP 2 Score: 92.4337 bits (228), Expect = 9.506e-18
Identity = 52/119 (43.70%), Postives = 77/119 (64.71%), Query Frame = 2
Query: 3167 YRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINV-SRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEI 3520
            Y  S  + D +   ++ ++ +SL +PGE VG LAA+S+GEP+TQMTLNTFH+AG    NVTLG+PRL+EI+ V S N KTP ++V +  N  K  +  KS+  +L    L ++  K ++
Sbjct: 1182 YEKSELSLDRLRTLLQLKWQRSLCEPGEAVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILMVASANIKTPMMSVPVL-NTKKALKRVKSLKKQLTRVCLGEVLQKIDV 1299          

HSP 3 Score: 74.3294 bits (181), Expect = 2.574e-12
Identity = 46/156 (29.49%), Postives = 82/156 (52.56%), Query Frame = 2
Query: 3935 KIVINSDGAFEGKAEWILETDGTCLQKVLAERDV-DSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDI 4399
            + ++N     + + E +L T+G  L ++    +V D     SN I  I  T+GIEAA   IE+E+  V +  G  V+ RHL+L+ + M  +G    ++R GI R  +  L + +FE +   L +A      D ++  S  +++G++ + GTG F++
Sbjct: 1500 RCLLNETTNNKNEKELVLNTEGINLPELFKYAEVLDLRRLYSNDIHAIANTYGIEAALRVIEKEIKDVFAVYGIAVDPRHLSLVADYMCFEGVYKPLNRFGI-RSNSSPLQQMTFETSFQFLKQATMLGSHDELRSPSACLVVGKVVRGGTGLFEL 1654          

HSP 4 Score: 65.4698 bits (158), Expect = 1.329e-9
Identity = 37/107 (34.58%), Postives = 53/107 (49.53%), Query Frame = 3
Query:   54 SVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKL 374
            ++P R ++ + FG+ SA E+K+LSV       Y +    G P  +GL D   GP D    C TC    + C GH GHI L   V++    +K+  +LR  C  C  L
Sbjct:    6 NMPWRRLQGISFGMYSAEELKKLSVKSITNPRYLDSL--GNPSANGLYDLALGPADSKEVCSTCVQDFSNCSGHLGHIELPLTVYNPLLFDKLYLLLRGSCLNCHML 110          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Celegans
Match: ama-1 (DNA-directed RNA polymerase II subunit RPB1 [Source:UniProtKB/Swiss-Prot;Acc:P16356])

HSP 1 Score: 1167.53 bits (3019), Expect = 0.000e+0
Identity = 561/890 (63.03%), Postives = 689/890 (77.42%), Query Frame = 3
Query:   57 VPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDRDEMD------LKTQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQP--LRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVE 2699
             PLR V RVQFGIL   EIKR+SV     + + E  ++GKPK  GLMDPRQG  D+   C TC G++ +CPGHFGH+ LA+PVFHIGF  K +KILR VCF C +LL D ++  V EILKKT  N +KR   +YD C+   VC       + M       +   +    GCG  QP +RR G++     K + ++   ++   L A +VLE+F++IT+ED L++G +P+++RPE MI TVL VPPLAVRPAVV   + K+ DDLTHKL++++K N +++  E NG A+ +L +    LQ+HVAT +DN  P LPTA QK GRPLK++KQRLKGK GRIR NLMGKR D+SARTVITADPNL +D VGVPR IAQNLTFPE VTPFN   LQ+LV  G T YPGA ++IRENG R+DL+  P ++D+ LQ G  VERHM + D +VFNRQPTLHKMSMM HRVK+LP+STFR+NLSVTSPYNADFDGDEMNLHLPQSLET+AE+ ++A V + +ITPQ+NKPVM IVQDTL A   MT RDVF++   +M LLMYLPTW+G++P+PAI KP  LWTGKQ+FSLIIPG VN +RTHSTHP+ E++GPYKWISPGDTKV+IE GEL+SGI+C KT+G SAG+L+H++ LE   + A  F++++QTV+N WL+ EGHTIGI D + D  T  +I+ TI +AK+ V + I+KAHN +L+ TPGNTLRQTFE  VN+ILNDARD+TGS AQKSLS++NNF  MV+SG+KGSKINISQVIACVGQQNVEGKRIPFGF+ RTLPHFIKDDYGPES+GFVENSYLAGLTP+EFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVM+ YD TVRN + Q++Q RYGEDGLDG +VE
Sbjct:   10 APLRIVSRVQFGILGPEEIKRMSVAH---VEFPEVYENGKPKLGGLMDPRQGVIDRRGRCMTCAGNLTDCPGHFGHLELAKPVFHIGFLTKTLKILRCVCFYCGRLLIDKSAPRVLEILKKTGTNSKKRLTMIYDLCKAKSVCEGAAEKEEGMPDDPDDPMNDGKKVAGGCGRYQPSYRRVGIDINAEWKKNVNEDTQERKIMLTAERVLEVFQQITDEDILVIGMDPQFARPEWMICTVLPVPPLAVRPAVVTFGSAKNQDDLTHKLSDIIKTNQQLQRNEANGAAAHVLTDDVRLLQFHVATLVDNCIPGLPTATQKGGRPLKSIKQRLKGKEGRIRGNLMGKRVDFSARTVITADPNLPIDTVGVPRTIAQNLTFPEIVTPFNVDKLQELVNRGDTQYPGAKYIIRENGARVDLRYHPRAADLHLQPGYRVERHMKDGDIIVFNRQPTLHKMSMMGHRVKILPWSTFRMNLSVTSPYNADFDGDEMNLHLPQSLETRAEIEEIAMVPRQLITPQANKPVMGIVQDTLCAVRMMTKRDVFIDWPFMMDLLMYLPTWDGKVPQPAILKPKPLWTGKQVFSLIIPGNVNVLRTHSTHPDSEDSGPYKWISPGDTKVIIEHGELLSGIVCSKTVGKSAGNLLHVVTLELGYEIAANFYSHIQTVINAWLIREGHTIGIGDTIADQATYLDIQNTIRKAKQDVVDVIEKAHNDDLEPTPGNTLRQTFENKVNQILNDARDRTGSSAQKSLSEFNNFKSMVVSGSKGSKINISQVIACVGQQNVEGKRIPFGFRHRTLPHFIKDDYGPESKGFVENSYLAGLTPSEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMVNYDGTVRNSLAQMVQLRYGEDGLDGMWVE 896          

HSP 2 Score: 702.59 bits (1812), Expect = 0.000e+0
Identity = 368/686 (53.64%), Postives = 470/686 (68.51%), Query Frame = 2
Query: 2702 QSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETGGRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDN---LNLVLRIXXXXXXXXXXXXXXXXXXXXYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALPMMSGVAHNLYMVGGATPMNSA-SPQLTPWTTLSSP----YTFSPKPNSF--GASFSPIAHSEIGMSP------NPALAFSPM--MSPKTPMDYGF--GRYSPS 4699
            Q++PT KP  A FE+ FR D+++   L +  +E  VREI    D I  +++EW QL +DR L+R I       ++VLPCN+ RL+ N QKIFK+DL K  ++ P+ +I  V  L   LI+V G+D ISK A  NATLL   L+RS LC K +  + +L+ EAFDW+LGEI++RF Q++ QPGEMVGALAA+SLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVS+  KTPSLTVFLTG AAKD E AK +  +LEHTTL+K+   + IYYDP+P+++VI  D EWV  +YE+PD D+ + SP+LLRI L RK+M DKKLT++ IA++I   F ND+     DDN   L   LRI    K + ++++  +MED  +L  +E  +L ++ LQGIP ISKVY++ P TDDKK+I+I  +G F+  A+WILETDGT L +VL+ER +D   T SN I EIFE  GIEA R AIEREM +VISFDGSYVNYRHLALLC++MT KG LM+I RHGINRQE GAL R SFEETVDILMEA  HAE DP+KGVSE+IMLGQLA+ GTGCFD++++ EKC     +P    +    Y     +P N   SP  +PW +  +P      +SP       GA FSP  +++ G SP      +PA    P+  +SP+TP   G   G YSPS
Sbjct:  898 QNMPTMKPNNAVFERDFRMDLTDNKFLRKNYSEDVVREIQESEDGISLVESEWSQLEEDRRLLRKIFPR-GDAKIVLPCNLQRLIWNAQKIFKVDLRKPVNLSPLHVISGVRELSKKLIIVSGNDEISKQAQYNATLLMNILLRSTLCTKNMCTKSKLNSEAFDWLLGEIESRFQQAIAQPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSKTLKTPSLTVFLTGAAAKDPEKAKDVLCKLEHTTLKKVTCNTAIYYDPDPKNTVIAEDEEWVSIFYEMPDHDLSRTSPWLLRIELDRKRMVDKKLTMEMIADRIHGGFGNDVHTIYTDDNAEKLVFRLRIAGEDKGEAQEEQVDKMEDDVFLRCIEANMLSDLTLQGIPAISKVYMNQPNTDDKKRIIITPEGGFKSVADWILETDGTALLRVLSERQIDPVRTTSNDICEIFEVLGIEAVRKAIEREMDNVISFDGSYVNYRHLALLCDVMTAKGHLMAITRHGINRQEVGALMRCSFEETVDILMEAAVHAEEDPVKGVSENIMLGQLARCGTGCFDLVLDVEKCKYGMEIPQNVVMGGGFYGSFAGSPSNREFSPAHSPWNSGVTPTYAGAAWSPTTGGMSPGAGFSPAGNTDGGASPFNEGGWSPASPGDPLGALSPRTPSYGGMSPGVYSPS 1582          

HSP 3 Score: 55.8398 bits (133), Expect = 4.708e-7
Identity = 33/83 (39.76%), Postives = 43/83 (51.81%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYSGNMSYSPTSPQYSPATSGYVANSPSYG----------QQNTNSNSGYSPQSP 5695
            Y+PTSP +SPS  +Y P SP T    SP    +  YSPTSP YSP +  Y  +SP Y            +   +++ YSP SP
Sbjct: 1748 YSPTSPQYSPSSPTYTPSSP-TYNPTSPRGFSSPQYSPTSPTYSPTSPSYTPSSPQYSPTSPTYTPSPSEQPGTSAQYSPTSP 1829          

HSP 4 Score: 53.5286 bits (127), Expect = 2.490e-6
Identity = 38/94 (40.43%), Postives = 49/94 (52.13%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVY-SG--------------------NMSYSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP 5695
            Y+PTSP +SP+  +Y+P SP T    SP Y SG                    + SYSPTSPQYSP +  Y  +SP+Y    T S+  Y+P SP
Sbjct: 1686 YSPTSPTYSPTSPTYSPTSP-TYSPTSPSYESGGGYSPSSPKYSPSSPTYSPTSPSYSPTSPQYSPTSPQYSPSSPTY----TPSSPTYNPTSP 1774          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Celegans
Match: ama-1 (DNA-directed RNA polymerase II subunit RPB1 [Source:UniProtKB/Swiss-Prot;Acc:P16356])

HSP 1 Score: 1167.53 bits (3019), Expect = 0.000e+0
Identity = 561/890 (63.03%), Postives = 689/890 (77.42%), Query Frame = 3
Query:   57 VPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDRDEMD------LKTQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQP--LRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVE 2699
             PLR V RVQFGIL   EIKR+SV     + + E  ++GKPK  GLMDPRQG  D+   C TC G++ +CPGHFGH+ LA+PVFHIGF  K +KILR VCF C +LL D ++  V EILKKT  N +KR   +YD C+   VC       + M       +   +    GCG  QP +RR G++     K + ++   ++   L A +VLE+F++IT+ED L++G +P+++RPE MI TVL VPPLAVRPAVV   + K+ DDLTHKL++++K N +++  E NG A+ +L +    LQ+HVAT +DN  P LPTA QK GRPLK++KQRLKGK GRIR NLMGKR D+SARTVITADPNL +D VGVPR IAQNLTFPE VTPFN   LQ+LV  G T YPGA ++IRENG R+DL+  P ++D+ LQ G  VERHM + D +VFNRQPTLHKMSMM HRVK+LP+STFR+NLSVTSPYNADFDGDEMNLHLPQSLET+AE+ ++A V + +ITPQ+NKPVM IVQDTL A   MT RDVF++   +M LLMYLPTW+G++P+PAI KP  LWTGKQ+FSLIIPG VN +RTHSTHP+ E++GPYKWISPGDTKV+IE GEL+SGI+C KT+G SAG+L+H++ LE   + A  F++++QTV+N WL+ EGHTIGI D + D  T  +I+ TI +AK+ V + I+KAHN +L+ TPGNTLRQTFE  VN+ILNDARD+TGS AQKSLS++NNF  MV+SG+KGSKINISQVIACVGQQNVEGKRIPFGF+ RTLPHFIKDDYGPES+GFVENSYLAGLTP+EFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVM+ YD TVRN + Q++Q RYGEDGLDG +VE
Sbjct:   10 APLRIVSRVQFGILGPEEIKRMSVAH---VEFPEVYENGKPKLGGLMDPRQGVIDRRGRCMTCAGNLTDCPGHFGHLELAKPVFHIGFLTKTLKILRCVCFYCGRLLIDKSAPRVLEILKKTGTNSKKRLTMIYDLCKAKSVCEGAAEKEEGMPDDPDDPMNDGKKVAGGCGRYQPSYRRVGIDINAEWKKNVNEDTQERKIMLTAERVLEVFQQITDEDILVIGMDPQFARPEWMICTVLPVPPLAVRPAVVTFGSAKNQDDLTHKLSDIIKTNQQLQRNEANGAAAHVLTDDVRLLQFHVATLVDNCIPGLPTATQKGGRPLKSIKQRLKGKEGRIRGNLMGKRVDFSARTVITADPNLPIDTVGVPRTIAQNLTFPEIVTPFNVDKLQELVNRGDTQYPGAKYIIRENGARVDLRYHPRAADLHLQPGYRVERHMKDGDIIVFNRQPTLHKMSMMGHRVKILPWSTFRMNLSVTSPYNADFDGDEMNLHLPQSLETRAEIEEIAMVPRQLITPQANKPVMGIVQDTLCAVRMMTKRDVFIDWPFMMDLLMYLPTWDGKVPQPAILKPKPLWTGKQVFSLIIPGNVNVLRTHSTHPDSEDSGPYKWISPGDTKVIIEHGELLSGIVCSKTVGKSAGNLLHVVTLELGYEIAANFYSHIQTVINAWLIREGHTIGIGDTIADQATYLDIQNTIRKAKQDVVDVIEKAHNDDLEPTPGNTLRQTFENKVNQILNDARDRTGSSAQKSLSEFNNFKSMVVSGSKGSKINISQVIACVGQQNVEGKRIPFGFRHRTLPHFIKDDYGPESKGFVENSYLAGLTPSEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMVNYDGTVRNSLAQMVQLRYGEDGLDGMWVE 896          

HSP 2 Score: 702.59 bits (1812), Expect = 0.000e+0
Identity = 368/686 (53.64%), Postives = 470/686 (68.51%), Query Frame = 2
Query: 2702 QSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETGGRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDN---LNLVLRIXXXXXXXXXXXXXXXXXXXXYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALPMMSGVAHNLYMVGGATPMNSA-SPQLTPWTTLSSP----YTFSPKPNSF--GASFSPIAHSEIGMSP------NPALAFSPM--MSPKTPMDYGF--GRYSPS 4699
            Q++PT KP  A FE+ FR D+++   L +  +E  VREI    D I  +++EW QL +DR L+R I       ++VLPCN+ RL+ N QKIFK+DL K  ++ P+ +I  V  L   LI+V G+D ISK A  NATLL   L+RS LC K +  + +L+ EAFDW+LGEI++RF Q++ QPGEMVGALAA+SLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVS+  KTPSLTVFLTG AAKD E AK +  +LEHTTL+K+   + IYYDP+P+++VI  D EWV  +YE+PD D+ + SP+LLRI L RK+M DKKLT++ IA++I   F ND+     DDN   L   LRI    K + ++++  +MED  +L  +E  +L ++ LQGIP ISKVY++ P TDDKK+I+I  +G F+  A+WILETDGT L +VL+ER +D   T SN I EIFE  GIEA R AIEREM +VISFDGSYVNYRHLALLC++MT KG LM+I RHGINRQE GAL R SFEETVDILMEA  HAE DP+KGVSE+IMLGQLA+ GTGCFD++++ EKC     +P    +    Y     +P N   SP  +PW +  +P      +SP       GA FSP  +++ G SP      +PA    P+  +SP+TP   G   G YSPS
Sbjct:  898 QNMPTMKPNNAVFERDFRMDLTDNKFLRKNYSEDVVREIQESEDGISLVESEWSQLEEDRRLLRKIFPR-GDAKIVLPCNLQRLIWNAQKIFKVDLRKPVNLSPLHVISGVRELSKKLIIVSGNDEISKQAQYNATLLMNILLRSTLCTKNMCTKSKLNSEAFDWLLGEIESRFQQAIAQPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSKTLKTPSLTVFLTGAAAKDPEKAKDVLCKLEHTTLKKVTCNTAIYYDPDPKNTVIAEDEEWVSIFYEMPDHDLSRTSPWLLRIELDRKRMVDKKLTMEMIADRIHGGFGNDVHTIYTDDNAEKLVFRLRIAGEDKGEAQEEQVDKMEDDVFLRCIEANMLSDLTLQGIPAISKVYMNQPNTDDKKRIIITPEGGFKSVADWILETDGTALLRVLSERQIDPVRTTSNDICEIFEVLGIEAVRKAIEREMDNVISFDGSYVNYRHLALLCDVMTAKGHLMAITRHGINRQEVGALMRCSFEETVDILMEAAVHAEEDPVKGVSENIMLGQLARCGTGCFDLVLDVEKCKYGMEIPQNVVMGGGFYGSFAGSPSNREFSPAHSPWNSGVTPTYAGAAWSPTTGGMSPGAGFSPAGNTDGGASPFNEGGWSPASPGDPLGALSPRTPSYGGMSPGVYSPS 1582          

HSP 3 Score: 55.8398 bits (133), Expect = 4.708e-7
Identity = 33/83 (39.76%), Postives = 43/83 (51.81%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYSGNMSYSPTSPQYSPATSGYVANSPSYG----------QQNTNSNSGYSPQSP 5695
            Y+PTSP +SPS  +Y P SP T    SP    +  YSPTSP YSP +  Y  +SP Y            +   +++ YSP SP
Sbjct: 1748 YSPTSPQYSPSSPTYTPSSP-TYNPTSPRGFSSPQYSPTSPTYSPTSPSYTPSSPQYSPTSPTYTPSPSEQPGTSAQYSPTSP 1829          

HSP 4 Score: 53.5286 bits (127), Expect = 2.490e-6
Identity = 38/94 (40.43%), Postives = 49/94 (52.13%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVY-SG--------------------NMSYSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP 5695
            Y+PTSP +SP+  +Y+P SP T    SP Y SG                    + SYSPTSPQYSP +  Y  +SP+Y    T S+  Y+P SP
Sbjct: 1686 YSPTSPTYSPTSPTYSPTSP-TYSPTSPSYESGGGYSPSSPKYSPSSPTYSPTSPSYSPTSPQYSPTSPQYSPSSPTY----TPSSPTYNPTSP 1774          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Celegans
Match: rpc-1 (DNA-directed RNA polymerase subunit [Source:UniProtKB/TrEMBL;Acc:Q18566])

HSP 1 Score: 582.408 bits (1500), Expect = 4.060e-178
Identity = 338/886 (38.15%), Postives = 505/886 (57.00%), Query Frame = 3
Query:  138 NGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDE---------CRRNKVCSVPNSDRDEMDLKTQEMSRSGCGYVQPIFRR----NGLEYFVTLKXXXXXXXXKQPLRAYQVL------EIFRRITEEDC-LLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMN-HTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNGT-MYPGAAFVI-RENGDRIDLKR-RPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNG------RLPKPAIYKPLRLWTGKQIFSLII-PGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAG-SLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVE 2699
            N  +Y +     +P   G +DP+ G   K   C TCG  + +C GHFG+ +L  PVFHIGF +  I++L+ +C  CS +L    +     +  +  +NP    D+++ +         C++   CS          LK   + ++    ++  F      + L  F T+   + +         + +L      ++F  I E D  +LM  + +   P  +++T + VPP+ +RP+VV     G + DD+T KL E++  N+ ++  + +G  S  L E    LQ   A +I++E   LP  +Q   R ++   QRLKGK GR R NL GKR D+S RTVI+ DPNL +DQVGVP  +A  LTFPE V   N   ++QLV NG+ ++PGA +++ ++ G++  LK  + D     L+ G+T+ERH+ ++D V+FNRQP+LHK+S+M HR KV+P  TFR N    +PYNADFDGDEMNLHLPQ+ E KAE S+L  V   +ITP+S +P+++ +QD +T    +T +D FL RAEV      L   +       R+P PAI +P+ LWTGKQ+  LII P + + +  + T       G  +  S  D+ V+I +  L++G L K  LGSS+  ++ +++  +   D A      +  +   +L   G +IGI D     +   E  Q +D       + I +    +L++ PG T  +T E+ + + L+  RD  G    ++LSKYN    M + G+KGS INISQ+IACVGQQ + G R P GF++R+LPHF +    PE++GFV NS+ +GLTPTEFFFH MGGREGL+DTAVKTAETGY+QRRL+K +E +   YD TVR+ +  +I+F +GEDGLD A +E
Sbjct:   38 NNKLYEDVEGKLQPANYGPLDPKMGVSTKTGTCSTCGLGLTDCVGHFGYFDLDVPVFHIGFFKLTIQLLQCICKNCSSILL---TPEQHRVFSRQVMNPN--LDYLHRKALHKRIVAACKKGSTCS-------HCGLKNGTVKKAVGAVLKIAFASPVSVDELGKFATMFSSNQEVGDHVRKMKFTLLNPLFVQKLFSNIKEGDIPVLMVRSGEEKHPNDLLLTRMPVPPVCIRPSVVSEVKAGTTEDDVTMKLMEIMLTNDVLKKHKRDGAPSKTLFETWEHLQIQCALYINSEMSGLPPDMQPK-RAMRAFTQRLKGKQGRFRGNLCGKRVDFSGRTVISPDPNLRIDQVGVPIHVAMTLTFPEIVNASNIEKMRQLVINGSDVHPGANYLVEKKTGNKKLLKYGKRDELAKNLRMGDTIERHLDDNDVVLFNRQPSLHKISIMSHRAKVMPGRTFRFNECACTPYNADFDGDEMNLHLPQTYEAKAEASELMNVKNNLITPRSGEPLVAAIQDFITGGYLLTHKDTFLPRAEVYRFAAALIDASAKKQTKIRIPPPAIRRPVELWTGKQLIELIIRPDKGSDVSLNLTAKNKSYTGNLELCSK-DSYVIIRNSVLLAGCLDKSLLGSSSKVNIFYMLMRDYGEDAAVDAMWRLARMAPVFLSNRGFSIGIGDVRPSEQLLREKGQLVDNGYSKCSQYIKELEEGKLKAQPGCTEEETLESIILRELSTIRDHAGQVCLRNLSKYNAPLTMAVCGSKGSFINISQMIACVGQQAISGHRPPDGFEERSLPHFERKKKTPEAKGFVANSFYSGLTPTEFFFHTMGGREGLVDTAVKTAETGYMQRRLVKCLEDLCASYDGTVRSSVGDVIEFVFGEDGLDPAMME 909          

HSP 2 Score: 168.703 bits (426), Expect = 1.556e-41
Identity = 127/442 (28.73%), Postives = 211/442 (47.74%), Query Frame = 2
Query: 3092 ANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLNLVLRIXXXXXXXXXXXXXXXXXXXXYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEK 4417
            A + + L   CL ++ LC    +  Y+++                +++ +PG  VGA+AA S+GEP+TQMTL TFH+AGV++ N+T GVPR+KEIIN  +   TP +T  L      D  +A+ + AR+E TTL ++                     +++   Y LPD        Y L + L  K++  + L L+   E I+       +C      +     +   K              +     +    L  + ++GIP +++  IH    D+KK       G F     + L  +GT  + VL+   VD   T  N+   + +  GIEAAR+ I  E+   +   G  ++ RH+ LL ++MT++G ++ I R+G+ + +   L  +SFE+T+D L EA   ++ D + GVSE I++G    +GTG F ++  Y+K
Sbjct: 1008 AYKTSLLANSCLTKTQLCSFIELCYYKVA----------------RAITEPGTAVGAIAATSIGEPSTQMTLKTFHFAGVASMNITQGVPRIKEIINAVKTISTPIITAALLD--PYDESLARRVKARIEKTTLGEIC--------------------DYIEEVY-LPD-------DYFLLVKLNSKRI--RLLQLEVCMESISYAIATSKVC----PQMRGCKIVAHGKTMMAIRPPSTSKLSKTMTMQILKYSLANVVVKGIPSVNRCVIH---ADEKK-------GDF-----YSLLVEGTDFRSVLSSVGVDPRKTNFNNALVVADVLGIEAARSCIINEIIATMDAHGIGLDRRHVMLLADVMTYRGEVLGITRNGLVKMKDSVLLLASFEKTMDHLFEAAFFSQRDVIHGVSECIIMGTPMTVGTGTFKLMQKYDK 1382          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Celegans
Match: rpoa-1 (DNA-directed RNA polymerase subunit [Source:UniProtKB/TrEMBL;Acc:G5EDG7])

HSP 1 Score: 358.221 bits (918), Expect = 6.922e-100
Identity = 224/627 (35.73%), Postives = 325/627 (51.83%), Query Frame = 3
Query: 1011 LKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNGT-MYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGET--------------VERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFS-TFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHL-LMYLPTWNGRL--PKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYK-----WISPG---------DTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAG-GFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFET-------IDKAHNYELQSTPGNTLRQTFETTVN--------KIL-----------NDARDKTGSCAQKSLSKY---NNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
            +KQ L+ K G  R ++MGKR +++ R+VIT DP L++D++G+P + A+ LTF E V  FN + ++ L++ G   +PGA F +  +G +  L  +P+    ++Q  +T              V RHM N D ++ NRQP+LHK S++ HR +VL      R+N +    YNADFDGDEMN HL QS   + EV ++A V    + P+   P++ ++QD + +   ++ RD FLN+ + MHL L     ++ R+  P P I  P RLWTGKQ+ + I+    NCI      P    +G  K     WI PG         ++ V+   GEL+ G+L K   G++   L H  A E +    G    +    +   +L   G T+G+ D L        +K    + KEAV E+       +  A      +TP    R    T  N        K+L           NDA   T SC    L +    N   LM+ SGAKGS +N  Q+  C+GQ  +EGKR+      RTLP F   D  P + G+++  +L G+ P E FFH M GREGLIDTAVKT+ +GY+QR +IK +E + + YDSTVR+    +IQFRYGEDG+D     F
Sbjct:  456 IKQILEKKQGLFRMHMMGKRVNFACRSVITPDPYLDIDEIGIPDIFAKKLTFTEPVNAFNVNEMKGLLRQGPHQHPGANFFVEPSGKKTMLGDKPEEKKRRMQMAKTLNAATTENLRQTPKVLRHMKNGDMIMMNRQPSLHKPSILGHRARVLTGQRALRMNYAPCKAYNADFDGDEMNGHLVQSHIAQTEVREIANVGSNFLVPKDATPLLGLIQDHVVSGVLLSVRDRFLNKEDFMHLVLASFAQYSKRIEIPPPTILYPKRLWTGKQVITTIVK---NCI--PDGKPLINLDGKAKTPLSCWIVPGFDAPQFDMSESHVVFRQGELLVGVLDKAHFGATQFGLAHC-AFELYGHRCGVQLLSCFSRLFTTYLQFHGFTLGVADILV-------VKDADGKRKEAVMESRTIGNQVVKTAFGLPDTATPAEIKRTLAATYCNPRGQGTDVKMLDFGMKQGIAKYNDA--ITKSCVPTGLLRLFPQNALQLMIQSGAKGSAVNAIQISGCLGQIELEGKRMAVTIAGRTLPSFRCFDPSPRAGGYIDQRFLTGMNPQELFFHTMAGREGLIDTAVKTSRSGYLQRCIIKHLEGIRVHYDSTVRDHDGSVIQFRYGEDGMDTTKATF 1067          

HSP 2 Score: 87.0409 bits (214), Expect = 1.506e-16
Identity = 45/93 (48.39%), Postives = 63/93 (67.74%), Query Frame = 2
Query: 3227 QSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEII-NVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKL 3502
            +SL  PGE VG LAA+S+GEP+TQMTLNTFH+AG    NVTLG+PRL+EI+   S++  TPS ++ +    ++D     SI   L+   L++L
Sbjct: 1226 RSLADPGENVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILMTASKSIATPSASIAVIAGTSRD--RIDSIKRELDRVYLKQL 1316          

HSP 3 Score: 83.5741 bits (205), Expect = 1.463e-15
Identity = 53/156 (33.97%), Postives = 81/156 (51.92%), Query Frame = 2
Query: 3968 GKAEWILETDGTCLQKVLAERDV-DSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQ 4432
            GK   IL+T G  L       DV D  +  SN +  I E +G+EA   AI  EM++V +  G  V+ RHL+L  + MT  G +   +R G     +  L + +FE T+  L EA  H E D +   S  +++G L + GTG FD+L++ +  +E +
Sbjct: 1567 GKEMTILQTQGVNLAAFFKHADVLDVNSVYSNDLNLILENYGVEACSKAITTEMNNVFAVYGIEVSKRHLSLTADYMTFTGQIQPFNR-GAMSSSSSPLQKMTFETTMAFLREALLHGEEDNVNSPSARLVMGALPRGGTGSFDLLLDTKMQSERE 1721          

HSP 4 Score: 64.6994 bits (156), Expect = 8.459e-10
Identity = 38/106 (35.85%), Postives = 51/106 (48.11%), Query Frame = 3
Query:  108 EIKRLSVVGENGIIYAEKTQD--GKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKK 419
            EI +LSV+     I   KT D  G P   GL DP  GP + +  C TC      CPGH GHI LA PVF+    +    +L+  C  C +L    +  N + +L +
Sbjct:   27 EIDKLSVLK----ITQTKTFDEVGHPIAGGLYDPILGPDNTFDMCMTCNQYERHCPGHMGHIQLAVPVFNPLLFQFTYNLLKGSCVHCHRLTCKGDGVNARMLLAQ 128          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Celegans
Match: rpoa-1 (DNA-directed RNA polymerase subunit [Source:UniProtKB/TrEMBL;Acc:G5EDG7])

HSP 1 Score: 56.9954 bits (136), Expect = 3.586e-9
Identity = 34/104 (32.69%), Postives = 57/104 (54.81%), Query Frame = 2
Query: 4121 EMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQ 4432
            EM++V +  G  V+ RHL+L  + MT  G +   +R G     +  L + +FE T+  L EA  H E D +   S  +++G L + GTG FD+L++ +  +E +
Sbjct:    2 EMNNVFAVYGIEVSKRHLSLTADYMTFTGQIQPFNR-GAMSSSSSPLQKMTFETTMAFLREALLHGEEDNVNSPSARLVMGALPRGGTGSFDLLLDTKMQSERE 104          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Fly
Match: RpII215 (gene:FBgn0003277 transcript:FBtr0073542)

HSP 1 Score: 1207.2 bits (3122), Expect = 0.000e+0
Identity = 577/892 (64.69%), Postives = 697/892 (78.14%), Query Frame = 3
Query:   57 VPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDRDEMDLKTQEM--------SRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQ-PLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
             PLR+VKRVQFGILS  EI+R+SV  E G+ +AE  + G+PK  GLMDPRQG  D+ S CQTC G++ ECPGHFGHI+LA+PVFHIGF  K IKILR VCF CSK+L   ++  +KEI+ K+   PRKR  ++YD C+   +C       ++MDL  +             GCG+ QP  RR GL+     K  + DS  K+  + A +V EI + IT+E+C ++G +PKY+RP+ MI+TVL VPPLAVRPAVVM    K+ DDLTHKL++++K NNE+R  E +G A+ ++ E    LQ+HVAT +DN+ P +P A+QKSG+PLK +K RLKGK GRIR NLMGKR D+SARTVIT DPNL +DQVGVPR IAQNLTFPE VTPFN   +Q+LV+ G + YPGA +++R+NG+RIDL+  P SSD+ LQ G  VERH+ +DD V+FNRQPTLHKMSMM HRVKVLP+STFR+NLS TSPYNADFDGDEMNLH+PQS+ET+AEV ++    + IITPQ+NKPVM IVQDTLTA  KMT RDVF+ R +VM+LLM+LPTW+ ++P+P I KP  LWTGKQIFSLIIPG VN IRTHSTHP+ E+ GPYKWISPGDTKV++E GELI GILCKK+LG+SAGSL+HI  LE   D AG F+ N+QTV+NNWLL EGH+IGI D + D +T  EI+Q I +AK+ V   I KAHN EL+ TPGNTLRQTFE  VN+ILNDARDKTG  A+KSL++YNN   MV+SG+KGS INISQVIACVGQQNVEGKRIP+GF++RTLPHFIKDDYGPESRGFVENSYLAGLTP+EF+FHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVM+ YD TVRN + QLIQ RYGEDGL G  VEF
Sbjct:    9 APLRQVKRVQFGILSPDEIRRMSVT-EGGVQFAETMEGGRPKLGGLMDPRQGVIDRTSRCQTCAGNMTECPGHFGHIDLAKPVFHIGFITKTIKILRCVCFYCSKMLVSPHNPKIKEIVMKSRGQPRKRLAYVYDLCKGKTICE----GGEDMDLTKENQQPDPNKKPGHGGCGHYQPSIRRTGLDLTAEWKHQNEDSQEKKIVVSAERVWEILKHITDEECFILGMDPKYARPDWMIVTVLPVPPLAVRPAVVMFGAAKNQDDLTHKLSDIIKANNELRKNEASGAAAHVIQENIKMLQFHVATLVDNDMPGMPRAMQKSGKPLKAIKARLKGKEGRIRGNLMGKRVDFSARTVITPDPNLRIDQVGVPRSIAQNLTFPELVTPFNIDRMQELVRRGNSQYPGAKYIVRDNGERIDLRFHPKSSDLHLQCGYKVERHLRDDDLVIFNRQPTLHKMSMMGHRVKVLPWSTFRMNLSCTSPYNADFDGDEMNLHVPQSMETRAEVENIHITPRQIITPQANKPVMGIVQDTLTAVRKMTKRDVFITREQVMNLLMFLPTWDAKMPQPCILKPRPLWTGKQIFSLIIPGNVNMIRTHSTHPDEEDEGPYKWISPGDTKVMVEHGELIMGILCKKSLGTSAGSLLHICFLELGHDIAGRFYGNIQTVINNWLLFEGHSIGIGDTIADPQTYNEIQQAIKKAKDDVINVIQKAHNMELEPTPGNTLRQTFENKVNRILNDARDKTGGSAKKSLTEYNNLKAMVVSGSKGSNINISQVIACVGQQNVEGKRIPYGFRKRTLPHFIKDDYGPESRGFVENSYLAGLTPSEFYFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMVNYDGTVRNSVGQLIQLRYGEDGLCGELVEF 895          

HSP 2 Score: 707.983 bits (1826), Expect = 0.000e+0
Identity = 366/667 (54.87%), Postives = 477/667 (71.51%), Query Frame = 2
Query: 2687 GICG----IQSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETGGRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLN-LVLRIXXXXXXXXXXX----XXXXXXXXXYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALP------MMSGVAHNLYMVGGATPMNSASPQLTPWTTLSSPYTFSPKPN-----SFGASFSPIAHSEI-GMSPN 4624
            G+CG     Q++PT K +   FEKRF+FD SNE  + +  T+  ++E+T  ++ I +L+ EWD+L  DR+ +R I  +    +VVLPCN+ R++ N QKIF I+    TD+ P+ +I+ V+ L    ++V G+D ISK ANENATLLF CLIRS LC K V +E+RLS EAF+W++GEI+TRF Q+   PGEMVGALAA+SLGEPATQMTLNTFH+AGVS+KNVTLGVPRLKEIIN+S+ PK PSLTVFLTG AA+DAE AK++  RLEHTTLRK+   + IYYDP+P+ +VI  D+E+V  YYE+PDFD  + SP+LLRI L RK+MTDKKLT++ IAEKI   F  D+ C   DDN + LVLRIR++  E+ K         +MED  +L  +E  +L ++ LQGI  I KVY+H P+TD KK+IVI   G F+   EW+LETDGT + KVL+ERDVD   T SN I EIF+  GIEA R ++E+EM+ V+ F G YVNYRHLALLC++MT KG LM+I RHGINRQ+TGAL R SFEETVD+LM+A AHAE DPM+GVSE+I++GQL K+GTGCFD+L++ EKC     +P      M+ G A  +++ GG+TP  S +P +TPW   ++P  FSP  +       G SFSP A S+  GMSP+
Sbjct:  887 GLCGELVEFQNMPTVKLSNKSFEKRFKFDWSNERLMKKVFTDDVIKEMTDSSEAIQELEAEWDRLVSDRDSLRQIFPNGES-KVVLPCNLQRMIWNVQKIFHINKRLPTDLSPIRVIKGVKTLLERCVIVTGNDRISKQANENATLLFQCLIRSTLCTKYVSEEFRLSTEAFEWLVGEIETRFQQAQANPGEMVGALAAQSLGEPATQMTLNTFHFAGVSSKNVTLGVPRLKEIINISKKPKAPSLTVFLTGGAARDAEKAKNVLCRLEHTTLRKVTANTAIYYDPDPQRTVISEDQEFVNVYYEMPDFDPTRISPWLLRIELDRKRMTDKKLTMEQIAEKINVGFGEDLNCIFNDDNADKLVLRIRIMNNEENKFQDEDEAVDKMEDDMFLRCIEANMLSDMTLQGIEAIGKVYMHLPQTDSKKRIVITETGEFKAIGEWLLETDGTSMMKVLSERDVDPIRTSSNDICEIFQVLGIEAVRKSVEKEMNAVLQFYGLYVNYRHLALLCDVMTAKGHLMAITRHGINRQDTGALMRCSFEETVDVLMDAAAHAETDPMRGVSENIIMGQLPKMGTGCFDLLLDAEKCRFGIEIPNTLGNSMLGGAA--MFIGGGSTP--SMTPPMTPWANCNTPRYFSPPGHVSAMTPGGPSFSPSAASDASGMSPS 1548          

HSP 3 Score: 54.6842 bits (130), Expect = 1.424e-6
Identity = 39/100 (39.00%), Postives = 45/100 (45.00%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSP-------------------STAGAVSPVYSGNMS--------YSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP 5695
            YTP SP +SP+   Y+P SP                   ST  A SP YS NMS        YSPTSP Y+P    Y   SP Y   +  + S YSP SP
Sbjct: 1777 YTPGSPQYSPASPKYSPTSPLYSPSSPQHSPSNQYSPTGSTYSATSPRYSPNMSIYSPSSTKYSPTSPTYTPTARNYSPTSPMY---SPTAPSHYSPTSP 1873          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Fly
Match: RpIIIC160 (gene:FBgn0030687 transcript:FBtr0300811)

HSP 1 Score: 555.444 bits (1430), Expect = 1.712e-168
Identity = 335/923 (36.29%), Postives = 511/923 (55.36%), Query Frame = 3
Query:   66 REVKRVQFGILSASEIKR---LSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDEC-------RRNKVCSVPNSDRDEMDLKTQEMSRSGCGYVQ------------PIFRRNGLEYFVT------LKXXXXXXXXKQPLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMN-HTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLK---QRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKRRPDSSDI--QLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYL-----PTWNGRLPKPAIYKPLRLWTGKQIFSLII-PGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIAL----EQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVE 2699
            +++  VQFGI  A EI++   + ++ +N  +Y  + Q   P   G++D R G   K + C+TCG  + EC GHFG+++LA PVFHIG     I IL+ +C  C+ ++        +++ +K   NP   F ++  +        +  KV   P+       +K       G G ++             +F  N  E   +      L     +  + + L    VL++F +I + D  L+G     + P+ +I+T + VPP  +RP+V+     G + DDLT K +E++ +N+ I+     G    ++ E  + LQ HVA +  +E   +P  +     P KT +   QRLKGK GR R NL GKR D+S RTVI+ DPNL ++QVGVP  +A+ LT+PE+V P N  ++++LV+NG +M+PGA +V +            +   +  +L+ G+ VERH+ + D V+FNRQP+LHKMS+MCHR KV P  TFR N    +PYNADFDGDEMNLHLPQ+ E +AE   L      ++TP++ + +++  QD +T    +T ++VFL + E M L          T + +LP PA+ KP RLWTGKQ+FSL++ P   + +R +  + +       K +   D+ + I + EL+ G++ K T+GS     I  + L    E H  +A      +  + + +L   G + GI D     K  +  +  ++       E I+      LQ  PG T  +T E+ + + L+  R++        L   N+  +M +SG+KGS INISQ+IACVGQQ + GKR+P GF+ R LPHF +    P +RGFV+NS+ +GLTPTEFFFH M GREGL+DTAVKTAETGY+QRRL+K +E +++ YD TVRN +++++   YG DGLD   +E
Sbjct:   13 KKISHVQFGISGADEIQQEALVRIISKN--LYQAQRQ---PVPYGVLDRRMGISTKDAMCETCGQGLNECIGHFGYLDLALPVFHIGHFRSTINILQMICKVCAHVMLKPED---RQLYEKKLHNPN--FSYLGKKALHVQMLAKAKKVTKCPHCGSPNGGVK------KGPGLLKILHDPYKGRKMDSLFTSNMNEMLRSTQTNRDLNSTLGNYSTAEELTPLMVLDLFEQIPQRDVALLGMCSHDAHPKHLIVTRVFVPPACIRPSVLSEVKAGTTEDDLTMKQSEILLINDVIQRHMATGGKIELIHEDWDFLQLHVALYFHSEISGIPINMA----PKKTTRGIVQRLKGKQGRFRCNLSGKRVDFSGRTVISPDPNLMINQVGVPVRVAKILTYPERVNPANIRHMRELVRNGPSMHPGANYVQQRGSSFKKYLAYGNREKVAQELKCGDVVERHLRDGDIVLFNRQPSLHKMSIMCHRAKVQPQRTFRFNECACTPYNADFDGDEMNLHLPQTEEARAEALILMGNQSNLVTPKNGEILIAATQDFITGGYLLTQKEVFLTKEEAMQLAACFLANEDSTMHIKLPPPALLKPRRLWTGKQMFSLLMRPNDDSQVRLNMVN-KGRNYTRNKDLCSNDSWIHIRNSELMCGVMDKATMGSGTKQCIFYLLLRDFGESHATKA---MWRLARIASYFLQNRGFSFGISDVTPSKKLLQHKELLLNNGYAKCNEYIELLKAGTLQCQPGCTPEETLESVMLRELSAIREQAAKTCFAELHPTNSALIMALSGSKGSNINISQMIACVGQQAISGKRVPNGFENRALPHFERHSAIPAARGFVQNSFYSGLTPTEFFFHTMAGREGLVDTAVKTAETGYLQRRLVKCLEDLVVHYDGTVRNAVNEMVDTIYGGDGLDPVSME 911          

HSP 2 Score: 186.422 bits (472), Expect = 8.508e-47
Identity = 128/414 (30.92%), Postives = 201/414 (48.55%), Query Frame = 2
Query: 3173 LSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLNLVLRIXXXXXXXXXXXXXXXXXXXXYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYE 4414
            L+ E     +  I  R+N+++ +PG  VGA+AA+S+GEP TQMTL TFH+AGV++ N+T GVPR+ EIIN ++   TP +T  L        E A+ + AR+E TTL +L+   E+   P      I  D   ++      D D       +  I+ +R ++   ++ + A   +I                   V+R+   +      +                L L  + + G+P I++  I     DD ++              + L  +G  L+ V+A   V  + T SN+I EI++T GIEAAR  I  E+  V+   G  V++RH+ LL   MT +G ++ I RHG+ +        +SFE+T D L +A  + + D + GVSE I+LG  A IGTG F +L  +E
Sbjct:  998 LTTEQLLQFVRRINDRYNRAVTEPGTAVGAIAAQSIGEPGTQMTLKTFHFAGVASMNITQGVPRIVEIINATKTISTPIITAELEN--CHSMEFARQVKARIEKTTLAELSSYVEVVCGPYSCYLAIGVDMARIKLLGLHIDLDT-----IVFSILKSRMRVKPTQVEVVASQSRI-------------------VVRVEATRTSTINAELARLA-----------LSLQNVVVAGLPNINRAVI---AVDDARQ-----------PPTYKLCIEGYGLRDVIATYGVVGKRTRSNNICEIYQTLGIEAARTIIMSEITEVMEGHGMSVDWRHIMLLASQMTARGEVLGITRHGLAKMRESVFNLASFEKTADHLFDAAYYGQTDAINGVSERIILGMPACIGTGIFKLLQQHE 1360          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Fly
Match: RpI1 (gene:FBgn0019938 transcript:FBtr0087511)

HSP 1 Score: 342.813 bits (878), Expect = 3.879e-95
Identity = 213/609 (34.98%), Postives = 327/609 (53.69%), Query Frame = 3
Query: 1011 LKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRI-----DLKRRPDSSDIQLQYGE----TVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFS-TFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTW---NGRLPKPAIYKPLRLWTGKQIFS---------------LIIPGRVNCIRTHSTHPEPEENGPYKWISP-----GDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALY----DAKTREEIKQTIDRAKEAVFETIDK---------AHNYELQSTPGNTLRQTFETTVNKILND-ARDKTGSCAQKSL-SKY--NNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLD 2684
            LKQ ++ K G IRS++MGKR +Y+ARTVIT DPN+N+D++G+P + A+ L++P  VT +N   L+++V NG  ++PGA ++  +NG        +  +R   + + L   +     V RH+LN D ++ NRQP+LHK S+M H+ ++L    TFRL+ S    YNADFDGDEMN H PQS   +AE  +L  V    + P+   P+  ++QD + +  K++ R  F NR +   L+    +    + +L  P I KP  LW+GKQI S               L    ++     + + P P    P    +P      +++V I +GEL+ G+L K+  G++   LIH +      D +         V   +L +EG T+G+ D L     D K R+ I++  +    AV   ++              E      +  R   +     +L+    D   +C  + L +K+  NN  LMV+SGAKGS +N  Q+   +GQ  +EGKR P     ++LP F   +  P+S GF++  ++ G+ P +FFFH M GREGLIDTAVKT+ +GY+QR LIK +E + + YD TVR+  + ++QF YGEDGLD
Sbjct:  399 LKQIIEKKSGLIRSHMMGKRVNYAARTVITPDPNINVDEIGIPDIFAKKLSYPVPVTEWNVTELRKMVMNGPDVHPGANYIQDKNGFTTYIPADNASKRESLAKLLLSNPKDGIKIVHRHVLNGDVLLLNRQPSLHKPSIMGHKARILHGEKTFRLHYSNCKAYNADFDGDEMNAHYPQSEVARAEAYNLVNVASNYLVPKDGTPLGGLIQDHVISGVKLSIRGRFFNREDYQQLVFQGLSQLKKDIKLLPPTILKPAVLWSGKQILSTIIINIIPEGYERINLDSFAKIAGKNWNVSRPRP----PICGTNPEGNDLSESQVQIRNGELLVGVLDKQQYGATTYGLIHCMYELYGGDVSTLLLTAFTKVFTFFLQLEGFTLGVKDILVTDVADRKRRKIIRECRNVGNSAVAAALELEDEPPHDELVEKMEAAYVKDSKFRVLLDRKYKSLLDGYTNDINSTCLPRGLITKFPSNNLQLMVLSGAKGSMVNTMQISCLLGQIELEGKRPPLMISGKSLPSFTSFETSPKSGGFIDGRFMTGIQPQDFFFHCMAGREGLIDTAVKTSRSGYLQRCLIKHLEGLSVHYDLTVRDSDNSVVQFLYGEDGLD 1003          

HSP 2 Score: 87.8113 bits (216), Expect = 1.116e-16
Identity = 55/135 (40.74%), Postives = 78/135 (57.78%), Query Frame = 2
Query: 3149 KKVIDEYRLSPEAFDWVLGEI-KTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINV-SRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKL----AVKSEIYYDPE 3535
            +K+I +Y     A    + +I + +  +SL  PGE VG +AA+S+GEP+TQMTLNTFH+AG    NVTLG+PRL+EI+ + S N KTPS+ + +       AE    +   L   TL  L     V + +  DPE
Sbjct: 1142 RKLITDYAKRKPALKETIADIMRVKTIKSLAAPGEPVGLIAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILMLASSNIKTPSMDIPIKPGQQHQAE---KLRINLNSVTLANLLEYVHVSTGLTLDPE 1273          

HSP 3 Score: 74.7146 bits (182), Expect = 1.102e-12
Identity = 44/143 (30.77%), Postives = 71/143 (49.65%), Query Frame = 2
Query: 3977 EWILETDGTCLQKVLAERDV-DSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDIL 4402
            + +L+TDG  + ++     + D     SN I  I  T+GIEAA   I +E+ +V    G  V+ RHL+L+ + MT  G    + R G+    +  L + SFE ++  L  A      D +   S  +M+G   + GTG F++L
Sbjct: 1497 DQLLKTDGINIGEMFQHNKILDLNRLYSNDIHAIARTYGIEAASQVIVKEVSNVFKVYGITVDRRHLSLIADYMTFDGTFQPLSRKGME-HSSSPLQQMSFESSLQFLKSAAGFGRADELSSPSSRLMVGLPVRNGTGAFELL 1638          

HSP 4 Score: 54.6842 bits (130), Expect = 1.294e-6
Identity = 34/100 (34.00%), Postives = 51/100 (51.00%), Query Frame = 3
Query:   81 VQFGILSASEIKRLSVVGE-NGIIYAEKTQDGKPKKDGLMDPRQGPFDK-YSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKL 374
            ++F + +  EI++LSVV    GI +      G     GL D R G + +    C TC   + +CPGH GHI L  PV++  F + + ++L   C  C KL
Sbjct:   16 LEFAVFTDQEIRKLSVVKVITGITFDAL---GHAIPGGLYDIRMGSYGRCMDPCGTCL-KLQDCPGHMGHIELGTPVYNPFFIKFVQRLLCIFCLHCYKL 111          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Zebrafish
Match: polr2a (polymerase (RNA) II (DNA directed) polypeptide A [Source:ZFIN;Acc:ZDB-GENE-041008-78])

HSP 1 Score: 1222.99 bits (3163), Expect = 0.000e+0
Identity = 589/896 (65.74%), Postives = 714/896 (79.69%), Query Frame = 3
Query:   54 SVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDRDEMDLK-----------TQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQPLRAYQ-VLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
            + PLR +KRVQFG+LS  E+KR+SV  E GI Y E T+ G+PK  GLMDPRQG  ++   CQTC G++ ECPGHFGHI LA+PVFH+GF  KI+K+LR VCF CSKLL D N+  +K+IL K++  PRKR   +YD C+   +C       +EMD K           T+E    GCG  QP  RR+GLE +   K  + DS  K+ L + + V EIF+RI +E+ +++G +PKY+RPE MI+TVL VPPLAVRPAVVM  + ++ DDLTHKL ++VK+NN+++  E++G A+ ++ E    LQ+HVAT +DNE P LP A+QKSGRPLK++KQRLKGK GR+R NLMGKR D+SARTVIT DPNL +DQVGVPR IA N+TFPE VTPFN   LQ+LV+ G + YPGA ++IR+NGDRIDL+  P  SD+ LQ G  VERHM + D +VFNRQPTLHKMSMM HRV++LP+STFRLNLSVT+PYNADFDGDEMNLHLPQSLET+AE+ +LA V ++I+TPQSN+PVM IVQDTLTA  K T RDVFL R EVM+LLM+L TW+G++P+PAI KP  LWTGKQIFSLIIPG +N IRTHSTHP+ E++GPYK ISPGDTKV++E+GELI GILCKK+LG+SAGSL+HI  LE   D    F++N+QTVVNNWLLIEGH+IGI D++ D  T ++I+ TI +AK+ V E I+KAHN EL+ TPGNTLRQTFE  VN+ILNDARDKTGS AQKSLS+YNNF  MV++G+KGSKINISQVIA VGQQNVEGKRIPFGF+ RTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIK+MESVM+KYD+TVRN I+Q++Q RYGEDGL G  VEF
Sbjct:   10 ACPLRLIKRVQFGVLSPDELKRMSVT-EGGIKYPETTEGGRPKLGGLMDPRQGVIERSGRCQTCAGNMTECPGHFGHIELAKPVFHVGFITKIMKVLRCVCFFCSKLLVDANNPKIKDILTKSKGQPRKRLTHVYDLCKGKNICE----GGEEMDNKFGVEQPESEDITKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRIADEEDIILGMDPKYARPEWMIVTVLPVPPLAVRPAVVMQGSARNQDDLTHKLADIVKINNQLKRNEQSGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSIKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLQIDQVGVPRSIAANMTFPEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQIGYKVERHMCDGDIIVFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINAIRTHSTHPDEEDSGPYKNISPGDTKVIVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVVNNWLLIEGHSIGIGDSIADKATYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVAGSKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGEAVEF 900          

HSP 2 Score: 721.85 bits (1862), Expect = 0.000e+0
Identity = 380/720 (52.78%), Postives = 499/720 (69.31%), Query Frame = 2
Query: 2645 SIDSVPIRRGWARWGICG----IQSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETG-GRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNL-NLVLRIXXXXXXXXXXXXXXXXXXXX----YLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALPM-MSGVA----HNLYMVGGATPMNSASPQLTPWTTLSSPY--TFSPKPNS----FGASFSPIAHSEI-GMSPNPALAFSPM------MSPKTPMDYGFGRYSPSMNPISPA 4720
            SI+ V ++  +   G+ G     Q++ T KP+   FEK+F+FD +NE  L R L E  V+++ T A     L+ E++++ +DRE++R I    TG  +VVLPCN+ R++ N QKIF+I+    TD+ P  +++ V+ L   L++V GDD +S+ A ENATLLF   +RS LC K++ +E+RLS EAFDW+LGEI+T+FNQS+  PGEMVGALAA+SLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKE+IN+S+ PKTPSLTVFL G AA+DAE AK I  RLEHTTLRK+   + IYYDP P+++V+  D+EWV  YYE+PDFD+ + SP+LLRI L RK MTD+KLT++ IAEKI   F +D+ C   DDN   LVLRIR++  ++ K  E  E+ D+     +L  +E+ +L ++ LQGI QISKVY+H P+TD+KKKI+I  DG F+   EWILETDG  L +VL+E+DVD   T SN I EIF   GIEA R A+ERE++HVISFDGSYVNYRHLALLC+ MT +G LM+I RHGINRQ+TG L + SFEETVD+LMEA +H E DPMKGVSE+IMLGQLA  GTGCFD+L++ EKC     +P  + G++      ++     +PM+  SP +TPW T ++P    +SP   S      A FSP A S+  G SP  + A+SP         P +P     G  SP+ +P SPA
Sbjct:  879 SINQV-VQLRYGEDGLAGEAVEFQNMATLKPSHKAFEKKFKFDYANERALRRTLQEDVVKDVMTNAHVQSSLEREFEKMREDREILRAIFP--TGDSKVVLPCNLARMIWNAQKIFRINPRAPTDLNPARVVDGVKELSKKLVIVNGDDQLSRQAQENATLLFNIHLRSTLCSKRMTEEFRLSTEAFDWLLGEIETKFNQSIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKRPKTPSLTVFLLGQAARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQNTVVTEDQEWVNVYYEMPDFDVTRISPWLLRIELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKFQEDEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGINRQDTGPLMKCSFEETVDVLMEASSHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGISVAGPTGMFFGSAPSPMSGMSPAMTPWNTGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPASPYIPSPGALSPNYSPTSPA 1595          

HSP 3 Score: 60.077 bits (144), Expect = 4.466e-8
Identity = 35/80 (43.75%), Postives = 46/80 (57.50%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYS-GNMSYSPTSPQYSPATSGYVANSPSY------GQQNTNSNSGYSPQSP 5695
            Y+PTSP +SP+   Y+P SP T    SP Y+  +  YSPTSP YSP +  Y   SP+Y      G   + ++ GYSP SP
Sbjct: 1871 YSPTSPTYSPTTPKYSPTSP-TYSPTSPTYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSP 1949          

HSP 4 Score: 54.6842 bits (130), Expect = 1.718e-6
Identity = 32/74 (43.24%), Postives = 45/74 (60.81%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYS-GNMSYSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP 5695
            Y+PTSP +SP+   Y+P SP T    +P YS  + +YSPTSP Y+P +  Y   SP+Y    + ++  YSP SP
Sbjct: 1857 YSPTSPKYSPTSPKYSPTSP-TYSPTTPKYSPTSPTYSPTSPTYTPTSPKYSPTSPTY----SPTSPKYSPTSP 1925          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Zebrafish
Match: polr3a (polymerase (RNA) III (DNA directed) polypeptide A [Source:ZFIN;Acc:ZDB-GENE-050208-103])

HSP 1 Score: 598.201 bits (1541), Expect = 0.000e+0
Identity = 348/908 (38.33%), Postives = 530/908 (58.37%), Query Frame = 3
Query:   66 REVKRVQFGILSASEIKR---LSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSK-LLADVNSSNVKEILKK---TEINPRKRFDFMYDECRRNKVCSVPNSDRDEMD----LKT-QEMSRSGCGYVQPIFRRNGLEYFVTLK----XXXXXXXXKQPLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMN-HTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKR-----RPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGR-----LPKPAIYKPLRLWTGKQIFSLIIPGRVNC-IRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGS-SAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVE 2699
            R++  + FG+ S+ ++++   + VV +N  +Y++ T   KP + G++D R G  +K   C+TCG ++A+C GH+G+++L  P FHIG+ + I+ IL+ +C  CS  LL         + L++     +  R     + D+CR+  VC   N+    +     LK   E  +S    V P        + V ++     +S  + +++ L    VL +FRRI ++D  L+  NP+  +P  +I+T L VPPL +RP+VV +  +G + DDLT KLTE++ +N+ I+     G  + +++E  + LQ   A +I++E   +P  +    +  +   QRLKGK GR R NL GKR D+S RTVI+ DPNL +D+V VP  +A+ LT+PEKV   N   +++LV+NG  ++PGA F+ + +   + +KR       +    +L++G+ VERHM++ D V+FNRQP+LHK+S+M H  +V P  TFR N  V +PYNADFDGDEMNLHLPQ+ E KAE   L      ++TP++ +P+++ +QD LT    +T +D F +R +   ++  +           LP PAI KP+RLWTGKQIFSLI+    +C +  +      +  G  + +   D+ V+I + EL+ G + K TLGS S  ++ +I+  +    EA    + +  +   +L   G +IGI D        +  ++ +D   E   E ID      LQ  PG T  +T E  + K L+  RD  GS   + L K N+  +M + G+KGS INISQ+IACVGQQ + G R+P GF+ R+LPHF K    P ++GFV +S+ +GLTPTEFFFH M GREGL+DTAVKTAETGY+QRRL+K++E +  +YD TVR+    +IQF YG DGLD A +E
Sbjct:   13 RKISHICFGMKSSEQMRQQAHIQVVSKN--LYSQDTSH-KPLQYGVLDHRMGTSEKDRPCETCGKNLADCLGHYGYLDLELPCFHIGYFKAIVGILQMICKTCSHILLTKEEKLQFLDYLRRPGLAYLQKRGLKKKISDKCRKKTVCLNCNAFNGSVKKCGLLKIIHEKYKSTKKVVDPAVSDFLQSFDVAIEHNKEVESLLTRAQENLNPLVVLNLFRRIPDKDVPLLLMNPESGKPADLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRMTGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPK-KWTRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTYPEKVNKANIELMRKLVRNGPEVHPGANFIQQRH---MQMKRFLKYGNREKMAQELKFGDVVERHMIDGDIVLFNRQPSLHKLSIMAHIARVKPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIAAIQDFLTGAYLLTLKDTFFDRTKACQIVASILVGKDEKIKISLPHPAILKPIRLWTGKQIFSLILKPSKSCPVMANLRTKGKQYCGKGEDLCANDSFVVIHNSELMCGSMDKGTLGSGSKNNIFYILLRDWGQQEAADAMSRLARLAPVYLSNRGFSIGIGDVTPGQGLLKAKQELLDAGYEKCDEYIDALKTGRLQQQPGCTAEETLEALILKELSVIRDHAGSACLRELDKSNSPLIMALCGSKGSFINISQMIACVGQQAISGSRVPDGFENRSLPHFQKHSKLPAAKGFVADSFYSGLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSTGDIIQFIYGGDGLDPAAME 913          

HSP 2 Score: 187.578 bits (475), Expect = 5.300e-47
Identity = 122/411 (29.68%), Postives = 210/411 (51.09%), Query Frame = 2
Query: 3170 RLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLNLVLRIXXXXXXXXXXXXXXXXXXXXYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDIL 4402
            R++P   +  L   + ++ ++ ++PG  VGAL A+S+GEP TQMTL TFH+AGV++ N+TLGVPR+KEIIN S+N  TP ++  L  N   D + A+ +  R+E T L +++   E  + P+    +++   + +R    L   +++ ++   +R  +   K+  K   +Q   E +        +C  P +N                           Y+       L ++ +QGIP++S+  IH  +                GK ++ L  +G  ++ V+A   V+   T SN+  E+ +T GIEAAR+ I  E+ + +   G  ++ RH+ LL ++M++KG ++ I R G+ + +   L  +SFE+T D L +A    + D + GVSE I++G    IGTG F +L
Sbjct: 1005 RITPTQLEKFLETCRDKYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKNISTPIISANLDTN--DDPDFARLVKGRIEKTLLGEISEYIEEVFLPDDTFILVKLSLDRIR----LLRLEVNAET---VRYSICTSKLRVKPGDVQVHGEAV--------VCVSPREN---------------------SKSSMYYVLQSLKQDLPKVVVQGIPEVSRAVIHIDEQ--------------SGKQKFKLLVEGDNMRSVMATHGVNGSKTTSNNTYEVEKTLGIEAARSTIINEIQYTMVNHGMSIDRRHVMLLADLMSYKGEILGITRFGLAKMKESVLMLASFEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLL 1363          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Zebrafish
Match: polr1a (RNA polymerase I subunit A [Source:ZFIN;Acc:ZDB-GENE-030131-5286])

HSP 1 Score: 329.331 bits (843), Expect = 1.255e-90
Identity = 210/614 (34.20%), Postives = 314/614 (51.14%), Query Frame = 3
Query: 1011 LKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDL----KRRPDSSDIQLQYGET---------VERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFS-TFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMY-LPTWNGR--LPKPAIYKPLRLWTGKQIFSL----IIP---------GRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWL-LIEGHTIGIVDALYDAKTREEIKQTI-------DRAKEAVFETIDKAHNYE-----------LQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
            ++Q L+ K G  R ++MGKR DY+AR+VI  D  +  +++G+P + A  LT+P+ VTP+N   ++Q V NG  ++PGA  V+ E+G R  L    + + ++   QL    T         V RH+ N D ++ NRQPTLH+ S+  H  ++LP     RL+ +    YNADFDGDEMN H PQS  ++AE   L    +  + P+  KP+  ++QD + +   MT R  F  R +   L+   L    GR  L  P + KP+ LWTGKQ+ S     +IP         G+            P     Y   S  +++V+I  GEL+ G+L K   GSSA  L+H        + +G   + +  +   +L L  G T+G+ D L      ++ K+ I        +A +A F     A + E           +     N +   F+  VN++ N+                NN  +MV SGAKGS +N  Q+   +GQ  +EG+R P     ++LP F   +  P S GFV   +L G+ P EFFFH M GREGL+DTAVKT+ +GY+QR +IK +E ++++YD TVR+    ++QF YGEDGLD    +F
Sbjct:  402 VRQLLEKKEGLFRKHMMGKRVDYAARSVICPDMYIGTNEIGIPMVFATKLTYPQPVTPWNVKEMRQAVLNGPNIHPGATMVVNEDGSRTILSSTNQTQREAVAKQLLTPSTGQHRIPMKIVNRHIKNGDVLLLNRQPTLHRPSIQAHCARILPGEKVLRLHYANCKAYNADFDGDEMNAHFPQSELSRAEAYTLVSTDQQYLVPKDGKPLAGLIQDHMVSGTSMTIRGCFFTRDQYTALVYRGLTDKIGRVKLLPPTLIKPVLLWTGKQVVSTLLLNVIPENSIPLNLTGKAKIPGKAWVKESPRPVPGYVPESMCESQVVIRQGELLMGVLDKAHYGSSAYGLVHCCYELYGGETSGKLLSCLARLFTAYLQLYRGFTLGVEDILVKDGANKQRKKIIKKSVTCGSKALQAAFNLPASAEDTEARERWQDAHLNIDQRDFNMVDLKFKEEVNQVNNNINKVCMPLGLHRSFPENNLQMMVQSGAKGSTVNTMQISCLLGQIELEGRRPPLMPSGKSLPCFQPYEPQPRSGGFVTGRFLTGIKPPEFFFHCMAGREGLVDTAVKTSRSGYLQRCVIKHLEGLVVQYDLTVRDSDGSVVQFLYGEDGLDIPKTQF 1015          

HSP 2 Score: 86.6557 bits (213), Expect = 3.676e-16
Identity = 51/138 (36.96%), Postives = 82/138 (59.42%), Query Frame = 2
Query: 3116 FCCLIRSMLCCKKVIDEYRLSPEA--FDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINV-SRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEI 3520
            F  ++ S L    +  E+  S E    D +   ++ ++ ++L  PGE VG +AA+S+GEP+TQMTLNTFH+AG    NVTLG+PRL+EI+ V S N KTP +++ +  N  K  +  K++  ++    L ++  K  +
Sbjct: 1147 FDSIVESYLNQFNIKQEFSASSETTDADRLRNLLQLKWQRALCDPGEAVGLVAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILLVASSNIKTPMMSIPVVMN-KKALKQVKTLRKKITRVCLSEVLHKVNV 1283          

HSP 3 Score: 73.559 bits (179), Expect = 3.222e-12
Identity = 44/156 (28.21%), Postives = 81/156 (51.92%), Query Frame = 2
Query: 3935 KIVINSDGAFEGKAEWILETDGTCLQKVLAERDV-DSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDI 4399
            + ++N     +G  E +L T+G  + ++    D+ D +   SN +  +  T+GIE A   IE+E+  V +  G  V+ RHL+L+ + M  +G    ++R GI +  +  L + +FE +   L +A      D +   S  +++G++ K GTG FD+
Sbjct: 1525 RCLLNEVTRKDGSKEIMLNTEGINIHEMFKYADILDLKRLYSNEVHAMASTYGIEVALRVIEKEIKDVFAVYGIEVDPRHLSLVADYMCFEGVYKPLNRFGI-QSNSSPLQQMTFETSFKFLKQATMLGSYDKLSSPSACLVVGKVVKGGTGIFDL 1679          

HSP 4 Score: 72.7886 bits (177), Expect = 5.337e-12
Identity = 39/107 (36.45%), Postives = 54/107 (50.47%), Query Frame = 3
Query:   60 PLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQD--GKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKL 374
            P R ++ + FG+ SA E ++LSV      I   +  D  G    +GL D   GP D    C TC    + CPGHFGHI L  PV++  F +K+  ++R  C  C  L
Sbjct:    8 PWRRLEGMSFGLFSADETRKLSV----KTITNPQLLDNVGNAAANGLYDLALGPADNKEICSTCMQDFSSCPGHFGHIELPLPVYNPLFFDKLYLLIRGSCLSCHIL 110          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Zebrafish
Match: polr1a (RNA polymerase I subunit A [Source:ZFIN;Acc:ZDB-GENE-030131-5286])

HSP 1 Score: 329.331 bits (843), Expect = 1.287e-90
Identity = 210/614 (34.20%), Postives = 314/614 (51.14%), Query Frame = 3
Query: 1011 LKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDL----KRRPDSSDIQLQYGET---------VERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFS-TFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMY-LPTWNGR--LPKPAIYKPLRLWTGKQIFSL----IIP---------GRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWL-LIEGHTIGIVDALYDAKTREEIKQTI-------DRAKEAVFETIDKAHNYE-----------LQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
            ++Q L+ K G  R ++MGKR DY+AR+VI  D  +  +++G+P + A  LT+P+ VTP+N   ++Q V NG  ++PGA  V+ E+G R  L    + + ++   QL    T         V RH+ N D ++ NRQPTLH+ S+  H  ++LP     RL+ +    YNADFDGDEMN H PQS  ++AE   L    +  + P+  KP+  ++QD + +   MT R  F  R +   L+   L    GR  L  P + KP+ LWTGKQ+ S     +IP         G+            P     Y   S  +++V+I  GEL+ G+L K   GSSA  L+H        + +G   + +  +   +L L  G T+G+ D L      ++ K+ I        +A +A F     A + E           +     N +   F+  VN++ N+                NN  +MV SGAKGS +N  Q+   +GQ  +EG+R P     ++LP F   +  P S GFV   +L G+ P EFFFH M GREGL+DTAVKT+ +GY+QR +IK +E ++++YD TVR+    ++QF YGEDGLD    +F
Sbjct:  411 VRQLLEKKEGLFRKHMMGKRVDYAARSVICPDMYIGTNEIGIPMVFATKLTYPQPVTPWNVKEMRQAVLNGPNIHPGATMVVNEDGSRTILSSTNQTQREAVAKQLLTPSTGQHRIPMKIVNRHIKNGDVLLLNRQPTLHRPSIQAHCARILPGEKVLRLHYANCKAYNADFDGDEMNAHFPQSELSRAEAYTLVSTDQQYLVPKDGKPLAGLIQDHMVSGTSMTIRGCFFTRDQYTALVYRGLTDKIGRVKLLPPTLIKPVLLWTGKQVVSTLLLNVIPENSIPLNLTGKAKIPGKAWVKESPRPVPGYVPESMCESQVVIRQGELLMGVLDKAHYGSSAYGLVHCCYELYGGETSGKLLSCLARLFTAYLQLYRGFTLGVEDILVKDGANKQRKKIIKKSVTCGSKALQAAFNLPASAEDTEARERWQDAHLNIDQRDFNMVDLKFKEEVNQVNNNINKVCMPLGLHRSFPENNLQMMVQSGAKGSTVNTMQISCLLGQIELEGRRPPLMPSGKSLPCFQPYEPQPRSGGFVTGRFLTGIKPPEFFFHCMAGREGLVDTAVKTSRSGYLQRCVIKHLEGLVVQYDLTVRDSDGSVVQFLYGEDGLDIPKTQF 1024          

HSP 2 Score: 86.6557 bits (213), Expect = 3.620e-16
Identity = 51/138 (36.96%), Postives = 82/138 (59.42%), Query Frame = 2
Query: 3116 FCCLIRSMLCCKKVIDEYRLSPEA--FDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINV-SRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEI 3520
            F  ++ S L    +  E+  S E    D +   ++ ++ ++L  PGE VG +AA+S+GEP+TQMTLNTFH+AG    NVTLG+PRL+EI+ V S N KTP +++ +  N  K  +  K++  ++    L ++  K  +
Sbjct: 1156 FDSIVESYLNQFNIKQEFSASSETTDADRLRNLLQLKWQRALCDPGEAVGLVAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILLVASSNIKTPMMSIPVVMN-KKALKQVKTLRKKITRVCLSEVLHKVNV 1292          

HSP 3 Score: 73.559 bits (179), Expect = 3.172e-12
Identity = 44/156 (28.21%), Postives = 81/156 (51.92%), Query Frame = 2
Query: 3935 KIVINSDGAFEGKAEWILETDGTCLQKVLAERDV-DSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDI 4399
            + ++N     +G  E +L T+G  + ++    D+ D +   SN +  +  T+GIE A   IE+E+  V +  G  V+ RHL+L+ + M  +G    ++R GI +  +  L + +FE +   L +A      D +   S  +++G++ K GTG FD+
Sbjct: 1534 RCLLNEVTRKDGSKEIMLNTEGINIHEMFKYADILDLKRLYSNEVHAMASTYGIEVALRVIEKEIKDVFAVYGIEVDPRHLSLVADYMCFEGVYKPLNRFGI-QSNSSPLQQMTFETSFKFLKQATMLGSYDKLSSPSACLVVGKVVKGGTGIFDL 1688          

HSP 4 Score: 72.7886 bits (177), Expect = 5.123e-12
Identity = 39/107 (36.45%), Postives = 54/107 (50.47%), Query Frame = 3
Query:   60 PLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQD--GKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKL 374
            P R ++ + FG+ SA E ++LSV      I   +  D  G    +GL D   GP D    C TC    + CPGHFGHI L  PV++  F +K+  ++R  C  C  L
Sbjct:    8 PWRRLEGMSFGLFSADETRKLSV----KTITNPQLLDNVGNAAANGLYDLALGPADNKEICSTCMQDFSSCPGHFGHIELPLPVYNPLFFDKLYLLIRGSCLSCHIL 110          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Xenopus
Match: ctdnep1 (CTD nuclear envelope phosphatase 1 [Source:Xenbase;Acc:XB-GENE-5939296])

HSP 1 Score: 1226.85 bits (3173), Expect = 0.000e+0
Identity = 588/895 (65.70%), Postives = 718/895 (80.22%), Query Frame = 3
Query:   54 SVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVC----------SVPNSDRDEMDLKTQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQPLRAYQ-VLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
            + PLR +KRVQFG++   E+KR+SV  E GI Y E T+ G+PK  GLMDPRQG  ++   CQTC G++ ECPGHFGHI LA+PVFH+GF  K +K+LR VCF CSKLL D N+  +K+IL K++  P+KR   +Y+ C+   +C           V  ++ DE D++ +E    GCG  QP  RR GLE +   K  + DS  K+ L + + V EIF+RIT+E+C ++G +P+++RPE +I+TVL VPPL+VRPAVVM  + ++ DDLTHKL ++VK+NN++R  E+NG A+ ++ E    LQ+HVAT +DNE P LP A+QKSGRPLK+LKQRLKGK GR+R NLMGKR D+SARTVIT DPNL++DQVGVPR IA N+TFPE VTPFN   LQ+LV+ G + YPGA ++IR+NGDRIDL+  P  SD+ LQ G  VERHM + D V+FNRQPTLHKMSMM HRV++LP+STFRLNLSVT+PYNADFDGDEMNLHLPQSLET+AE+ +LA V ++I+TPQSN+PVM IVQDTLTA  K T RDVFL R EVM+LLM+L TW+G++P+PAI KP  LWTGKQIFSLI+PG +NCIRTHSTHP+ E++GPYK ISPGDTKV++E+GELI GILCKK+LG+SAGSL+HI  LE   D    F++N+QTV+NNWLLIEGHTIGI D++ DAKT ++I+ TI +AK+ V E I+KAHN EL+ TPGNTLRQTFE  VN+ILNDARDKTGS AQKSLS+YNNF  MV+SGAKGSKINISQVIA VGQQNVEGKRIPFGF+ RTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIK+MESVM+KYD+TVRN I+Q++Q RYGEDGL G  VEF
Sbjct:   10 ACPLRTIKRVQFGVIGPDELKRMSVT-EGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDANNPKIKDILIKSKGQPKKRLTHVYELCKGKNICEGGEEMDNKFGVEQTEGDE-DIQ-KEKGHGGCGRYQPRIRRTGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRITDEECFILGMDPRFARPEWLIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFPEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQIGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIVPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVIVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDTTRLFYSNIQTVINNWLLIEGHTIGIGDSIADAKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGEGVEF 901          

HSP 2 Score: 432.565 bits (1111), Expect = 8.351e-124
Identity = 218/406 (53.69%), Postives = 298/406 (73.40%), Query Frame = 2
Query: 2699 IQSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETG-GRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNL-NLVLRIXXXXXXXXXXXXXXXXXXX---XYLELVENLILDEICLQGIPQISKV 3901
             Q+L T KP+   FEK+F+FD +NE  L R L E  V+EI ++A    +L+ E++++ +DRE++R I    TG  +VVLPCN+ R++ N QKIF I+    +D+ P+ ++E V  L   L++V GDD +S+ A ENATLLF   +RS LC +++++E+RLS EAFDW+LGEI+++FNQ++  PGEMVGALAA+SLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKE+IN+S+ PKTPSLTVFL G +A+DAE AK I  RLEHTTLRK+   + IYYDP P+++V+  D+EWV  YYE+PDFD+ + SP+LLR+ L RK MTD+KLT++ IAEKI   F +D+ C   DDN   LVLRIR++  E+ K  ++  ++      +L  +E+ +L ++ LQGI QISKV
Sbjct:  901 FQNLATLKPSNKAFEKKFKFDYANERALRRTLQEDVVKEILSDAHVQNELEKEFEKMKEDREVLRVIFP--TGDSKVVLPCNLQRMIWNAQKIFHINTRMPSDLHPIKVVEGVRELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMVEEFRLSGEAFDWLLGEIESKFNQAVAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQNTVVSEDQEWVNVYYEMPDFDVTRISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSEENKMQDEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKV 1304          

HSP 3 Score: 97.4413 bits (241), Expect = 2.329e-19
Identity = 67/169 (39.64%), Postives = 85/169 (50.30%), Query Frame = 2
Query: 4283 TVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALP-----MMSGVAHNLYMVGGATPMNSASPQLTPWTTLSSPYTFSPKPNSFGASFSPIAHSEIGMSPNP---ALAFSPMMSPKTPMDYGF---------------GRYSPSMNPISPA 4720
            +VD+LMEA AH E DPMKGVSE+I LGQLA  GTGCFD+L+  EKC     +P     +  G A  ++     +PM   SP +TPW   ++P   +  P S G+  +P A    G SP+    A  FSP  SP      G                G  SPS +P SPA
Sbjct: 1417 SVDVLMEAPAHGESDPMKGVSENIFLGQLAPAGTGCFDLLLEAEKCKLGMEIPKKIPGLGGGGATGMFFGTAPSPMGGMSPAMTPWNQGATPAYGAWSP-SIGSGMTPGA---AGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPA 1581          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Xenopus
Match: ctdnep1 (CTD nuclear envelope phosphatase 1 [Source:Xenbase;Acc:XB-GENE-5939296])

HSP 1 Score: 1226.46 bits (3172), Expect = 0.000e+0
Identity = 588/895 (65.70%), Postives = 718/895 (80.22%), Query Frame = 3
Query:   54 SVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVC----------SVPNSDRDEMDLKTQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQPLRAYQ-VLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
            + PLR +KRVQFG++   E+KR+SV  E GI Y E T+ G+PK  GLMDPRQG  ++   CQTC G++ ECPGHFGHI LA+PVFH+GF  K +K+LR VCF CSKLL D N+  +K+IL K++  P+KR   +Y+ C+   +C           V  ++ DE D++ +E    GCG  QP  RR GLE +   K  + DS  K+ L + + V EIF+RIT+E+C ++G +P+++RPE +I+TVL VPPL+VRPAVVM  + ++ DDLTHKL ++VK+NN++R  E+NG A+ ++ E    LQ+HVAT +DNE P LP A+QKSGRPLK+LKQRLKGK GR+R NLMGKR D+SARTVIT DPNL++DQVGVPR IA N+TFPE VTPFN   LQ+LV+ G + YPGA ++IR+NGDRIDL+  P  SD+ LQ G  VERHM + D V+FNRQPTLHKMSMM HRV++LP+STFRLNLSVT+PYNADFDGDEMNLHLPQSLET+AE+ +LA V ++I+TPQSN+PVM IVQDTLTA  K T RDVFL R EVM+LLM+L TW+G++P+PAI KP  LWTGKQIFSLI+PG +NCIRTHSTHP+ E++GPYK ISPGDTKV++E+GELI GILCKK+LG+SAGSL+HI  LE   D    F++N+QTV+NNWLLIEGHTIGI D++ DAKT ++I+ TI +AK+ V E I+KAHN EL+ TPGNTLRQTFE  VN+ILNDARDKTGS AQKSLS+YNNF  MV+SGAKGSKINISQVIA VGQQNVEGKRIPFGF+ RTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIK+MESVM+KYD+TVRN I+Q++Q RYGEDGL G  VEF
Sbjct:   10 ACPLRTIKRVQFGVIGPDELKRMSVT-EGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDANNPKIKDILIKSKGQPKKRLTHVYELCKGKNICEGGEEMDNKFGVEQTEGDE-DIQ-KEKGHGGCGRYQPRIRRTGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRITDEECFILGMDPRFARPEWLIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFPEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQIGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIVPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVIVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDTTRLFYSNIQTVINNWLLIEGHTIGIGDSIADAKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGEGVEF 901          

HSP 2 Score: 431.795 bits (1109), Expect = 7.129e-124
Identity = 220/407 (54.05%), Postives = 300/407 (73.71%), Query Frame = 2
Query: 2699 IQSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETG-GRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNL-NLVLRIXXXXXXXXXXXXXXXXXXXX----YLELVENLILDEICLQGIPQISKV 3901
             Q+L T KP+   FEK+F+FD +NE  L R L E  V+EI ++A    +L+ E++++ +DRE++R I    TG  +VVLPCN+ R++ N QKIF I+    +D+ P+ ++E V  L   L++V GDD +S+ A ENATLLF   +RS LC +++++E+RLS EAFDW+LGEI+++FNQ++  PGEMVGALAA+SLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKE+IN+S+ PKTPSLTVFL G +A+DAE AK I  RLEHTTLRK+   + IYYDP P+++V+  D+EWV  YYE+PDFD+ + SP+LLR+ L RK MTD+KLT++ IAEKI   F +D+ C   DDN   LVLRIR++  E+ K  ++ E+ D+     +L  +E+ +L ++ LQGI QISKV
Sbjct:  901 FQNLATLKPSNKAFEKKFKFDYANERALRRTLQEDVVKEILSDAHVQNELEKEFEKMKEDREVLRVIFP--TGDSKVVLPCNLQRMIWNAQKIFHINTRMPSDLHPIKVVEGVRELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMVEEFRLSGEAFDWLLGEIESKFNQAVAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQNTVVSEDQEWVNVYYEMPDFDVTRISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSEENKMQDEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKV 1305          

HSP 3 Score: 77.0258 bits (188), Expect = 3.524e-13
Identity = 34/53 (64.15%), Postives = 40/53 (75.47%), Query Frame = 2
Query: 4283 TVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALP 4441
            +VD+LMEA AH E DPMKGVSE+I LGQLA  GTGCFD+L+  EKC     +P
Sbjct: 1398 SVDVLMEAPAHGESDPMKGVSENIFLGQLAPAGTGCFDLLLEAEKCKLGMEIP 1450          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Xenopus
Match: polr3a (polymerase (RNA) III (DNA directed) polypeptide A, 155kDa [Source:NCBI gene;Acc:100124725])

HSP 1 Score: 597.43 bits (1539), Expect = 0.000e+0
Identity = 344/905 (38.01%), Postives = 527/905 (58.23%), Query Frame = 3
Query:   66 REVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILK------KTEINPRKRFDFMYDECRRNKVC---SVPNSDRDEMDLK--TQEMSRSGCGYVQPIFRRNGLEYFVTL-----KXXXXXXXXKQPLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMN-HTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKRRPDSSDI--QLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNG-----RLPKPAIYKPLRLWTGKQIFSLII-PGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGS-SAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVE 2699
            +++  + FG+ SA ++++ + +         +  +  P   G++D R G  +K  +CQTCG ++AEC GH+G+++L  P FH+G+ + +I IL+ +C  CS++L  +N+   K+ L        T +  R     + D+CR+  VC      N    +  L     E  ++    V P+   + L+ F T      + +S    +++ L    VL + R+I  ED  L+  NP+  +P  +I+T L VPPL +RP+VV +  +G + DDLT KLTE++ +N+ I+     G  + +++E  + LQ   A +I++E   +P  +    +  +   QRLKGK GR R NL GKR D+S RTVI+ DPNL +D+V VP  +A+ LTFPEKV   N   +++LV+NG  ++PGA F+ + +       +  +   I  +L++G+ VERH+++ D V+FNRQP+LHK+S+M H  +V P  TFR N  V +PYNADFDGDEMNLHLPQ+ E KAE   L      ++TP++ +P+++ +QD LTA   +T +D F +RA+   ++  +          RLP PAI KP+ LWTGKQ+FSLI+ P   N +R +      +  G  + +   D+ V I++ EL+ G L K TLGS S  ++ +I+  +    EA    + +  +   +L   G +IGI D        +  +  +D   +   E I+  +  +LQ  PG +  +T E  + + L+  RD  GS   + L K N+  +M + G+KGS INISQ+IACVGQQ + G R+P GF+ R+LPHF K    P ++GFV NS+ +GLTPTEFFFH M GREGL+DTAVKTAETGY+QRRL+K++E +  +YD TVR+    +IQF YG DGLD A +E
Sbjct:   12 KKISHICFGVKSAEQMRQQAHIQIVSKSLYSQDNNHTPLAFGVLDHRMGTSEKDRHCQTCGKNLAECLGHYGYLDLELPCFHVGYFKAVIGILQMICKTCSRIL--LNAEERKQFLDFLKRPGLTYLQKRGLKKKISDKCRKKTVCLYCGAYNGSVKKCGLLKIIHEKYKTTKKVVDPMVS-HFLQSFDTAIEHNKEVESLLGRAQENLNPLIVLNLLRQIPAEDIPLLLMNPEAGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRITGAKTQMIMEDWDFLQLQCALYINSELSGIPMNMAPK-KWTRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNQANMQLMRKLVQNGPDVHPGANFIQQRHTQMKRFLKYGNREKIAQELRFGDIVERHLIDGDIVLFNRQPSLHKLSIMAHIARVKPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEAYVLMGTKANLVTPRNGEPLIAAIQDFLTAAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPAILKPVTLWTGKQVFSLILQPSHDNPVRANLRTKGKQYCGKGEDLCHNDSYVTIQNSELMCGSLDKGTLGSGSKNNIFYILLRDWGQVEAADAMSRLARLAPVFLSNRGFSIGIGDVTPGQGLLKAKQDLLDAGYKKCDEYIEALNTGKLQPQPGCSAEETLEALILRELSVIRDHAGSACLRELDKSNSPLIMALCGSKGSFINISQMIACVGQQAISGSRVPDGFENRSLPHFEKHSKLPAAKGFVANSFYSGLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSTGDIIQFIYGGDGLDPAAME 912          

HSP 2 Score: 188.348 bits (477), Expect = 4.200e-47
Identity = 127/416 (30.53%), Postives = 214/416 (51.44%), Query Frame = 2
Query: 3170 RLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLNLVLRIXXXXXXXXXXXXXXXXXXXXYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEK 4417
            R++P   +  L   + ++ ++ ++PG  VGAL A+S+GEP TQMTL TFH+AGV++ N+TLGVPR+KEIIN S+N  TP +T  L  +   DA+ A+ +  R+E T L +++   E  + P+    +++   E +R    L   +++ ++   +R  +   K+  K   +    E +        +C  P +N                              L E+L   ++ +QGIP++++  IH    D++            GK ++ L  +G  L+ V+A   V    T SN+  E+ +T GIEAAR+ I  E+ + +   G  ++ RH+ LL ++MT+KG ++ I R G+ + +   L  +SFE+T D L +A    + D + GVSE I++G    IGTG F +L   +K
Sbjct: 1004 RITPTQLEKFLETCRDKYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKNISTPIITAHL--DIDDDADFARLVKGRIEKTLLGEISEYIEEVFLPDDCFLLVKLSLERIR----LLRLEVNAET---VRYSICMSKLRVKPGDIAVHGEAV--------LCVTPREN-------------------SKSSMYYVLQSLKEDL--PKVVVQGIPEVARAVIH---IDEQ-----------SGKEKYKLLVEGDNLRSVMATHGVKGSRTTSNNTYEVEKTLGIEAARSTIINEIQYTMVNHGMSIDRRHVMLLADLMTYKGEVLGITRFGLAKMKESVLMLASFEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADK 1367          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Xenopus
Match: polr3a (polymerase (RNA) III (DNA directed) polypeptide A, 155kDa [Source:NCBI gene;Acc:100124725])

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 346/909 (38.06%), Postives = 532/909 (58.53%), Query Frame = 3
Query:   63 LREVKRVQFGILSASEIKR---LSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILK------KTEINPRKRFDFMYDECRRNKVC---SVPNSDRDEMDLK--TQEMSRSGCGYVQPIFRRNGLEYFVTL-----KXXXXXXXXKQPLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMN-HTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKRRPDSSDI--QLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNG-----RLPKPAIYKPLRLWTGKQIFSLII-PGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGS-SAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVE 2699
             + +  + FG+ SA ++++   + +V ++  +Y++   +  P   G++D R G  +K  +CQTCG ++AEC GH+G+++L  P FH+G+ + +I IL+ +C  CS++L  +N+   K+ L        T +  R     + D+CR+  VC      N    +  L     E  ++    V P+   + L+ F T      + +S    +++ L    VL + R+I  ED  L+  NP+  +P  +I+T L VPPL +RP+VV +  +G + DDLT KLTE++ +N+ I+     G  + +++E  + LQ   A +I++E   +P  +    +  +   QRLKGK GR R NL GKR D+S RTVI+ DPNL +D+V VP  +A+ LTFPEKV   N   +++LV+NG  ++PGA F+ + +       +  +   I  +L++G+ VERH+++ D V+FNRQP+LHK+S+M H  +V P  TFR N  V +PYNADFDGDEMNLHLPQ+ E KAE   L      ++TP++ +P+++ +QD LTA   +T +D F +RA+   ++  +          RLP PAI KP+ LWTGKQ+FSLI+ P   N +R +      +  G  + +   D+ V I++ EL+ G L K TLGS S  ++ +I+  +    EA    + +  +   +L   G +IGI D        +  +  +D   +   E I+  +  +LQ  PG +  +T E  + + L+  RD  GS   + L K N+  +M + G+KGS INISQ+IACVGQQ + G R+P GF+ R+LPHF K    P ++GFV NS+ +GLTPTEFFFH M GREGL+DTAVKTAETGY+QRRL+K++E +  +YD TVR+    +IQF YG DGLD A +E
Sbjct:    2 FKSISHICFGVKSAEQMRQQAHIQIVSKS--LYSQDN-NHTPLAFGVLDHRMGTSEKDRHCQTCGKNLAECLGHYGYLDLELPCFHVGYFKAVIGILQMICKTCSRIL--LNAEERKQFLDFLKRPGLTYLQKRGLKKKISDKCRKKTVCLYCGAYNGSVKKCGLLKIIHEKYKTTKKVVDPMVS-HFLQSFDTAIEHNKEVESLLGRAQENLNPLIVLNLLRQIPAEDIPLLLMNPEAGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRITGAKTQMIMEDWDFLQLQCALYINSELSGIPMNMAPK-KWTRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNQANMQLMRKLVQNGPDVHPGANFIQQRHTQMKRFLKYGNREKIAQELRFGDIVERHLIDGDIVLFNRQPSLHKLSIMAHIARVKPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEAYVLMGTKANLVTPRNGEPLIAAIQDFLTAAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPAILKPVTLWTGKQVFSLILQPSHDNPVRANLRTKGKQYCGKGEDLCHNDSYVTIQNSELMCGSLDKGTLGSGSKNNIFYILLRDWGQVEAADAMSRLARLAPVFLSNRGFSIGIGDVTPGQGLLKAKQDLLDAGYKKCDEYIEALNTGKLQPQPGCSAEETLEALILRELSVIRDHAGSACLRELDKSNSPLIMALCGSKGSFINISQMIACVGQQAISGSRVPDGFENRSLPHFEKHSKLPAAKGFVANSFYSGLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSTGDIIQFIYGGDGLDPAAME 903          

HSP 2 Score: 188.348 bits (477), Expect = 3.417e-47
Identity = 127/416 (30.53%), Postives = 214/416 (51.44%), Query Frame = 2
Query: 3170 RLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLNLVLRIXXXXXXXXXXXXXXXXXXXXYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEK 4417
            R++P   +  L   + ++ ++ ++PG  VGAL A+S+GEP TQMTL TFH+AGV++ N+TLGVPR+KEIIN S+N  TP +T  L  +   DA+ A+ +  R+E T L +++   E  + P+    +++   E +R    L   +++ ++   +R  +   K+  K   +    E +        +C  P +N                              L E+L   ++ +QGIP++++  IH    D++            GK ++ L  +G  L+ V+A   V    T SN+  E+ +T GIEAAR+ I  E+ + +   G  ++ RH+ LL ++MT+KG ++ I R G+ + +   L  +SFE+T D L +A    + D + GVSE I++G    IGTG F +L   +K
Sbjct:  995 RITPTQLEKFLETCRDKYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKNISTPIITAHL--DIDDDADFARLVKGRIEKTLLGEISEYIEEVFLPDDCFLLVKLSLERIR----LLRLEVNAET---VRYSICMSKLRVKPGDIAVHGEAV--------LCVTPREN-------------------SKSSMYYVLQSLKEDL--PKVVVQGIPEVARAVIH---IDEQ-----------SGKEKYKLLVEGDNLRSVMATHGVKGSRTTSNNTYEVEKTLGIEAARSTIINEIQYTMVNHGMSIDRRHVMLLADLMTYKGEVLGITRFGLAKMKESVLMLASFEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADK 1358          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Xenopus
Match: polr3a (polymerase (RNA) III (DNA directed) polypeptide A, 155kDa [Source:NCBI gene;Acc:100124725])

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 340/868 (39.17%), Postives = 510/868 (58.76%), Query Frame = 3
Query:  177 PKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILK------KTEINPRKRFDFMYDECRRNKVC---SVPNSDRDEMDLK--TQEMSRSGCGYVQPIFRRNGLEYFVTL-----KXXXXXXXXKQPLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMN-HTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKRRPDSSDI--QLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNG-----RLPKPAIYKPLRLWTGKQIFSLII-PGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGS-SAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVE 2699
            P   G++D R G  +K  +CQTCG ++AEC GH+G+++L  P FH+G+ + +I IL+ +C  CS++L  +N+   K+ L        T +  R     + D+CR+  VC      N    +  L     E  ++    V P+   + L+ F T      + +S    +++ L    VL + R+I  ED  L+  NP+  +P  +I+T L VPPL +RP+VV +  +G + DDLT KLTE++ +N+ I+     G  + +++E  + LQ   A +I++E   +P  +    +  +   QRLKGK GR R NL GKR D+S RTVI+ DPNL +D+V VP  +A+ LTFPEKV   N   +++LV+NG  ++PGA F+ + +       +  +   I  +L++G+ VERH+++ D V+FNRQP+LHK+S+M H  +V P  TFR N  V +PYNADFDGDEMNLHLPQ+ E KAE   L      ++TP++ +P+++ +QD LTA   +T +D F +RA+   ++  +          RLP PAI KP+ LWTGKQ+FSLI+ P   N +R +      +  G  + +   D+ V I++ EL+ G L K TLGS S  ++ +I+  +    EA    + +  +   +L   G +IGI D        +  +  +D   +   E I+  +  +LQ  PG +  +T E  + + L+  RD  GS   + L K N+  +M + G+KGS INISQ+IACVGQQ + G R+P GF+ R+LPHF K    P ++GFV NS+ +GLTPTEFFFH M GREGL+DTAVKTAETGY+QRRL+K++E +  +YD TVR+    +IQF YG DGLD A +E
Sbjct:   31 PLAFGVLDHRMGTSEKDRHCQTCGKNLAECLGHYGYLDLELPCFHVGYFKAVIGILQMICKTCSRIL--LNAEERKQFLDFLKRPGLTYLQKRGLKKKISDKCRKKTVCLYCGAYNGSVKKCGLLKIIHEKYKTTKKVVDPMVS-HFLQSFDTAIEHNKEVESLLGRAQENLNPLIVLNLLRQIPAEDIPLLLMNPEAGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRITGAKTQMIMEDWDFLQLQCALYINSELSGIPMNMAPK-KWTRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNQANMQLMRKLVQNGPDVHPGANFIQQRHTQMKRFLKYGNREKIAQELRFGDIVERHLIDGDIVLFNRQPSLHKLSIMAHIARVKPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEAYVLMGTKANLVTPRNGEPLIAAIQDFLTAAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPAILKPVTLWTGKQVFSLILQPSHDNPVRANLRTKGKQYCGKGEDLCHNDSYVTIQNSELMCGSLDKGTLGSGSKNNIFYILLRDWGQVEAADAMSRLARLAPVFLSNRGFSIGIGDVTPGQGLLKAKQDLLDAGYKKCDEYIEALNTGKLQPQPGCSAEETLEALILRELSVIRDHAGSACLRELDKSNSPLIMALCGSKGSFINISQMIACVGQQAISGSRVPDGFENRSLPHFEKHSKLPAAKGFVANSFYSGLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSTGDIIQFIYGGDGLDPAAME 894          

HSP 2 Score: 188.348 bits (477), Expect = 3.743e-47
Identity = 127/416 (30.53%), Postives = 214/416 (51.44%), Query Frame = 2
Query: 3170 RLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLNLVLRIXXXXXXXXXXXXXXXXXXXXYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEK 4417
            R++P   +  L   + ++ ++ ++PG  VGAL A+S+GEP TQMTL TFH+AGV++ N+TLGVPR+KEIIN S+N  TP +T  L  +   DA+ A+ +  R+E T L +++   E  + P+    +++   E +R    L   +++ ++   +R  +   K+  K   +    E +        +C  P +N                              L E+L   ++ +QGIP++++  IH    D++            GK ++ L  +G  L+ V+A   V    T SN+  E+ +T GIEAAR+ I  E+ + +   G  ++ RH+ LL ++MT+KG ++ I R G+ + +   L  +SFE+T D L +A    + D + GVSE I++G    IGTG F +L   +K
Sbjct:  986 RITPTQLEKFLETCRDKYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKNISTPIITAHL--DIDDDADFARLVKGRIEKTLLGEISEYIEEVFLPDDCFLLVKLSLERIR----LLRLEVNAET---VRYSICMSKLRVKPGDIAVHGEAV--------LCVTPREN-------------------SKSSMYYVLQSLKEDL--PKVVVQGIPEVARAVIH---IDEQ-----------SGKEKYKLLVEGDNLRSVMATHGVKGSRTTSNNTYEVEKTLGIEAARSTIINEIQYTMVNHGMSIDRRHVMLLADLMTYKGEVLGITRFGLAKMKESVLMLASFEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADK 1349          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Mouse
Match: Polr2a (polymerase (RNA) II (DNA directed) polypeptide A [Source:MGI Symbol;Acc:MGI:98086])

HSP 1 Score: 1231.08 bits (3184), Expect = 0.000e+0
Identity = 592/897 (66.00%), Postives = 716/897 (79.82%), Query Frame = 3
Query:   54 SVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDRDEMDLK------------TQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQPLRAYQ-VLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
            + PLR +KRVQFG+LS  E+KR+SV  E GI Y E T+ G+PK  GLMDPRQG  ++   CQTC G++ ECPGHFGHI LA+PVFH+GF  K +K+LR VCF CSKLL D N+  +K+IL K++  P+KR   +YD C+   +C       +EMD K            T+E    GCG  QP  RR+GLE +   K  + DS  K+ L + + V EIF+RI++E+C ++G  P+Y+RPE MI+TVL VPPL+VRPAVVM  + ++ DDLTHKL ++VK+NN++R  E+NG A+ ++ E    LQ+HVAT +DNE P LP A+QKSGRPLK+LKQRLKGK GR+R NLMGKR D+SARTVIT DPNL++DQVGVPR IA N+TF E VTPFN   LQ+LV+ G + YPGA ++IR+NGDRIDL+  P  SD+ LQ G  VERHM + D V+FNRQPTLHKMSMM HRV++LP+STFRLNLSVT+PYNADFDGDEMNLHLPQSLET+AE+ +LA V ++I+TPQSN+PVM IVQDTLTA  K T RDVFL R EVM+LLM+L TW+G++P+PAI KP  LWTGKQIFSLIIPG +NCIRTHSTHP+ E++GPYK ISPGDTKV++E+GELI GILCKK+LG+SAGSL+HI  LE   D    F++N+QTV+NNWLLIEGHTIGI D++ D+KT ++I+ TI +AK+ V E I+KAHN EL+ TPGNTLRQTFE  VN+ILNDARDKTGS AQKSLS+YNNF  MV+SGAKGSKINISQVIA VGQQNVEGKRIPFGF+ RTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIK+MESVM+KYD+TVRN I+Q++Q RYGEDGL G  VEF
Sbjct:   12 ACPLRTIKRVQFGVLSPDELKRMSVT-EGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICE----GGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEF 903          

HSP 2 Score: 689.493 bits (1778), Expect = 0.000e+0
Identity = 368/717 (51.32%), Postives = 481/717 (67.09%), Query Frame = 2
Query: 2645 SIDSVPIRRGWARWGICG----IQSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETG-GRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNL-NLVLRIXXXXXXXXXXXXXXXXXXXX----YLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALPMMSGVAHNLYMVGGATPMNSASPQLTPWTTLSSPYTFSPKPNSFGASFSP--------------IAHSEIGMSPNPALAFSPMMSPKTPMDYGFGRYSPSMNPISPAG 4723
            SI+ V ++  +   G+ G     Q+L T KP+   FEK+FRFD +NE  L R L E  V+++ + A    +L+ E++++ +DRE++R I    TG  +VVLPCN+ R++ N QKIF I+    +D+ P+ ++E V+ L   L++V GDD +S+ A ENATLLF   +RS LC +++ +E+RLS EAFDW+LGEI+++FNQ++  PGEMVGALAA+SLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKE+IN+S+ PKTPSLTVFL G +A+DAE AK I  RLEHTTLRK+   + IYYDP P+S+V+  D+EWV  YYE+PDFD+ + SP+LLR+ L RK MTD+KLT++ IAEKI   F +D+ C   DDN   LVLRIR++  ++ K  E+ E+ D+     +L  +E+ +L ++ LQGI QISKVY+H P+TD+KKKI+I  DG F+   EWILETDG  L +VL+E+DVD   T SN I EIF   GIEA R A+ERE++HVISFDGSYVNYRHLALLC+ MT +G LM+I RHG+NRQ+TG L + SFEETVD+LMEA AH E DPMKGVSE+IMLGQLA  GTGCFD+L++ EKC     +P       N+  +G A         +TP         FSP   S  + FSP                       P+P  A SP  SP           SP+  P SP G
Sbjct:  882 SINQV-VQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFP--TGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPT------NIPGLGAA-----GRSGMTPGAA-----GFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPT----------SPAYEPRSPGG 1569          

HSP 3 Score: 62.003 bits (149), Expect = 1.094e-8
Identity = 36/80 (45.00%), Postives = 47/80 (58.75%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYS-GNMSYSPTSPQYSPATSGYVANSPSY------GQQNTNSNSGYSPQSP 5695
            Y+PTSP +SP+   Y+P SP T    SPVY+  +  YSPTSP YSP +  Y   SP+Y      G   + ++ GYSP SP
Sbjct: 1836 YSPTSPTYSPTTPKYSPTSP-TYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSP 1914          

HSP 4 Score: 54.6842 bits (130), Expect = 1.946e-6
Identity = 32/74 (43.24%), Postives = 45/74 (60.81%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYS-GNMSYSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP 5695
            Y+PTSP +SP+   Y+P SP T    +P YS  + +YSPTSP Y+P +  Y   SP+Y    + ++  YSP SP
Sbjct: 1822 YSPTSPKYSPTSPKYSPTSP-TYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTY----SPTSPKYSPTSP 1890          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Mouse
Match: Polr2a (polymerase (RNA) II (DNA directed) polypeptide A [Source:MGI Symbol;Acc:MGI:98086])

HSP 1 Score: 1230.31 bits (3182), Expect = 0.000e+0
Identity = 592/897 (66.00%), Postives = 716/897 (79.82%), Query Frame = 3
Query:   54 SVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDRDEMDLK------------TQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQPLRAYQ-VLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
            + PLR +KRVQFG+LS  E+KR+SV  E GI Y E T+ G+PK  GLMDPRQG  ++   CQTC G++ ECPGHFGHI LA+PVFH+GF  K +K+LR VCF CSKLL D N+  +K+IL K++  P+KR   +YD C+   +C       +EMD K            T+E    GCG  QP  RR+GLE +   K  + DS  K+ L + + V EIF+RI++E+C ++G  P+Y+RPE MI+TVL VPPL+VRPAVVM  + ++ DDLTHKL ++VK+NN++R  E+NG A+ ++ E    LQ+HVAT +DNE P LP A+QKSGRPLK+LKQRLKGK GR+R NLMGKR D+SARTVIT DPNL++DQVGVPR IA N+TF E VTPFN   LQ+LV+ G + YPGA ++IR+NGDRIDL+  P  SD+ LQ G  VERHM + D V+FNRQPTLHKMSMM HRV++LP+STFRLNLSVT+PYNADFDGDEMNLHLPQSLET+AE+ +LA V ++I+TPQSN+PVM IVQDTLTA  K T RDVFL R EVM+LLM+L TW+G++P+PAI KP  LWTGKQIFSLIIPG +NCIRTHSTHP+ E++GPYK ISPGDTKV++E+GELI GILCKK+LG+SAGSL+HI  LE   D    F++N+QTV+NNWLLIEGHTIGI D++ D+KT ++I+ TI +AK+ V E I+KAHN EL+ TPGNTLRQTFE  VN+ILNDARDKTGS AQKSLS+YNNF  MV+SGAKGSKINISQVIA VGQQNVEGKRIPFGF+ RTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIK+MESVM+KYD+TVRN I+Q++Q RYGEDGL G  VEF
Sbjct:   12 ACPLRTIKRVQFGVLSPDELKRMSVT-EGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICE----GGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEF 903          

HSP 2 Score: 705.286 bits (1819), Expect = 0.000e+0
Identity = 375/729 (51.44%), Postives = 497/729 (68.18%), Query Frame = 2
Query: 2645 SIDSVPIRRGWARWGICG----IQSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETG-GRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNL-NLVLRIXXXXXXXXXXXXXXXXXXXX----YLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALP-----MMSGVAHNLYMVGGATPMNSASPQLTPWTTLSSPY--TFSPKPNS----FGASFSPIAHSEI-GMSPNPALAFSP--------------MMSPKTPMDYGFGRYSPSMNPISPAG 4723
            SI+ V ++  +   G+ G     Q+L T KP+   FEK+FRFD +NE  L R L E  V+++ + A    +L+ E++++ +DRE++R I    TG  +VVLPCN+ R++ N QKIF I+    +D+ P+ ++E V+ L   L++V GDD +S+ A ENATLLF   +RS LC +++ +E+RLS EAFDW+LGEI+++FNQ++  PGEMVGALAA+SLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKE+IN+S+ PKTPSLTVFL G +A+DAE AK I  RLEHTTLRK+   + IYYDP P+S+V+  D+EWV  YYE+PDFD+ + SP+LLR+ L RK MTD+KLT++ IAEKI   F +D+ C   DDN   LVLRIR++  ++ K  E+ E+ D+     +L  +E+ +L ++ LQGI QISKVY+H P+TD+KKKI+I  DG F+   EWILETDG  L +VL+E+DVD   T SN I EIF   GIEA R A+ERE++HVISFDGSYVNYRHLALLC+ MT +G LM+I RHG+NRQ+TG L + SFEETVD+LMEA AH E DPMKGVSE+IMLGQLA  GTGCFD+L++ EKC     +P     + +     ++     +PM   SP +TPW   ++P    +SP   S      A FSP A S+  G SP  + A+SP              + SP   M   +   SP+  P SP G
Sbjct:  882 SINQV-VQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFP--TGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGG 1607          

HSP 3 Score: 61.6178 bits (148), Expect = 1.400e-8
Identity = 36/80 (45.00%), Postives = 47/80 (58.75%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYS-GNMSYSPTSPQYSPATSGYVANSPSY------GQQNTNSNSGYSPQSP 5695
            Y+PTSP +SP+   Y+P SP T    SPVY+  +  YSPTSP YSP +  Y   SP+Y      G   + ++ GYSP SP
Sbjct: 1874 YSPTSPTYSPTTPKYSPTSP-TYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSP 1952          

HSP 4 Score: 54.299 bits (129), Expect = 2.532e-6
Identity = 32/74 (43.24%), Postives = 45/74 (60.81%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYS-GNMSYSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP 5695
            Y+PTSP +SP+   Y+P SP T    +P YS  + +YSPTSP Y+P +  Y   SP+Y    + ++  YSP SP
Sbjct: 1860 YSPTSPKYSPTSPKYSPTSP-TYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTY----SPTSPKYSPTSP 1928          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Mouse
Match: Polr3a (polymerase (RNA) III (DNA directed) polypeptide A [Source:MGI Symbol;Acc:MGI:2681836])

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 346/909 (38.06%), Postives = 529/909 (58.20%), Query Frame = 3
Query:   66 REVKRVQFGILSASEIKR---LSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSK-LLADVNSSNVKEILKK---TEINPRKRFDFMYDECRRNKVCSVPNSDRDEMD----LKT-QEMSRSGCGYVQPIFRRNGLEYFVTL-----KXXXXXXXXKQPLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMN-HTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKR-----RPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNG-----RLPKPAIYKPLRLWTGKQIFSLII-PGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGS-SAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVE 2699
            +++  + FG+ S  E+++   + VV +N  +Y++      P   G++D R G  +K   C+TCG ++A+C GH+G+I+L  P FH+G+   +I IL+ +C  C   +L+        + LK+   T +  R     + D+CR+   C    +    +     LK   E  ++    V PI   N L+ F T      + +     +++ L    VL +F+RI  ED  L+  NP+  +P  +I+T L VPPL +RP+VV +  +G + DDLT KLTE++ +N+ I+    +G  + +++E  + LQ   A +I++E   +P  +    +  +   QRLKGK GR R NL GKR D+S RTVI+ DPNL +D+V VP  +A+ LTFPEKV   N ++L++LV+NG  ++PGA F+ + +   + +KR       +    +L++G+ VERH+++ D V+FNRQP+LHK+S+M H  +V P  TFR N  V +PYNADFDGDEMNLHLPQ+ E KAE   L      ++TP++ +P+++ +QD LT    +T +D F +RA+   ++  +          RLP P I KP+ LWTGKQIFS+I+ P   N +R +      +  G  + +   D+ V I++ EL+ G + K TLGS S  ++ +I+  +   +EA    + +  +   +L   G +IGI D        +   + ++   +   E I+  +  +LQ  PG T  +T E  + K L+  RD  GS   + L K N+   M + G+KGS INISQ+IACVGQQ + G R+P GF+ R+LPHF K    P ++GFV NS+ +GLTPTEFFFH M GREGL+DTAVKTAETGY+QRRL+K++E +  +YD TVR+    +IQF YG DGLD A +E
Sbjct:   13 KKISHICFGMKSPEEMRQQAHIQVVSKN--LYSQDNNHA-PLLYGVLDHRMGTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHIMLSQEEKQQFLDFLKRPGLTYLQKRGLKKKISDKCRKKSTCHYCGAFNGTVKKCGLLKIIHEKYKTNKKVVDPIVS-NFLQSFETAIEHNKEVEPLLGRAQENLNPLVVLNLFKRIPAEDVPLLLMNPESGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRISGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPK-KWTRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANINFLRKLVRNGPDVHPGANFIQQRH---MQMKRFLKYGNREKMAQELKFGDIVERHLIDGDVVLFNRQPSLHKLSIMAHLARVKPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIAAIQDFLTGAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPTILKPVTLWTGKQIFSVILRPSDDNPVRANLRTKGKQYCGKGEDLCVNDSYVTIQNSELMCGSMDKGTLGSGSKNNIFYILLRDWGQNEAADAMSRLARLAPVYLSNRGFSIGIGDVTPGQGLLKAKYELLNAGYKKCDEYIEALNTGKLQQQPGCTAEETLEALILKELSVIRDHAGSACLRELDKSNSPLTMALCGSKGSFINISQMIACVGQQAISGSRVPDGFENRSLPHFEKHSKLPAAKGFVANSFYSGLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSTGDIIQFIYGGDGLDPAAME 913          

HSP 2 Score: 183.726 bits (465), Expect = 8.390e-46
Identity = 125/411 (30.41%), Postives = 209/411 (50.85%), Query Frame = 2
Query: 3170 RLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLNLVLRIXXXXXXXXXXXXXXXXXXXXYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDIL 4402
            R++P   +  L   + ++ ++ ++PG  VGAL A+S+GEP TQMTL TFH+AGV++ N+TLGVPR+KEIIN S+   TP +T  L  +   DA+ A+ +  R+E T L +++   E  + P+    +++   E +R    L   +++ ++   +R  +   K+  K   +    E +        +C  P +N                           Y+       L ++ +QGIP++S+  IH    D++            GK ++ L  +G  L+ V+A   V    T SN+  E+ +T GIEAAR  I  E+ + +   G  ++ RH+ LL ++MT+KG ++ I R G+ + +   L  +SFE+T D L +A    + D + GVSE I++G    IGTG F +L
Sbjct: 1005 RITPTQIEKFLETCRDKYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKAISTPIITAQL--DKDDDADYARLVKGRIEKTLLGEISEYIEEVFLPDDCFILVKLSLERIR----LLRLEVNAET---VRYSICTSKLRVKPGDVAVHGEAV--------VCVTPREN---------------------SKSSMYYVLQFLKEDLPKVVVQGIPEVSRAVIH---IDEQ-----------SGKEKFKLLVEGDNLRAVMATHGVKGTRTTSNNTYEVEKTLGIEAARTTIINEIQYTMVNHGMSIDRRHVMLLSDLMTYKGEVLGITRFGLAKMKESVLMLASFEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLL 1363          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Mouse
Match: Polr3a (polymerase (RNA) III (DNA directed) polypeptide A [Source:MGI Symbol;Acc:MGI:2681836])

HSP 1 Score: 372.859 bits (956), Expect = 7.287e-112
Identity = 223/612 (36.44%), Postives = 353/612 (57.68%), Query Frame = 3
Query:   66 REVKRVQFGILSASEIKR---LSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSK-LLADVNSSNVKEILKK---TEINPRKRFDFMYDECRRNKVCSVPNSDRDEMD----LKT-QEMSRSGCGYVQPIFRRNGLEYFVTL-----KXXXXXXXXKQPLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMN-HTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKR-----RPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNG-----RLPKPAIYKPLRLWTGKQIFSLII-PGRVNCIRTH 1811
            +++  + FG+ S  E+++   + VV +N  +Y++      P   G++D R G  +K   C+TCG ++A+C GH+G+I+L  P FH+G+   +I IL+ +C  C   +L+        + LK+   T +  R     + D+CR+   C    +    +     LK   E  ++    V PI   N L+ F T      + +     +++ L    VL +F+RI  ED  L+  NP+  +P  +I+T L VPPL +RP+VV +  +G + DDLT KLTE++ +N+ I+    +G  + +++E  + LQ   A +I++E   +P  +    +  +   QRLKGK GR R NL GKR D+S RTVI+ DPNL +D+V VP  +A+ LTFPEKV   N ++L++LV+NG  ++PGA F+ + +   + +KR       +    +L++G+ VERH+++ D V+FNRQP+LHK+S+M H  +V P  TFR N  V +PYNADFDGDEMNLHLPQ+ E KAE   L      ++TP++ +P+++ +QD LT    +T +D F +RA+   ++  +          RLP P I KP+ LWTGKQIFS+I+ P   N +R +
Sbjct:   13 KKISHICFGMKSPEEMRQQAHIQVVSKN--LYSQDNNHA-PLLYGVLDHRMGTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHIMLSQEEKQQFLDFLKRPGLTYLQKRGLKKKISDKCRKKSTCHYCGAFNGTVKKCGLLKIIHEKYKTNKKVVDPIVS-NFLQSFETAIEHNKEVEPLLGRAQENLNPLVVLNLFKRIPAEDVPLLLMNPESGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRISGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPK-KWTRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANINFLRKLVRNGPDVHPGANFIQQRH---MQMKRFLKYGNREKMAQELKFGDIVERHLIDGDVVLFNRQPSLHKLSIMAHLARVKPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIAAIQDFLTGAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPTILKPVTLWTGKQIFSVILRPSDDNPVRAN 616          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Mouse
Match: Polr1a (polymerase (RNA) I polypeptide A [Source:MGI Symbol;Acc:MGI:1096397])

HSP 1 Score: 345.51 bits (885), Expect = 1.124e-95
Identity = 226/644 (35.09%), Postives = 329/644 (51.09%), Query Frame = 3
Query:  924 LQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDR-----IDLKRR---------PDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFS-TFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMY-LPTWNGR--LPKPAIYKPLRLWTGKQIFSL----IIP---------GRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWL-LIEGHTIGIVDALYD-------AKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPG-----------NTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
            LQ HV    D+E   L   ++K       ++Q L+ K G  R ++MGKR DY+AR+VI  D  +N +++G+P + A  LT+P+ VTP+N   L+Q V NG  ++PGA+ VI E+G R     +D  +R         P +   + Q  + V RH+ N D ++ NRQPTLH+ S+  HR ++LP     RL+ +    YNADFDGDEMN H PQS   +AE   LA   +  + P+  +P+  ++QD + +   MT R  F  R + M L+   L    GR  L  PAI KP  LWTGKQ+ S     IIP         G+           +P     +   S  +++V+I +GEL+ G+L K   GSSA  L+H        + +G     +  +   +L L  G T+G+ D L          +  EE  Q   +A +A     + A   E+Q               N +   F+  VN   N+                NN  +MV SGAKGS +N  Q+   +GQ  +EG+R P     ++LP F   ++ P + GFV   +L G+ P EFFFH M GREGL+DTAVKT+ +GY+QR +IK +E ++I+YD TVR+    ++QF YGEDGLD    +F
Sbjct:  401 LQSHVNIVFDSEMDKL--MLEK----YPGIRQILEKKEGLFRKHMMGKRVDYAARSVICPDMYINTNEIGIPMVFATKLTYPQPVTPWNVQELRQAVINGPNVHPGASMVINEDGSRTALSSVDAAQREAVAKQLLTPATGAPKPQGTKVVCRHVKNGDILLLNRQPTLHRPSIQAHRARILPEEKVLRLHYANCKAYNADFDGDEMNAHFPQSELGRAEAYVLACTDQQYLVPKDGQPLAGLIQDHMVSGANMTIRGCFFTREQYMELVYRGLTDKVGRVKLFPPAILKPFPLWTGKQVVSTLLINIIPEDYAPLNLSGKAKIGSKAWVKEKPRPIPDFDPDSMCESQVIIREGELLCGVLDKAHYGSSAYGLVHCCYEIYGGETSGRVLTCLARLFTAYLQLYRGFTLGVEDILVKPNADVVRQRIIEESTQCGPQAVKAALSLPETASCDEIQGKWQDAHLSKDQRDFNMIDMKFKEEVNHYSNEINKACMPLGLHRQFPENNLQMMVQSGAKGSTVNTMQISCLLGQIELEGRRPPLMASGKSLPCFEPYEFTPRAGGFVTGRFLTGIRPPEFFFHCMAGREGLVDTAVKTSRSGYLQRCIIKHLEGLVIQYDLTVRDSDGSVVQFLYGEDGLDIPKTQF 1038          

HSP 2 Score: 94.3597 bits (233), Expect = 1.485e-18
Identity = 57/121 (47.11%), Postives = 77/121 (63.64%), Query Frame = 2
Query: 3167 YRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINV-SRNPKTP--SLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEI 3520
            Y+ S  + D +   ++ ++ +SL  PGE VG LAA+S+GEP+TQMTLNTFH+AG    NVTLG+PRL+EI+ V S N KTP  S+ VF T  A K     KS+  RL    L ++  K +I
Sbjct: 1189 YKKSELSLDRLRTLLQLKWQRSLCDPGEAVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILMVASANIKTPMMSVPVFDTKKALKK---VKSLKKRLTRVCLGEVLQKVDI 1306          

HSP 3 Score: 73.559 bits (179), Expect = 3.104e-12
Identity = 45/156 (28.85%), Postives = 82/156 (52.56%), Query Frame = 2
Query: 3935 KIVINSDGAFEGKAEWILETDGTCLQKVLAERDV-DSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDI 4399
            + ++N     + + E +L T+G  L ++    ++ D     SN I  +  T+GIEAA   IE+E+  V +  G  V+ RHL+L+ + M  +G    ++R GI +  +  L + +FE +   L +A      D +K  S  +++G++ K GTG F++
Sbjct: 1558 RCLLNETTNSKNEKELVLNTEGINLPELFKYSEILDLRRLYSNDIHAMANTYGIEAALRVIEKEIKDVFAVYGIAVDPRHLSLVADYMCFEGVYKPLNRFGI-QSSSSPLQQMTFETSFQFLKQATMMGSHDELKSPSACLVVGKVVKGGTGLFEL 1712          

HSP 4 Score: 70.0922 bits (170), Expect = 3.977e-11
Identity = 37/105 (35.24%), Postives = 51/105 (48.57%), Query Frame = 3
Query:   60 PLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKL 374
            P R ++ + FG+ SA E+K+LSV       Y +    G P  +GL D   GP D    C TC      C GH GHI+L   V++    +K+  +LR  C  C  L
Sbjct:    8 PWRRLQGISFGMYSAEELKKLSVKSITNPRYVDYL--GNPSANGLYDLALGPADSKEVCATCVQDFNNCSGHLGHIDLPLTVYNPFLFDKLYLLLRGSCLSCHML 110          
BLAST of DNA-directed RNA polymerase subunit vs. UniProt/SwissProt
Match: sp|P08775|RPB1_MOUSE (DNA-directed RNA polymerase II subunit RPB1 OS=Mus musculus OX=10090 GN=Polr2a PE=1 SV=3)

HSP 1 Score: 1230.31 bits (3182), Expect = 0.000e+0
Identity = 592/897 (66.00%), Postives = 716/897 (79.82%), Query Frame = 3
Query:   54 SVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDRDEMDLK------------TQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQPLRAYQ-VLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
            + PLR +KRVQFG+LS  E+KR+SV  E GI Y E T+ G+PK  GLMDPRQG  ++   CQTC G++ ECPGHFGHI LA+PVFH+GF  K +K+LR VCF CSKLL D N+  +K+IL K++  P+KR   +YD C+   +C       +EMD K            T+E    GCG  QP  RR+GLE +   K  + DS  K+ L + + V EIF+RI++E+C ++G  P+Y+RPE MI+TVL VPPL+VRPAVVM  + ++ DDLTHKL ++VK+NN++R  E+NG A+ ++ E    LQ+HVAT +DNE P LP A+QKSGRPLK+LKQRLKGK GR+R NLMGKR D+SARTVIT DPNL++DQVGVPR IA N+TF E VTPFN   LQ+LV+ G + YPGA ++IR+NGDRIDL+  P  SD+ LQ G  VERHM + D V+FNRQPTLHKMSMM HRV++LP+STFRLNLSVT+PYNADFDGDEMNLHLPQSLET+AE+ +LA V ++I+TPQSN+PVM IVQDTLTA  K T RDVFL R EVM+LLM+L TW+G++P+PAI KP  LWTGKQIFSLIIPG +NCIRTHSTHP+ E++GPYK ISPGDTKV++E+GELI GILCKK+LG+SAGSL+HI  LE   D    F++N+QTV+NNWLLIEGHTIGI D++ D+KT ++I+ TI +AK+ V E I+KAHN EL+ TPGNTLRQTFE  VN+ILNDARDKTGS AQKSLS+YNNF  MV+SGAKGSKINISQVIA VGQQNVEGKRIPFGF+ RTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIK+MESVM+KYD+TVRN I+Q++Q RYGEDGL G  VEF
Sbjct:   12 ACPLRTIKRVQFGVLSPDELKRMSVT-EGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICE----GGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEF 903          

HSP 2 Score: 705.286 bits (1819), Expect = 0.000e+0
Identity = 375/729 (51.44%), Postives = 497/729 (68.18%), Query Frame = 2
Query: 2645 SIDSVPIRRGWARWGICG----IQSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETG-GRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNL-NLVLRIXXXXXXXXXXXXXXXXXXXX----YLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALP-----MMSGVAHNLYMVGGATPMNSASPQLTPWTTLSSPY--TFSPKPNS----FGASFSPIAHSEI-GMSPNPALAFSP--------------MMSPKTPMDYGFGRYSPSMNPISPAG 4723
            SI+ V ++  +   G+ G     Q+L T KP+   FEK+FRFD +NE  L R L E  V+++ + A    +L+ E++++ +DRE++R I    TG  +VVLPCN+ R++ N QKIF I+    +D+ P+ ++E V+ L   L++V GDD +S+ A ENATLLF   +RS LC +++ +E+RLS EAFDW+LGEI+++FNQ++  PGEMVGALAA+SLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKE+IN+S+ PKTPSLTVFL G +A+DAE AK I  RLEHTTLRK+   + IYYDP P+S+V+  D+EWV  YYE+PDFD+ + SP+LLR+ L RK MTD+KLT++ IAEKI   F +D+ C   DDN   LVLRIR++  ++ K  E+ E+ D+     +L  +E+ +L ++ LQGI QISKVY+H P+TD+KKKI+I  DG F+   EWILETDG  L +VL+E+DVD   T SN I EIF   GIEA R A+ERE++HVISFDGSYVNYRHLALLC+ MT +G LM+I RHG+NRQ+TG L + SFEETVD+LMEA AH E DPMKGVSE+IMLGQLA  GTGCFD+L++ EKC     +P     + +     ++     +PM   SP +TPW   ++P    +SP   S      A FSP A S+  G SP  + A+SP              + SP   M   +   SP+  P SP G
Sbjct:  882 SINQV-VQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFP--TGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGG 1607          

HSP 3 Score: 61.6178 bits (148), Expect = 9.796e-8
Identity = 36/80 (45.00%), Postives = 47/80 (58.75%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYS-GNMSYSPTSPQYSPATSGYVANSPSY------GQQNTNSNSGYSPQSP 5695
            Y+PTSP +SP+   Y+P SP T    SPVY+  +  YSPTSP YSP +  Y   SP+Y      G   + ++ GYSP SP
Sbjct: 1874 YSPTSPTYSPTTPKYSPTSP-TYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSP 1952          
BLAST of DNA-directed RNA polymerase subunit vs. UniProt/SwissProt
Match: sp|P24928|RPB1_HUMAN (DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A PE=1 SV=2)

HSP 1 Score: 1230.31 bits (3182), Expect = 0.000e+0
Identity = 592/897 (66.00%), Postives = 716/897 (79.82%), Query Frame = 3
Query:   54 SVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDRDEMDLK------------TQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQPLRAYQ-VLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
            + PLR +KRVQFG+LS  E+KR+SV  E GI Y E T+ G+PK  GLMDPRQG  ++   CQTC G++ ECPGHFGHI LA+PVFH+GF  K +K+LR VCF CSKLL D N+  +K+IL K++  P+KR   +YD C+   +C       +EMD K            T+E    GCG  QP  RR+GLE +   K  + DS  K+ L + + V EIF+RI++E+C ++G  P+Y+RPE MI+TVL VPPL+VRPAVVM  + ++ DDLTHKL ++VK+NN++R  E+NG A+ ++ E    LQ+HVAT +DNE P LP A+QKSGRPLK+LKQRLKGK GR+R NLMGKR D+SARTVIT DPNL++DQVGVPR IA N+TF E VTPFN   LQ+LV+ G + YPGA ++IR+NGDRIDL+  P  SD+ LQ G  VERHM + D V+FNRQPTLHKMSMM HRV++LP+STFRLNLSVT+PYNADFDGDEMNLHLPQSLET+AE+ +LA V ++I+TPQSN+PVM IVQDTLTA  K T RDVFL R EVM+LLM+L TW+G++P+PAI KP  LWTGKQIFSLIIPG +NCIRTHSTHP+ E++GPYK ISPGDTKV++E+GELI GILCKK+LG+SAGSL+HI  LE   D    F++N+QTV+NNWLLIEGHTIGI D++ D+KT ++I+ TI +AK+ V E I+KAHN EL+ TPGNTLRQTFE  VN+ILNDARDKTGS AQKSLS+YNNF  MV+SGAKGSKINISQVIA VGQQNVEGKRIPFGF+ RTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIK+MESVM+KYD+TVRN I+Q++Q RYGEDGL G  VEF
Sbjct:   12 ACPLRTIKRVQFGVLSPDELKRMSVT-EGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICE----GGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEF 903          

HSP 2 Score: 705.286 bits (1819), Expect = 0.000e+0
Identity = 375/729 (51.44%), Postives = 497/729 (68.18%), Query Frame = 2
Query: 2645 SIDSVPIRRGWARWGICG----IQSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETG-GRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNL-NLVLRIXXXXXXXXXXXXXXXXXXXX----YLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALP-----MMSGVAHNLYMVGGATPMNSASPQLTPWTTLSSPY--TFSPKPNS----FGASFSPIAHSEI-GMSPNPALAFSP--------------MMSPKTPMDYGFGRYSPSMNPISPAG 4723
            SI+ V ++  +   G+ G     Q+L T KP+   FEK+FRFD +NE  L R L E  V+++ + A    +L+ E++++ +DRE++R I    TG  +VVLPCN+ R++ N QKIF I+    +D+ P+ ++E V+ L   L++V GDD +S+ A ENATLLF   +RS LC +++ +E+RLS EAFDW+LGEI+++FNQ++  PGEMVGALAA+SLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKE+IN+S+ PKTPSLTVFL G +A+DAE AK I  RLEHTTLRK+   + IYYDP P+S+V+  D+EWV  YYE+PDFD+ + SP+LLR+ L RK MTD+KLT++ IAEKI   F +D+ C   DDN   LVLRIR++  ++ K  E+ E+ D+     +L  +E+ +L ++ LQGI QISKVY+H P+TD+KKKI+I  DG F+   EWILETDG  L +VL+E+DVD   T SN I EIF   GIEA R A+ERE++HVISFDGSYVNYRHLALLC+ MT +G LM+I RHG+NRQ+TG L + SFEETVD+LMEA AH E DPMKGVSE+IMLGQLA  GTGCFD+L++ EKC     +P     + +     ++     +PM   SP +TPW   ++P    +SP   S      A FSP A S+  G SP  + A+SP              + SP   M   +   SP+  P SP G
Sbjct:  882 SINQV-VQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFP--TGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGG 1607          

HSP 3 Score: 61.6178 bits (148), Expect = 9.632e-8
Identity = 36/80 (45.00%), Postives = 47/80 (58.75%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYS-GNMSYSPTSPQYSPATSGYVANSPSY------GQQNTNSNSGYSPQSP 5695
            Y+PTSP +SP+   Y+P SP T    SPVY+  +  YSPTSP YSP +  Y   SP+Y      G   + ++ GYSP SP
Sbjct: 1874 YSPTSPTYSPTTPKYSPTSP-TYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSP 1952          
BLAST of DNA-directed RNA polymerase subunit vs. UniProt/SwissProt
Match: sp|P11414|RPB1_CRIGR (DNA-directed RNA polymerase II subunit RPB1 OS=Cricetulus griseus OX=10029 GN=POLR2A PE=2 SV=2)

HSP 1 Score: 1230.31 bits (3182), Expect = 0.000e+0
Identity = 592/897 (66.00%), Postives = 716/897 (79.82%), Query Frame = 3
Query:   54 SVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDRDEMDLK------------TQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQPLRAYQ-VLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
            + PLR +KRVQFG+LS  E+KR+SV  E GI Y E T+ G+PK  GLMDPRQG  ++   CQTC G++ ECPGHFGHI LA+PVFH+GF  K +K+LR VCF CSKLL D N+  +K+IL K++  P+KR   +YD C+   +C       +EMD K            T+E    GCG  QP  RR+GLE +   K  + DS  K+ L + + V EIF+RI++E+C ++G  P+Y+RPE MI+TVL VPPL+VRPAVVM  + ++ DDLTHKL ++VK+NN++R  E+NG A+ ++ E    LQ+HVAT +DNE P LP A+QKSGRPLK+LKQRLKGK GR+R NLMGKR D+SARTVIT DPNL++DQVGVPR IA N+TF E VTPFN   LQ+LV+ G + YPGA ++IR+NGDRIDL+  P  SD+ LQ G  VERHM + D V+FNRQPTLHKMSMM HRV++LP+STFRLNLSVT+PYNADFDGDEMNLHLPQSLET+AE+ +LA V ++I+TPQSN+PVM IVQDTLTA  K T RDVFL R EVM+LLM+L TW+G++P+PAI KP  LWTGKQIFSLIIPG +NCIRTHSTHP+ E++GPYK ISPGDTKV++E+GELI GILCKK+LG+SAGSL+HI  LE   D    F++N+QTV+NNWLLIEGHTIGI D++ D+KT ++I+ TI +AK+ V E I+KAHN EL+ TPGNTLRQTFE  VN+ILNDARDKTGS AQKSLS+YNNF  MV+SGAKGSKINISQVIA VGQQNVEGKRIPFGF+ RTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIK+MESVM+KYD+TVRN I+Q++Q RYGEDGL G  VEF
Sbjct:   12 ACPLRTIKRVQFGVLSPDELKRMSVT-EGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICE----GGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEF 903          

HSP 2 Score: 705.286 bits (1819), Expect = 0.000e+0
Identity = 375/729 (51.44%), Postives = 497/729 (68.18%), Query Frame = 2
Query: 2645 SIDSVPIRRGWARWGICG----IQSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETG-GRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNL-NLVLRIXXXXXXXXXXXXXXXXXXXX----YLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALP-----MMSGVAHNLYMVGGATPMNSASPQLTPWTTLSSPY--TFSPKPNS----FGASFSPIAHSEI-GMSPNPALAFSP--------------MMSPKTPMDYGFGRYSPSMNPISPAG 4723
            SI+ V ++  +   G+ G     Q+L T KP+   FEK+FRFD +NE  L R L E  V+++ + A    +L+ E++++ +DRE++R I    TG  +VVLPCN+ R++ N QKIF I+    +D+ P+ ++E V+ L   L++V GDD +S+ A ENATLLF   +RS LC +++ +E+RLS EAFDW+LGEI+++FNQ++  PGEMVGALAA+SLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKE+IN+S+ PKTPSLTVFL G +A+DAE AK I  RLEHTTLRK+   + IYYDP P+S+V+  D+EWV  YYE+PDFD+ + SP+LLR+ L RK MTD+KLT++ IAEKI   F +D+ C   DDN   LVLRIR++  ++ K  E+ E+ D+     +L  +E+ +L ++ LQGI QISKVY+H P+TD+KKKI+I  DG F+   EWILETDG  L +VL+E+DVD   T SN I EIF   GIEA R A+ERE++HVISFDGSYVNYRHLALLC+ MT +G LM+I RHG+NRQ+TG L + SFEETVD+LMEA AH E DPMKGVSE+IMLGQLA  GTGCFD+L++ EKC     +P     + +     ++     +PM   SP +TPW   ++P    +SP   S      A FSP A S+  G SP  + A+SP              + SP   M   +   SP+  P SP G
Sbjct:  882 SINQV-VQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFP--TGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGG 1607          

HSP 3 Score: 61.6178 bits (148), Expect = 9.632e-8
Identity = 36/80 (45.00%), Postives = 47/80 (58.75%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYS-GNMSYSPTSPQYSPATSGYVANSPSY------GQQNTNSNSGYSPQSP 5695
            Y+PTSP +SP+   Y+P SP T    SPVY+  +  YSPTSP YSP +  Y   SP+Y      G   + ++ GYSP SP
Sbjct: 1874 YSPTSPTYSPTTPKYSPTSP-TYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSP 1952          
BLAST of DNA-directed RNA polymerase subunit vs. UniProt/SwissProt
Match: sp|P04052|RPB1_DROME (DNA-directed RNA polymerase II subunit RPB1 OS=Drosophila melanogaster OX=7227 GN=RpII215 PE=3 SV=4)

HSP 1 Score: 1207.2 bits (3122), Expect = 0.000e+0
Identity = 577/892 (64.69%), Postives = 697/892 (78.14%), Query Frame = 3
Query:   57 VPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDRDEMDLKTQEM--------SRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQ-PLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
             PLR+VKRVQFGILS  EI+R+SV  E G+ +AE  + G+PK  GLMDPRQG  D+ S CQTC G++ ECPGHFGHI+LA+PVFHIGF  K IKILR VCF CSK+L   ++  +KEI+ K+   PRKR  ++YD C+   +C       ++MDL  +             GCG+ QP  RR GL+     K  + DS  K+  + A +V EI + IT+E+C ++G +PKY+RP+ MI+TVL VPPLAVRPAVVM    K+ DDLTHKL++++K NNE+R  E +G A+ ++ E    LQ+HVAT +DN+ P +P A+QKSG+PLK +K RLKGK GRIR NLMGKR D+SARTVIT DPNL +DQVGVPR IAQNLTFPE VTPFN   +Q+LV+ G + YPGA +++R+NG+RIDL+  P SSD+ LQ G  VERH+ +DD V+FNRQPTLHKMSMM HRVKVLP+STFR+NLS TSPYNADFDGDEMNLH+PQS+ET+AEV ++    + IITPQ+NKPVM IVQDTLTA  KMT RDVF+ R +VM+LLM+LPTW+ ++P+P I KP  LWTGKQIFSLIIPG VN IRTHSTHP+ E+ GPYKWISPGDTKV++E GELI GILCKK+LG+SAGSL+HI  LE   D AG F+ N+QTV+NNWLL EGH+IGI D + D +T  EI+Q I +AK+ V   I KAHN EL+ TPGNTLRQTFE  VN+ILNDARDKTG  A+KSL++YNN   MV+SG+KGS INISQVIACVGQQNVEGKRIP+GF++RTLPHFIKDDYGPESRGFVENSYLAGLTP+EF+FHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVM+ YD TVRN + QLIQ RYGEDGL G  VEF
Sbjct:    9 APLRQVKRVQFGILSPDEIRRMSVT-EGGVQFAETMEGGRPKLGGLMDPRQGVIDRTSRCQTCAGNMTECPGHFGHIDLAKPVFHIGFITKTIKILRCVCFYCSKMLVSPHNPKIKEIVMKSRGQPRKRLAYVYDLCKGKTICE----GGEDMDLTKENQQPDPNKKPGHGGCGHYQPSIRRTGLDLTAEWKHQNEDSQEKKIVVSAERVWEILKHITDEECFILGMDPKYARPDWMIVTVLPVPPLAVRPAVVMFGAAKNQDDLTHKLSDIIKANNELRKNEASGAAAHVIQENIKMLQFHVATLVDNDMPGMPRAMQKSGKPLKAIKARLKGKEGRIRGNLMGKRVDFSARTVITPDPNLRIDQVGVPRSIAQNLTFPELVTPFNIDRMQELVRRGNSQYPGAKYIVRDNGERIDLRFHPKSSDLHLQCGYKVERHLRDDDLVIFNRQPTLHKMSMMGHRVKVLPWSTFRMNLSCTSPYNADFDGDEMNLHVPQSMETRAEVENIHITPRQIITPQANKPVMGIVQDTLTAVRKMTKRDVFITREQVMNLLMFLPTWDAKMPQPCILKPRPLWTGKQIFSLIIPGNVNMIRTHSTHPDEEDEGPYKWISPGDTKVMVEHGELIMGILCKKSLGTSAGSLLHICFLELGHDIAGRFYGNIQTVINNWLLFEGHSIGIGDTIADPQTYNEIQQAIKKAKDDVINVIQKAHNMELEPTPGNTLRQTFENKVNRILNDARDKTGGSAKKSLTEYNNLKAMVVSGSKGSNINISQVIACVGQQNVEGKRIPYGFRKRTLPHFIKDDYGPESRGFVENSYLAGLTPSEFYFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMVNYDGTVRNSVGQLIQLRYGEDGLCGELVEF 895          

HSP 2 Score: 707.983 bits (1826), Expect = 0.000e+0
Identity = 366/667 (54.87%), Postives = 477/667 (71.51%), Query Frame = 2
Query: 2687 GICG----IQSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETGGRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLN-LVLRIXXXXXXXXXXX----XXXXXXXXXYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALP------MMSGVAHNLYMVGGATPMNSASPQLTPWTTLSSPYTFSPKPN-----SFGASFSPIAHSEI-GMSPN 4624
            G+CG     Q++PT K +   FEKRF+FD SNE  + +  T+  ++E+T  ++ I +L+ EWD+L  DR+ +R I  +    +VVLPCN+ R++ N QKIF I+    TD+ P+ +I+ V+ L    ++V G+D ISK ANENATLLF CLIRS LC K V +E+RLS EAF+W++GEI+TRF Q+   PGEMVGALAA+SLGEPATQMTLNTFH+AGVS+KNVTLGVPRLKEIIN+S+ PK PSLTVFLTG AA+DAE AK++  RLEHTTLRK+   + IYYDP+P+ +VI  D+E+V  YYE+PDFD  + SP+LLRI L RK+MTDKKLT++ IAEKI   F  D+ C   DDN + LVLRIR++  E+ K         +MED  +L  +E  +L ++ LQGI  I KVY+H P+TD KK+IVI   G F+   EW+LETDGT + KVL+ERDVD   T SN I EIF+  GIEA R ++E+EM+ V+ F G YVNYRHLALLC++MT KG LM+I RHGINRQ+TGAL R SFEETVD+LM+A AHAE DPM+GVSE+I++GQL K+GTGCFD+L++ EKC     +P      M+ G A  +++ GG+TP  S +P +TPW   ++P  FSP  +       G SFSP A S+  GMSP+
Sbjct:  887 GLCGELVEFQNMPTVKLSNKSFEKRFKFDWSNERLMKKVFTDDVIKEMTDSSEAIQELEAEWDRLVSDRDSLRQIFPNGES-KVVLPCNLQRMIWNVQKIFHINKRLPTDLSPIRVIKGVKTLLERCVIVTGNDRISKQANENATLLFQCLIRSTLCTKYVSEEFRLSTEAFEWLVGEIETRFQQAQANPGEMVGALAAQSLGEPATQMTLNTFHFAGVSSKNVTLGVPRLKEIINISKKPKAPSLTVFLTGGAARDAEKAKNVLCRLEHTTLRKVTANTAIYYDPDPQRTVISEDQEFVNVYYEMPDFDPTRISPWLLRIELDRKRMTDKKLTMEQIAEKINVGFGEDLNCIFNDDNADKLVLRIRIMNNEENKFQDEDEAVDKMEDDMFLRCIEANMLSDMTLQGIEAIGKVYMHLPQTDSKKRIVITETGEFKAIGEWLLETDGTSMMKVLSERDVDPIRTSSNDICEIFQVLGIEAVRKSVEKEMNAVLQFYGLYVNYRHLALLCDVMTAKGHLMAITRHGINRQDTGALMRCSFEETVDVLMDAAAHAETDPMRGVSENIIMGQLPKMGTGCFDLLLDAEKCRFGIEIPNTLGNSMLGGAA--MFIGGGSTP--SMTPPMTPWANCNTPRYFSPPGHVSAMTPGGPSFSPSAASDASGMSPS 1548          
BLAST of DNA-directed RNA polymerase subunit vs. UniProt/SwissProt
Match: sp|P35074|RPB1_CAEBR (DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis briggsae OX=6238 GN=rpb-1 PE=3 SV=2)

HSP 1 Score: 1176.39 bits (3042), Expect = 0.000e+0
Identity = 567/890 (63.71%), Postives = 693/890 (77.87%), Query Frame = 3
Query:   57 VPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDRD----EMDLKTQEMSR--SGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQP--LRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVE 2699
             PLR V RVQFGIL   EIKR+SV     + + E  ++GKPK  GLMDPRQG  D+   C TC G++ +CPGHFGH+ LA+PVFHIGF  K +KILR VCF C +LL D  +  V +ILKKT  NP+KR   +YD C+   VC       D    +MD    E  +  +GCG  QP +RR G++     K + ++   ++   L A +VLE+F++IT+ED L++G +P+++RPE MI TVL VPPLAVRPAVV   + K+ DDLTHKL++++K N +++  E NG A+ +L +    LQYHVAT +DN  P LPTA QK GRPLK++KQRLKGK GRIR NLMGKR D+SARTVITADPNL +D VGVPR IAQNLTFPE VTPFN   LQ+LV  G T YPGA ++IRENG R+DL+  P ++D+ LQ G  VERHM + D +VFNRQPTLHKMSMM HRVK+LP+STFR+NLSVTSPYNADFDGDEMNLHLPQSLET+AE+ ++A V + +ITPQ+NKPVM IVQDTL A   MT RD+F++   +M LLMYLPTW+G++P+PAI KP  LWTGKQ+FSLIIPG VN +RTHSTHP+ E++GPYKWISPGDTKVLIE GEL+SGI+C KT+G SAG+L+H++ALE   + A  F++++QTV+N WLL EGHTIGI D + D  T  +I+ TI +AK+ V + I+KAHN +L+ TPGNTLRQTFE  VN+ILNDARD+TGS AQKSLS++NNF  MV+SG+KGSKINISQVIACVGQQNVEGKRIPFGF+ RTLPHFIKDDYGPES+GFVENSYLAGLTP+EFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVM+ YD TVRN + Q++Q RYGEDGLDG +VE
Sbjct:   10 APLRTVCRVQFGILGPEEIKRMSVAH---VEFPEVYENGKPKMGGLMDPRQGVIDRRGRCMTCAGNLTDCPGHFGHLELAKPVFHIGFLTKSLKILRCVCFYCGRLLIDKTNPRVMDILKKTSGNPKKRLALIYDLCKSKSVCEGAAEKEDGLPDDMDDPMNEGKKVPAGCGRYQPSYRRVGIDINAEWKKNVNEDTQERKIMLTAERVLEVFKQITDEDILVIGMDPQFARPEWMICTVLPVPPLAVRPAVVTFGSAKNQDDLTHKLSDIIKTNQQLQRNEANGAAAHVLTDDVRLLQYHVATLVDNCIPGLPTATQKGGRPLKSIKQRLKGKEGRIRGNLMGKRVDFSARTVITADPNLPIDTVGVPRTIAQNLTFPEIVTPFNVDKLQELVNRGDTQYPGAKYIIRENGARVDLRYHPRAADLHLQPGYRVERHMKDGDIIVFNRQPTLHKMSMMGHRVKILPWSTFRMNLSVTSPYNADFDGDEMNLHLPQSLETRAEIEEIAMVPRQLITPQANKPVMGIVQDTLCAVRMMTKRDIFIDWPFMMDLLMYLPTWDGKVPQPAILKPKPLWTGKQVFSLIIPGNVNVLRTHSTHPDSEDSGPYKWISPGDTKVLIEHGELLSGIVCSKTVGKSAGNLLHVVALELGHEIAANFYSHIQTVINAWLLREGHTIGIGDTIADQSTYLDIQNTIRKAKQDVVDVIEKAHNDDLEPTPGNTLRQTFENKVNQILNDARDRTGSSAQKSLSEFNNFKSMVVSGSKGSKINISQVIACVGQQNVEGKRIPFGFRHRTLPHFIKDDYGPESKGFVENSYLAGLTPSEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMVNYDGTVRNSLAQMVQLRYGEDGLDGMWVE 896          

HSP 2 Score: 695.656 bits (1794), Expect = 0.000e+0
Identity = 367/691 (53.11%), Postives = 474/691 (68.60%), Query Frame = 2
Query: 2702 QSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETGGRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNL-NLVLRIXXX---XXXXXXXXXXXXXXXXXYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALPMMSGVAHNLYMVGGA-TPMNSASPQLTPWTTLSSPYTFSPKPNSFG----ASFSPIAHSEIGMSP------NPALAFSPM--MSPKTPMDYGFGRYSPSM-NPISPA 4720
            Q++PT KP  A FE+ FR D+++   L +  +E  VREI    D I  +++EW QL +DR L+R I       ++VLPCN+ RL+ N QKIFK+DL K  ++ P+ +I  V  L   LI+V G+D ISK A  NATLL   L+RS LC KK+    +L+ EAFDW+LGEI+TRF Q++ QPGEMVGALAA+SLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVS+  KTPSLTVFLTG AAKD E AK +  +LEHTTL+K+   + IYYDP+P+++VI  D EWV  +YE+PD D+ + SP+LLRI L RK+M DKKLT++ IA++I   F  D+     DDN   LV R+R+    K  + ++++  +MED  +L  +E  +L ++ LQGIP ISKVY++ P TDDKK+I+I  +G F+  A+WILETDGT L +VL+ER +D   T SN I EIFE  GIEA R +IE+EM +VISFDGSYVNYRHLALLC++MT KG LM+I RHGINRQE GAL R SFEETVDILMEA  HAE DP+KGVSE+IMLGQLA+ GTGCFD++++ EKC     +P    +   +Y  G A +P    SP  +PW +  +P    P   + G    A FSP  + + G SP      +PA    P+  +SP+TP    +G  SP + +P SP 
Sbjct:  898 QNMPTMKPNNAVFERDFRMDLTDNKFLRKNYSEDVVREIQEAQDGISLVESEWSQLEEDRRLLRKIFPR-GDAKIVLPCNLQRLIWNAQKIFKVDLRKPVNLSPLHVINGVRELSKKLIIVSGNDEISKQAQYNATLLMNILLRSTLCTKKMCTSAKLNTEAFDWLLGEIETRFQQAIAQPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSKQLKTPSLTVFLTGAAAKDPEKAKDVLCKLEHTTLKKVTCNTAIYYDPDPKNTVIAEDEEWVSIFYEMPDHDLTRTSPWLLRIELDRKRMVDKKLTMEMIADRIHGGFGQDVHTIYTDDNAEKLVFRLRIAGEDKGAEGQEEQVDKMEDDVFLRCIEANMLSDLTLQGIPAISKVYMNQPNTDDKKRIIITPEGGFKAVADWILETDGTALLRVLSERQIDPVRTTSNDICEIFEVLGIEAVRKSIEKEMDNVISFDGSYVNYRHLALLCDVMTAKGHLMAITRHGINRQEVGALMRCSFEETVDILMEASVHAEVDPVKGVSENIMLGQLARCGTGCFDLVLDVEKCKHGMEIPQNVVMGAGIYGGGFAGSPSREFSPAHSPWNSGVTPNYSGPWSPTGGMSPSAGFSPAGNLDGGASPFNEGGWSPASPGDPLGALSPRTP---AYGGMSPGVYSPASPG 1584          

HSP 3 Score: 57.3806 bits (137), Expect = 1.695e-6
Identity = 37/91 (40.66%), Postives = 47/91 (51.65%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYSGNM------------------SYSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP 5695
            Y+PTSP +SP+  +Y+P SP T    SP Y G                    SYSPTSPQYSP +  Y  +SP+Y    T S+  Y+P SP
Sbjct: 1686 YSPTSPTYSPTSPTYSPTSP-TYSPTSPSYEGYSPSSPKYSPSSPTYSPTSPSYSPTSPQYSPTSPQYSPSSPTY----TPSSPTYNPTSP 1771          
BLAST of DNA-directed RNA polymerase subunit vs. TrEMBL
Match: A0A1S6KMI6 (DNA-directed RNA polymerase subunit OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1850.1 bits (4791), Expect = 0.000e+0
Identity = 890/890 (100.00%), Postives = 890/890 (100.00%), Query Frame = 3
Query:   33 MANLDLPSVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDRDEMDLKTQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQPLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNGTMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
            MANLDLPSVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDRDEMDLKTQEMSRSGCGYVQPIFRRNGLEYFVTLKDDSSDSDSKQPLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNGTMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF
Sbjct:    1 MANLDLPSVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDRDEMDLKTQEMSRSGCGYVQPIFRRNGLEYFVTLKDDSSDSDSKQPLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNGTMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 890          

HSP 2 Score: 1363.59 bits (3528), Expect = 0.000e+0
Identity = 675/676 (99.85%), Postives = 675/676 (99.85%), Query Frame = 2
Query: 2699 IQSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETGGRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLNLVLRIXXXXXXXXXXXXXXXXXXXXYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALPMMSGVAHNLYMVGGATPMNSASPQLTPWTTLSSPYTFSPKPNSFGASFSPIAHSEIGMSPNPALAFSPMMSPKTPMDYGFGRYSPSMNPISPAGT 4726
             QSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETGGRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLNLVLRIRMLKKEDEKDDEKLEMEDRKYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALPMMSGVAHNLYMVGGATPMNSASPQLTPWTTLSSPYTFSPKPNSFGASFSPIAHSEIGMSPNPALAFSPMMSPKTPMDYGFGRYSPSMNPISPAGT
Sbjct:  890 FQSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETGGRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLNLVLRIRMLKKEDEKDDEKLEMEDRKYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALPMMSGVAHNLYMVGGATPMNSASPQLTPWTTLSSPYTFSPKPNSFGASFSPIAHSEIGMSPNPALAFSPMMSPKTPMDYGFGRYSPSMNPISPAGT 1565          

HSP 3 Score: 187.963 bits (476), Expect = 1.027e-43
Identity = 205/205 (100.00%), Postives = 205/205 (100.00%), Query Frame = 2
Query: 5081 RLGTSIEGRSINYSPTSPAMGXXXXXXXXXXXXXXFNQRSTRXXXXXXXXXXXXXATLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRYTLXXXXXXXXXXXXXXXXYTPTSPAFSPSIGSYAPQSPSTAGAVSPVYSGNMSYSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP 5695
            RLGTSIEGRSINYSPTSPAMGYSPTSPSYSPSSPSFNQRSTRYSPSSPNYSPSSPATLHYSPSSPNSPSSPNYSPSNRNYSPTSPNYSPTSPVIPASPAYSPSSPNYSPTSPRYTLASPSYSVSRSYSASPRYTPTSPAFSPSIGSYAPQSPSTAGAVSPVYSGNMSYSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP
Sbjct: 1684 RLGTSIEGRSINYSPTSPAMGYSPTSPSYSPSSPSFNQRSTRYSPSSPNYSPSSPATLHYSPSSPNSPSSPNYSPSNRNYSPTSPNYSPTSPVIPASPAYSPSSPNYSPTSPRYTLASPSYSVSRSYSASPRYTPTSPAFSPSIGSYAPQSPSTAGAVSPVYSGNMSYSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP 1888          
BLAST of DNA-directed RNA polymerase subunit vs. TrEMBL
Match: A0A095APJ2 (DNA-directed RNA polymerase subunit OS=Schistosoma haematobium OX=6185 GN=MS3_04490 PE=3 SV=1)

HSP 1 Score: 1369.76 bits (3544), Expect = 0.000e+0
Identity = 647/885 (73.11%), Postives = 749/885 (84.63%), Query Frame = 3
Query:   60 PLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDR--DEMDLK-TQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQ-PLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNGTMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
            PLREV+ +QFGILS  EIK LSV  + GI YAE  + GKPK  GLMDPRQG  D+ S CQTC GSV+ CPGHFGH+ LA+PVFHIGF +K +K+LR VCF CSK+L DV SS ++EIL+KT+ + R+R  FMY+EC+    C + N D+   E D+  + ++ RSGCG  QP FRRNGLE     K  + +S  ++  L A +VLE+F+R+++EDCL +GF+P+Y+RP+ MI TVL VPPL VRPAVVM    ++ DDLTHKL +++K NN++R  E+NG A+ I+ E    LQ+HV T +DNE P LP AIQKSGRPLK++KQRLKGK GRIR NLMGKR D+SARTVITADPNLNLDQVGVPR IAQNLT+PE VT FN  +LQ+LV+NGT+YPGA F++RENGDRIDL+  P  SD+ LQ G  VERHMLNDDFV+FNRQPTLHKMSMMCHRVKVLP+STFRLNLSVTSPYNADFDGDEMNLHLPQS+ETKAE+S LARV++L+ITPQ+NKPVM IVQDTLTA NKMT RDVFLNR+E+M+LLMYLPTWNGR+PKPAIYKP RLWTGKQ+FSL+IPGRVNCIRTHSTHPE E+ GPYKWISPGDTKV+++DG+LISGILCKKTLGS AGSLIHI+ALE H D+   FFNN+QTVVNNWLLIEGHTIGI D LYD  TR +I  TI +AK+AVFE ID+AHNY+LQ TPGNTLRQTFE +VNKILNDARDKTGSCAQ+SLSKYNNFN+MV++G+KGS+INISQVIACVGQQNVEGKRIPFGF+ RTLPHFI+DDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYD TVRNQI+QLIQ RYGEDGLD   VEF
Sbjct:   10 PLREVRALQFGILSPDEIKELSVTADGGIKYAETMEGGKPKLGGLMDPRQGCVDRSSICQTCSGSVSSCPGHFGHVELAKPVFHIGFLKKTMKVLRCVCFYCSKILVDVQSSRIQEILRKTKGDNRRRMSFMYEECKTRSEC-ISNDDQVQSENDVSLSSKVKRSGCGRYQPRFRRNGLELTAEWKKVNEESQERKINLTAERVLEVFKRMSDEDCLSLGFDPRYARPDWMIATVLPVPPLCVRPAVVMYGATRNQDDLTHKLADIIKANNQLRRDEQNGAAAHIIAEDIKMLQFHVTTMVDNEVPGLPKAIQKSGRPLKSIKQRLKGKAGRIRGNLMGKRVDFSARTVITADPNLNLDQVGVPRTIAQNLTYPEVVTQFNIDHLQKLVQNGTLYPGAKFIVRENGDRIDLRYHPKVSDLTLQVGYIVERHMLNDDFVIFNRQPTLHKMSMMCHRVKVLPWSTFRLNLSVTSPYNADFDGDEMNLHLPQSVETKAEISQLARVSRLVITPQANKPVMGIVQDTLTAVNKMTQRDVFLNRSEMMNLLMYLPTWNGRMPKPAIYKPQRLWTGKQLFSLVIPGRVNCIRTHSTHPEEEDIGPYKWISPGDTKVIVDDGDLISGILCKKTLGSGAGSLIHIVALEHHHDQVNMFFNNIQTVVNNWLLIEGHTIGIADTLYDQATRRQISGTITKAKDAVFEIIDQAHNYDLQPTPGNTLRQTFENSVNKILNDARDKTGSCAQRSLSKYNNFNIMVVAGSKGSRINISQVIACVGQQNVEGKRIPFGFRHRTLPHFIQDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDGTVRNQINQLIQLRYGEDGLDATHVEF 893          

HSP 2 Score: 792.341 bits (2045), Expect = 0.000e+0
Identity = 412/711 (57.95%), Postives = 499/711 (70.18%), Query Frame = 2
Query: 2699 IQSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETGGRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLNLVLRIXXXXXX-----XXXXXXXXXXXXXXYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALPMMSGVAHNLYMVGGATPMNS-ASPQL------------------TPWTTLSSPYTFSPKPNSFG----------ASFSPIAHSEIGMSPNPALAFSPMM-SPKTPMDYGFGRYSPSMNPISPAGT 4726
             Q LPTFKP+ A FE  FRFDI NE  L R + E  VR + T++ T  +L++EW QLC DRE++R ++K +T   VVLPCNINRLV N QKIF+ID L KT+I P  ++E V   C  LIVV GDD +SK AN NATLL   LIR+ LC KKVI +YRLS EA DWVLGE++ RF Q+ + PGEMVGALAA+SLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVS+ PKTPS+T+FLTG AA+DAE  K + ARLEHTTLRKL   + IYYDP+P+++V+E DREWV TYYELPDFD+   S ++LRI  TRK MT KKL+++ IA+KIT  F ND+ICHIPDDNL LV+RIR++  +      + D    +MED  +L  +E  +L +I LQGIPQI+KVY+H PKT DKK++VI  DG+F+  AEW+LETDGTCL +VLAERDVD   T+SN I EIFE  GIEA R AIE EMHHVISFDGSYVNYRHLALLC+IMT KG LM+I RHG+NR +TGALAR SFEETVDILMEA  H+ECDPM GVSE+IMLGQLA+IGTGCFD+L++  KC EAQ +P+   +   L+   G   + + ASP L                  TPW    SP      P+  G          A FSP    +  +SP      SP + SP+TP  +    Y    +P+S  GT
Sbjct:  893 FQRLPTFKPSNAVFEHGFRFDIGNERVLRRCMPEDVVRSLATDSQTQSELESEWLQLCSDREILRSVIK-KTDDSVVLPCNINRLVMNAQKIFEIDPLSKTNIHPRQVVEMVRETCKRLIVVPGDDRLSKEANANATLLLSSLIRASLCAKKVIIDYRLSYEALDWVLGEVRARFQQAHIHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSKRPKTPSMTIFLTGQAARDAERTKDVVARLEHTTLRKLVNSTYIYYDPDPQNTVVEEDREWVSTYYELPDFDVSAISSWMLRIEFTRKGMTGKKLSMEQIADKITRAFGNDLICHIPDDNLKLVMRIRIMNSDLEKDFKDADTTSDKMEDDTFLRFIEANLLTDITLQGIPQITKVYMHLPKTQDKKRVVIKDDGSFDTVAEWMLETDGTCLMRVLAERDVDPVRTVSNDIVEIFEALGIEAVRKAIECEMHHVISFDGSYVNYRHLALLCDIMTVKGHLMAITRHGLNRLDTGALARCSFEETVDILMEAAIHSECDPMAGVSETIMLGQLARIGTGCFDLLLDSAKCQEAQPIPLGGVLGMGLFNAPGFEGLAALASPGLGLTMNADGIPVLGDSGYHTPWDNAHSPVGSVDSPSYRGGLGGATAPHNAMFSPAMRYDSSLSP----GRSPQLDSPRTPEAFSPAAYVGFSSPMSFMGT 1598          
BLAST of DNA-directed RNA polymerase subunit vs. TrEMBL
Match: A0A183P3V9 (DNA-directed RNA polymerase subunit OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS9045 PE=3 SV=1)

HSP 1 Score: 1368.6 bits (3541), Expect = 0.000e+0
Identity = 647/885 (73.11%), Postives = 748/885 (84.52%), Query Frame = 3
Query:   60 PLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDR--DEMDLK-TQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQ-PLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNGTMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
            PLREV+ +QFGILS  EIK LSV  + GI YAE  + GKPK  GLMDPRQG  D+ S CQTC GSV+ CPGHFGH+ LA+PVFHIGF +K +K+LR VCF CSK+L DV SS ++EIL+KT+ + R+R  FMY EC+    C + N D+   E D+  + ++ RSGCG  QP FRRNGLE     K  + +S  ++  L A +VLE+F+R+++EDCL +GF+P+Y+RP+ MI TVL VPPL VRPAVVM    ++ DDLTHKL +++K NN++R  E+NG A+ I+ E    LQ+HV T +DNE P LP AIQKSGRPLK++KQRLKGK GRIR NLMGKR D+SARTVITADPNLNLDQVGVPR IAQNLT+PE VT FN  +LQ+LV+NGT+YPGA F++RENGDRIDL+  P  SD+ LQ G  VERHMLNDDFV+FNRQPTLHKMSMMCHRVKVLP+STFRLNLSVTSPYNADFDGDEMNLHLPQS+ETKAE+S LARV++L+ITPQ+NKPVM IVQDTLTA NKMT RDVFLNR+E+M+LLMYLPTWNGR+PKPAIYKP RLWTGKQ+FSL+IPGRVNCIRTHSTHPE E+ GPYKWISPGDTKV+++DG+LISGILCKKTLGS AGSLIHI+ALE H D+   FFNN+QTVVNNWLLIEGHTIGI D LYD  TR +I  TI +AK+AVFE ID+AHNY+LQ TPGNTLRQTFE +VNKILNDARDKTGSCAQ+SLSKYNNFN+MV++G+KGS+INISQVIACVGQQNVEGKRIPFGF+ RTLPHFI+DDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYD TVRNQI+QLIQ RYGEDGLD   VEF
Sbjct:   10 PLREVRALQFGILSPDEIKELSVTADGGIKYAETMEGGKPKLGGLMDPRQGCVDRSSICQTCSGSVSSCPGHFGHVELAKPVFHIGFLKKTMKVLRCVCFYCSKILVDVQSSRIQEILRKTKGDNRRRMSFMYKECKTRSEC-ISNDDQVQSENDVSLSSKVKRSGCGRYQPRFRRNGLELTAEWKKVNEESQERKINLTAERVLEVFKRMSDEDCLSLGFDPRYARPDWMIATVLPVPPLCVRPAVVMYGATRNQDDLTHKLADIIKANNQLRRDEQNGAAAHIIAEDIKMLQFHVTTMVDNEVPGLPKAIQKSGRPLKSIKQRLKGKAGRIRGNLMGKRVDFSARTVITADPNLNLDQVGVPRTIAQNLTYPEVVTQFNIDHLQKLVQNGTLYPGAKFIVRENGDRIDLRYHPKVSDLTLQVGYIVERHMLNDDFVIFNRQPTLHKMSMMCHRVKVLPWSTFRLNLSVTSPYNADFDGDEMNLHLPQSVETKAEISQLARVSRLVITPQANKPVMGIVQDTLTAVNKMTQRDVFLNRSEMMNLLMYLPTWNGRMPKPAIYKPQRLWTGKQLFSLVIPGRVNCIRTHSTHPEEEDIGPYKWISPGDTKVIVDDGDLISGILCKKTLGSGAGSLIHIVALEHHHDQVNMFFNNIQTVVNNWLLIEGHTIGIADTLYDQATRRQISGTITKAKDAVFEIIDQAHNYDLQPTPGNTLRQTFENSVNKILNDARDKTGSCAQRSLSKYNNFNIMVVAGSKGSRINISQVIACVGQQNVEGKRIPFGFRHRTLPHFIQDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDGTVRNQINQLIQLRYGEDGLDATHVEF 893          

HSP 2 Score: 733.406 bits (1892), Expect = 0.000e+0
Identity = 390/711 (54.85%), Postives = 473/711 (66.53%), Query Frame = 2
Query: 2699 IQSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETGGRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLNLVLRIXXXXXX-----XXXXXXXXXXXXXXYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALPMMSGVAHNLYMVGGATPMNS-ASPQL------------------TPWTTLSSPYTFSPKPNSFG----------ASFSPIAHSEIGMSPNPALAFSPMM-SPKTPMDYGFGRYSPSMNPISPAGT 4726
             Q LPTFKP+ A FE  FRFDI NE  L R + E  VR + T++ T  +L++EW QLC DRE++                                 L KT+I P  ++E V   C  LIVV GDD +SK AN NATLL   LIR+ LC KKVI +YRLS EA DWVLGE++ RF Q+ + PGEMVGALAA+SLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVS+ PKTPS+T+FLTG AA+DAE  K + ARLEHTTLRKL   + IYYDP+P+++V+E DREWV TYYELPDFD+   S ++LRI  TRK MT KKL+++ IA+KIT  F ND+ICHIPDDNL LV+RIR++  +      + D    +MED  +L  +E  +L +I LQGIPQI+KVY+H PKT DKK++VI  DG+F+  AEW+LETDGTCL +VLAERDVD   T+SN I EIFE  GIEA R AIE EMHHVISFDGSYVNYRHLALLC+IMT KG LM+I RHG+NR +TGALAR SFEETVDILMEA  H+ECDPM GVSE+IMLGQLA+IGTG FD+L++  KC EAQ +P+   +   L+   G   + + ASP L                  TPW    SP      P+  G          A FSP    +  +SP      SP + SP+TP  +    Y    +P+S  GT
Sbjct:  893 FQRLPTFKPSNAVFEHGFRFDIGNERVLRRCMPEDVVRSLATDSQTQSELESEWLQLCSDREILHP-------------------------------LSKTNIHPRQVVEMVRETCKRLIVVPGDDRLSKEANANATLLLSSLIRASLCAKKVIIDYRLSYEALDWVLGEVRARFQQAHIHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSKRPKTPSMTIFLTGQAARDAERTKDVVARLEHTTLRKLVNSTYIYYDPDPQNTVVEEDREWVSTYYELPDFDVSAISSWMLRIEFTRKGMTGKKLSMEQIADKITRAFGNDLICHIPDDNLKLVMRIRIMNSDLEKDFKDADTTSDKMEDDTFLRFIEANLLTDITLQGIPQITKVYMHLPKTQDKKRVVIKDDGSFDTVAEWMLETDGTCLMRVLAERDVDPVRTVSNDIVEIFEALGIEAVRKAIECEMHHVISFDGSYVNYRHLALLCDIMTVKGHLMAITRHGLNRLDTGALARCSFEETVDILMEAAIHSECDPMAGVSETIMLGQLARIGTGSFDLLLDSAKCQEAQPIPLGGVLGMGLFNAPGFEGLAALASPGLGLTMNADGIPVLGDSGYHTPWDNAHSPVGSVDSPSYRGGLGGATAPHNAMFSPAMRYDSSLSP----GRSPQLDSPRTPEAFSPAAYVGFSSPMSFMGT 1568          
BLAST of DNA-directed RNA polymerase subunit vs. TrEMBL
Match: A0A3Q0KQP2 (DNA-directed RNA polymerase subunit OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 1368.21 bits (3540), Expect = 0.000e+0
Identity = 647/885 (73.11%), Postives = 749/885 (84.63%), Query Frame = 3
Query:   60 PLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDR--DEMDLK-TQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQ-PLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNGTMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
            PLREV+ +QFGILS  EIK LSV  + GI YAE  + GKPK  GLMDPRQG  D+ S CQTC GSV+ CPGHFGH+ LA+PVFHIGF +K +K+LR VCF CSK+L DV SS ++EIL+KT+ + R+R  FMY+EC+    C + N D+   E D+  + ++ RSGCG  QP FRRNGLE     K  + +S  ++  L A +VLE+F+R+++EDCL +GF+P+Y+RP+ MI TVL VPPL VRPAVVM    ++ DDLTHKL +++K NN++R  E+NG A+ I+ E    LQ+HV T +DNE P LP AIQKSGRPLK++KQRLKGK GRIR NLMGKR D+SARTVITADPNLNLDQVGVPR IAQNLT+PE VT FN  +LQ+LV+NGT+YPGA F++RENGDRIDL+  P  SD+ LQ G  VERHMLNDDFV+FNRQPTLHKMSMMCHRVKVLP+STFRLNLSVTSPYNADFDGDEMNLHLPQS+ETKAE+S LARV++L+ITPQ+NKPVM IVQDTLTA NKMT RDVFLNR+E+M+LLMYLPTWNGR+PKPAIYKP RLWTGKQ+FSL+IPGRVNCIRTHSTHPE E+ GPYKWISPGDTKV+++DG+LISGILCKKTLGS AGSLIHI+ALE H D+   FFNN+QTVVNNWLLIEGHTIGI D LYD  TR +I  TI +AK+AVFE ID+AHNY+LQ TPGNTLRQTFE +VNKILNDARDKTGSCAQ+SLSKYNNFN+MV++G+KGS+INISQVIACVGQQNVEGKRIPFGF+ RTLPHFI+DDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYD TVRNQI+QLIQ RYGEDGLD   VEF
Sbjct:   10 PLREVRALQFGILSPDEIKELSVTPDGGIKYAETMEGGKPKLGGLMDPRQGCVDRSSICQTCSGSVSSCPGHFGHVELAKPVFHIGFLKKTMKVLRCVCFYCSKILVDVQSSRIQEILRKTKGDNRRRMSFMYEECKTRSEC-ISNDDQVQSENDVSLSSKVKRSGCGRYQPRFRRNGLELTAEWKKVNEESQERKINLTAERVLEVFKRMSDEDCLSLGFDPRYARPDWMIATVLPVPPLCVRPAVVMYGATRNQDDLTHKLADIIKANNQLRRDEQNGAAAHIIAEDIKMLQFHVTTMVDNEVPGLPKAIQKSGRPLKSIKQRLKGKAGRIRGNLMGKRVDFSARTVITADPNLNLDQVGVPRTIAQNLTYPEIVTQFNIDHLQKLVQNGTLYPGAKFIVRENGDRIDLRYHPKVSDLTLQVGYIVERHMLNDDFVIFNRQPTLHKMSMMCHRVKVLPWSTFRLNLSVTSPYNADFDGDEMNLHLPQSVETKAEISQLARVSRLVITPQANKPVMGIVQDTLTAVNKMTQRDVFLNRSEMMNLLMYLPTWNGRMPKPAIYKPQRLWTGKQLFSLVIPGRVNCIRTHSTHPEEEDIGPYKWISPGDTKVIVDDGDLISGILCKKTLGSGAGSLIHIVALEHHHDQVNMFFNNIQTVVNNWLLIEGHTIGIADTLYDQATRRQISGTITKAKDAVFEIIDQAHNYDLQPTPGNTLRQTFENSVNKILNDARDKTGSCAQRSLSKYNNFNIMVVAGSKGSRINISQVIACVGQQNVEGKRIPFGFRHRTLPHFIQDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDGTVRNQINQLIQLRYGEDGLDATHVEF 893          

HSP 2 Score: 792.727 bits (2046), Expect = 0.000e+0
Identity = 412/711 (57.95%), Postives = 500/711 (70.32%), Query Frame = 2
Query: 2699 IQSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETGGRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLNLVLRIXXXXXX-----XXXXXXXXXXXXXXYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALPMMSGVAHNLYMVGGATPMNS-ASPQL------------------TPWTTLSSPYTFSPKPNSFG----------ASFSPIAHSEIGMSPNPALAFSPMM-SPKTPMDYGFGRYSPSMNPISPAGT 4726
             Q LPTFKP+ A FE  FRFDI NE  L R + E  VR + T++ T  +L++EW QLC DRE++R ++K +T   VVLPCNINRLV N QKIF+ID L KT+I P  ++E V   C  LIVV GDD +SK AN NATLL   LIR+ LC KKVI +YRLS EA DWVLGE++ RF Q+ + PGEMVGALAA+SLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVS+ PKTPS+T+FLTG AA+DAE  K + ARLEHTTLRKL   + IYYDP+P+++V+E DREWV TYYELPDFD++  S ++LRI  TRK MT KKL+++ IA+KIT  F ND+ICHIPDDNL LV+RIR++  +      + D    +MED  +L  +E  +L +I LQGIPQI+KVY+H PKT DKK++VI  DG+F+  AEW+LETDGTCL +VLAERDVD   T+SN I EIFE  GIEA R AIE EMHHVISFDGSYVNYRHLALLC+IMT KG LM+I RHG+NR +TGALAR SFEETVDILMEA  H+ECDPM GVSE+IMLGQLA+IGTGCFD+L++  KC EAQ +P+   +   L+   G   + + ASP L                  TPW    SP      P+  G          A FSP    +  +SP      SP + SP+TP  +    Y    +P+S  GT
Sbjct:  893 FQRLPTFKPSNAVFEHGFRFDIGNERVLRRCMPEDVVRSLATDSQTQSELESEWLQLCSDREILRSVIK-KTDDSVVLPCNINRLVMNAQKIFEIDPLSKTNIHPRQVVEMVRETCKRLIVVPGDDRLSKEANANATLLLSSLIRASLCSKKVIIDYRLSYEALDWVLGEVRARFQQAHIHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSKRPKTPSMTIFLTGQAARDAERTKDVVARLEHTTLRKLVNSTYIYYDPDPQNTVVEEDREWVSTYYELPDFDVNAISSWMLRIEFTRKGMTGKKLSMEQIADKITRAFGNDLICHIPDDNLKLVMRIRIMNSDLEKDFKDADTTSDKMEDDTFLRFIEANLLTDITLQGIPQITKVYMHLPKTQDKKRVVIKDDGSFDTVAEWMLETDGTCLMRVLAERDVDPVRTVSNDIVEIFEALGIEAVRKAIECEMHHVISFDGSYVNYRHLALLCDIMTVKGHLMAITRHGLNRLDTGALARCSFEETVDILMEAAIHSECDPMAGVSETIMLGQLARIGTGCFDLLLDSAKCQEAQPIPLGGVLGMGLFNAPGFEGLAALASPGLGLTMNADGIPVLGDSGYHTPWDNAHSPVGSVDSPSYRGGLGGATAPHNAMFSPAMRYDSSLSP----GRSPQLDSPRTPEAFSPAAYVGFSSPMSFMGT 1598          
BLAST of DNA-directed RNA polymerase subunit vs. TrEMBL
Match: A0A4E0RZ98 (DNA-directed RNA polymerase subunit OS=Fasciola hepatica OX=6192 GN=D915_004697 PE=3 SV=1)

HSP 1 Score: 1362.44 bits (3525), Expect = 0.000e+0
Identity = 640/892 (71.75%), Postives = 755/892 (84.64%), Query Frame = 3
Query:   33 MANLDLPSVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECR-RNKVCSVPNSDRDEMDLKTQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQ-PLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNGTMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
            MA++   S PLREV+ +QFGILS  EIK +SV  + GI YAE  + G+PK  GLMDPRQG  D+ S CQTC G+V+ CPGHFGH+ L +PVFHIGF +K +K+LR VCF CSK+L DV+S  V+EIL+KT+ + R+R  FMY+EC+ R +  S  + +  E D+   +  R+GCG  QP FRR GLE     K  + +S  ++  L A +VLE+F+RI++EDC+ +GF+P+Y+RP+ MI+TVL VPPLAVRPAVVM  T ++ DDLTHKL +++K NN++R  E+NG A+ IL E+   LQ+HV T +DN+ P LP AIQKSGRPLK++K RLKGK GRIR NLMGKR D+SARTVITADPNLNLDQVGVPR IAQNLT+PE VT FN  +LQ+LV+NGT+YPGA F++RENGDRIDL+  P  +D+ LQ G  VERHMLNDDFV+FNRQPTLHKMSMMCHRVKVLP+STFRLNLSVTSPYNADFDGDEMNLHLPQS+ETKAE+S LARV++L+ITPQ+NKPVM IVQDTLTA NKMT RDVFLNRAE+M+LLMYLPTW+GR+PKPAIYKP RLWTGKQ+FSL+IPGRVNCIRTHSTHPE E+ GPY+WISPGDTKV+++DG+LI+GILCKKTLGS +GSLIHI+ALE H ++   FFNN+QTVVNNWLLIEGHTIGI D LYD  TR +I +TI +AK+AVFE ID+AHNY+LQ TPGNTLRQTFE +VNKILNDARDKTGSCAQKSLSKYNNFN+MV++G+KGS+INISQVIACVGQQNVEGKRIPFGF+ RTLPHFI+DDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYD TVRNQI+QLIQ RYGEDGLD + VEF
Sbjct:    1 MASIVGGSPPLREVRALQFGILSPDEIKEMSVTSDGGIKYAETLEGGRPKLGGLMDPRQGCVDRNSICQTCSGNVSNCPGHFGHVELTKPVFHIGFIKKTLKLLRCVCFHCSKILVDVDSPAVQEILRKTKGDNRRRMTFMYEECKTRTECLSGEDQNGSENDVMENKTRRAGCGRYQPRFRRIGLEISAEWKKINEESQERKIALTAERVLEVFKRISDEDCISLGFDPRYARPDWMIITVLPVPPLAVRPAVVMYGTTRNQDDLTHKLADIIKANNQLRRDEQNGAAAHILAEEIRILQFHVTTLVDNDVPGLPKAIQKSGRPLKSIKTRLKGKAGRIRGNLMGKRVDFSARTVITADPNLNLDQVGVPRTIAQNLTYPETVTQFNIDHLQKLVQNGTLYPGAKFIVRENGDRIDLRYHPKVADLTLQVGYVVERHMLNDDFVIFNRQPTLHKMSMMCHRVKVLPWSTFRLNLSVTSPYNADFDGDEMNLHLPQSVETKAEISQLARVSRLVITPQANKPVMGIVQDTLTAVNKMTQRDVFLNRAEMMNLLMYLPTWSGRMPKPAIYKPQRLWTGKQLFSLVIPGRVNCIRTHSTHPEEEDIGPYRWISPGDTKVIVDDGDLIAGILCKKTLGSGSGSLIHIVALEHHHEQVAMFFNNIQTVVNNWLLIEGHTIGIADTLYDQATRRQIGETITKAKDAVFEIIDQAHNYDLQPTPGNTLRQTFENSVNKILNDARDKTGSCAQKSLSKYNNFNIMVVAGSKGSRINISQVIACVGQQNVEGKRIPFGFRHRTLPHFIQDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDGTVRNQINQLIQLRYGEDGLDASHVEF 892          

HSP 2 Score: 791.956 bits (2044), Expect = 0.000e+0
Identity = 408/713 (57.22%), Postives = 498/713 (69.85%), Query Frame = 2
Query: 2699 IQSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETGGRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLNLVLRIXXXXXX-----XXXXXXXXXXXXXXYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALPMMSGVAHNLYMVGGATPMNS-ASPQL-------------------TPWTTLSSPY-TFSPKPNSFG----------ASFSPIAHSEIGMSPNPALAFSPMM-SPKTPMDYGFGRYSPSMNPISPAGT 4726
             Q LPTFKP+ A FE  FRFD+ N   L R + E+ VR + T++ T  +LD EW QLC DRE +R +++ +T   VVLPCNINRLV N QKIF+ID L KT + P  ++E V   C  L+V+ GDD +SK AN NATLL C LIRS LC KKVI EYRL+ EA DWVLGE++ RF Q+ + PGEMVGALAA+SLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVS+ PKTPS+T++L G AA+DAE  K + ARLEHTTLRKL   + IYYDP+P++SV+E DREWV TYYELPDFD++  S ++LRI  TRK MT KKL+++ IA+KIT  F ND+ICHIPDDNL LV+RIR++  +      E D    +MED  +L  +E  +L +I LQGIPQI+KVY+H+PKT DK ++VI  DG+F+  AEW+LETDGTCL +VLAERDVD   T+SN I EIFE  GIEA R AIE EMHHVISFDGSYVNYRHLALLC+IMT KG LM+I RHG+NR +TGALAR SFEETVDILM+A  HAECDPM GVSE IMLGQLA+IGTGC D+L++  +C EAQ +P+   +   L+   G    ++ ASP L                   TPW    SP  +F   P+  G          A FSP    +  +SP      SP + SP+TP  Y    Y+   +P+S  GT
Sbjct:  892 FQKLPTFKPSHAAFEHGFRFDVGNGRALRRCMPEEVVRSLATDSQTQAELDAEWMQLCADREALRSVIR-KTDDSVVLPCNINRLVMNAQKIFEIDPLSKTTVHPRQVVEMVRETCKRLVVIPGDDRLSKEANSNATLLICSLIRSSLCAKKVISEYRLNYEALDWVLGEVRARFQQAQIHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSKKPKTPSMTIYLIGPAARDAERTKDVVARLEHTTLRKLVNSTYIYYDPDPKNSVVEEDREWVSTYYELPDFDVNAISSWMLRIEFTRKGMTGKKLSMEQIADKITRAFGNDLICHIPDDNLKLVMRIRIMNSDLEKDFKEADTTSDKMEDDTFLRFIEANLLSDITLQGIPQITKVYMHFPKTRDKMRVVIKDDGSFDAVAEWMLETDGTCLMRVLAERDVDPTRTVSNDIVEIFEALGIEAVRKAIECEMHHVISFDGSYVNYRHLALLCDIMTVKGHLMAITRHGLNRLDTGALARCSFEETVDILMDAATHAECDPMAGVSERIMLGQLARIGTGCCDLLLDSARCQEAQPIPLSGVMGMGLFNAPGFEGFSAMASPGLGLAVGADGLPVLSGDSGYHTPWDNAHSPAGSFDASPSYRGGLGGATAPHNAMFSPAVRYDSSLSP----GRSPQLDSPRTPEVYSPAAYANFTSPMSITGT 1599          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Cavefish
Match: polr2a (RNA polymerase II subunit A [Source:NCBI gene;Acc:103029187])

HSP 1 Score: 1228.77 bits (3178), Expect = 0.000e+0
Identity = 593/895 (66.26%), Postives = 718/895 (80.22%), Query Frame = 3
Query:   54 SVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVC----------SVPNSDRDEMDLKTQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQPLRAYQ-VLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
            + PLR +KRVQFGI+S  E+KR+SV  E GI Y E T+ G+PK  GLMDPRQG  ++   CQTC G++ ECPGHFGHI LA+PVFH+GF  KI+K+LR VCF CSKLL D N+  +K+IL K++  PRKR   +YD C+   +C           V   + DE DL T+E    GCG  QP  RR+GLE +   K  + DS  K+ L + + V EIF+RI++E+ L++G +PKY+RPE MI+TVL VPPLAVRPAVVM  + ++ DDLTHKL ++VK+NN++R  E++G A+ ++ E    LQ+HVAT +DNE P LP A+QKSGRPLK++KQRLKGK GR+R NLMGKR D+SARTVIT DPNL +DQVGVPR IA N+TFPE VTPFN   LQ+LV+ G + YPGA ++IR+NGDRIDL+  P  SD+ LQ G  VERHM + D V+FNRQPTLHKMSMM HRV++LP+STFRLNLSVT+PYNADFDGDEMNLHLPQSLET+AE+ +LA V ++I+TPQSN+PVM IVQDTLTA  K T RDVFL R EVM+LLM+L TW+G++P+PAI+KP  LWTGKQIFSLIIPG +N IRTHSTHP+ E++GPYK ISPGDTKV++E+GELI GILCKK+LG+SAGSL+HI  LE   D    F++N+QTVVNNWLLIEGH+IGI D++ DAKT  +I+ TI +AK+ V E I+KAHN EL+ TPGNTLRQTFE  VN+ILNDARDKTGS AQKSLS+YNNF  MV++G+KGSKINISQVIA VGQQNVEGKRIPFGF+ RTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIK+MES+M+KYD+TVRN I+Q++Q RYGEDGL G  VEF
Sbjct:   10 ACPLRLIKRVQFGIISPDELKRMSVT-EGGIKYPETTEGGRPKLGGLMDPRQGVIERSGRCQTCAGNMTECPGHFGHIELAKPVFHVGFVTKIMKVLRCVCFFCSKLLVDANNPKIKDILSKSKGQPRKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPENDE-DL-TKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEEDLILGMDPKYARPEWMIVTVLPVPPLAVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQSGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSIKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLQIDQVGVPRSIAANMTFPEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQIGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAIHKPRPLWTGKQIFSLIIPGHINVIRTHSTHPDDEDSGPYKHISPGDTKVIVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVVNNWLLIEGHSIGIGDSIADAKTYLDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVAGSKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESIMVKYDATVRNSINQVVQLRYGEDGLAGEAVEF 901          

HSP 2 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 369/704 (52.41%), Postives = 488/704 (69.32%), Query Frame = 2
Query: 2645 SIDSVPIRRGWARWGICG----IQSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETG-GRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNL-NLVLRIXXXXXXXXXXXXXXXXXXXX----YLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALPM-MSGVAHNLYMVGGATPMNSASPQLTPWTTLSSPYTFSPKPNSFGASFSPIAHSEIGMSPNPALAFSPMMSPKTPMDYGFGRYSPSMNPISPAG 4723
            SI+ V ++  +   G+ G     Q++ T KP+   FEK+F+F+ +NE  L R L E  ++++ T A     L+ E++++ +DRE++R I    TG  +VVLPCN+ R++ N QKIF+I+    TD+ P+ ++E V+ L   L++V GDD +SK A +NATLLF   +RS LC +++ +E+RLS EAF+W+LGEI+ +FNQS+  PGEMVGALAA+SLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKE+IN+S+ PKTPSLTVFL G AA+DAE AK I  RLEHTTLRK+   + IYYDP P+++V+  D+EWV  YYE+PDFD+ + SP+LLRI L RK MTD+KLT++ IAEKI   F +D+ C   DDN   LVLRIR++  ++ K  E  E+ D+     +L  +E+ +L ++ LQGI QISKVY+H P+TD+KKKI+I  DG F+   EWILETDG  L +VL+E+DVD   T SN I EIF   GIEA R A+ERE++HVISFDGSYVNYRHLALLC+ MT +G LM+I RHGINRQ+TG L + SFEETVD+LMEA +H ECDPMKGVSE+IMLGQLA  GTGCFD+L++ EKC     +P  + G++     V G + M   +   +P +  S    FSP    +  ++SP   S    SP PA  + P  SP   M   +   SP+  P SP G
Sbjct:  880 SINQV-VQLRYGEDGLAGEAVEFQNMATLKPSNKAFEKKFKFEYTNERALRRTLQEDVLKDVMTNAHVQSSLEREFEKMREDREILRAIFP--TGDSKVVLPCNLARMIWNAQKIFRINPRTPTDLNPLRVVEGVQELSKKLVIVNGDDPLSKQAQQNATLLFNIHLRSTLCSRRMTEEFRLSTEAFEWLLGEIEAKFNQSIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKRPKTPSLTVFLLGQAARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQNTVVAEDQEWVNVYYEMPDFDVTRISPWLLRIELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKFQEDEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGINRQDTGPLMKCSFEETVDVLMEASSHGECDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGIS-----VAGRSGMTPGAAGFSP-SAASDASGFSP---GYSPAWSPTPGSP--GSPGPASPYIP--SPGGAMSPNYSPTSPAYEPRSPGG 1567          

HSP 3 Score: 60.077 bits (144), Expect = 3.059e-8
Identity = 35/80 (43.75%), Postives = 46/80 (57.50%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYS-GNMSYSPTSPQYSPATSGYVANSPSY------GQQNTNSNSGYSPQSP 5695
            Y+PTSP +SP+   Y+P SP T    SP Y+  +  YSPTSP YSP +  Y   SP+Y      G   + ++ GYSP SP
Sbjct: 1834 YSPTSPTYSPTTPKYSPTSP-TYSPTSPTYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSP 1912          

HSP 4 Score: 55.0694 bits (131), Expect = 1.148e-6
Identity = 32/74 (43.24%), Postives = 45/74 (60.81%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYS-GNMSYSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP 5695
            Y+PTSP +SP+   Y+P SP T    +P YS  + +YSPTSP Y+P +  Y   SP+Y    + ++  YSP SP
Sbjct: 1820 YSPTSPKYSPTSPKYSPTSP-TYSPTTPKYSPTSPTYSPTSPTYTPTSPKYSPTSPTY----SPTSPKYSPTSP 1888          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Cavefish
Match: polr2a (RNA polymerase II subunit A [Source:NCBI gene;Acc:103029187])

HSP 1 Score: 1228 bits (3176), Expect = 0.000e+0
Identity = 593/895 (66.26%), Postives = 718/895 (80.22%), Query Frame = 3
Query:   54 SVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVC----------SVPNSDRDEMDLKTQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQPLRAYQ-VLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
            + PLR +KRVQFGI+S  E+KR+SV  E GI Y E T+ G+PK  GLMDPRQG  ++   CQTC G++ ECPGHFGHI LA+PVFH+GF  KI+K+LR VCF CSKLL D N+  +K+IL K++  PRKR   +YD C+   +C           V   + DE DL T+E    GCG  QP  RR+GLE +   K  + DS  K+ L + + V EIF+RI++E+ L++G +PKY+RPE MI+TVL VPPLAVRPAVVM  + ++ DDLTHKL ++VK+NN++R  E++G A+ ++ E    LQ+HVAT +DNE P LP A+QKSGRPLK++KQRLKGK GR+R NLMGKR D+SARTVIT DPNL +DQVGVPR IA N+TFPE VTPFN   LQ+LV+ G + YPGA ++IR+NGDRIDL+  P  SD+ LQ G  VERHM + D V+FNRQPTLHKMSMM HRV++LP+STFRLNLSVT+PYNADFDGDEMNLHLPQSLET+AE+ +LA V ++I+TPQSN+PVM IVQDTLTA  K T RDVFL R EVM+LLM+L TW+G++P+PAI+KP  LWTGKQIFSLIIPG +N IRTHSTHP+ E++GPYK ISPGDTKV++E+GELI GILCKK+LG+SAGSL+HI  LE   D    F++N+QTVVNNWLLIEGH+IGI D++ DAKT  +I+ TI +AK+ V E I+KAHN EL+ TPGNTLRQTFE  VN+ILNDARDKTGS AQKSLS+YNNF  MV++G+KGSKINISQVIA VGQQNVEGKRIPFGF+ RTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIK+MES+M+KYD+TVRN I+Q++Q RYGEDGL G  VEF
Sbjct:   10 ACPLRLIKRVQFGIISPDELKRMSVT-EGGIKYPETTEGGRPKLGGLMDPRQGVIERSGRCQTCAGNMTECPGHFGHIELAKPVFHVGFVTKIMKVLRCVCFFCSKLLVDANNPKIKDILSKSKGQPRKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPENDE-DL-TKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEEDLILGMDPKYARPEWMIVTVLPVPPLAVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQSGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSIKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLQIDQVGVPRSIAANMTFPEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQIGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAIHKPRPLWTGKQIFSLIIPGHINVIRTHSTHPDDEDSGPYKHISPGDTKVIVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVVNNWLLIEGHSIGIGDSIADAKTYLDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVAGSKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESIMVKYDATVRNSINQVVQLRYGEDGLAGEAVEF 901          

HSP 2 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 378/723 (52.28%), Postives = 502/723 (69.43%), Query Frame = 2
Query: 2645 SIDSVPIRRGWARWGICG----IQSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETG-GRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNL-NLVLRIXXXXXXXXXXXXXXXXXXXX----YLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALPM-MSGVA----HNLYMVGGATPMNSASPQLTPWTTLSSPY--TFSPKPNS----FGASFSPIAHSEI-GMSPNPALAFSPMMSPKTPMDYG---------FGRYSPSMNPISPA 4720
            SI+ V ++  +   G+ G     Q++ T KP+   FEK+F+F+ +NE  L R L E  ++++ T A     L+ E++++ +DRE++R I    TG  +VVLPCN+ R++ N QKIF+I+    TD+ P+ ++E V+ L   L++V GDD +SK A +NATLLF   +RS LC +++ +E+RLS EAF+W+LGEI+ +FNQS+  PGEMVGALAA+SLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKE+IN+S+ PKTPSLTVFL G AA+DAE AK I  RLEHTTLRK+   + IYYDP P+++V+  D+EWV  YYE+PDFD+ + SP+LLRI L RK MTD+KLT++ IAEKI   F +D+ C   DDN   LVLRIR++  ++ K  E  E+ D+     +L  +E+ +L ++ LQGI QISKVY+H P+TD+KKKI+I  DG F+   EWILETDG  L +VL+E+DVD   T SN I EIF   GIEA R A+ERE++HVISFDGSYVNYRHLALLC+ MT +G LM+I RHGINRQ+TG L + SFEETVD+LMEA +H ECDPMKGVSE+IMLGQLA  GTGCFD+L++ EKC     +P  + G++      ++     +PM+  SP +TPW T ++P    +SP   S      A FSP A S+  G SP  + A+SP  +P +P   G          G  SP+ +P SPA
Sbjct:  880 SINQV-VQLRYGEDGLAGEAVEFQNMATLKPSNKAFEKKFKFEYTNERALRRTLQEDVLKDVMTNAHVQSSLEREFEKMREDREILRAIFP--TGDSKVVLPCNLARMIWNAQKIFRINPRTPTDLNPLRVVEGVQELSKKLVIVNGDDPLSKQAQQNATLLFNIHLRSTLCSRRMTEEFRLSTEAFEWLLGEIEAKFNQSIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKRPKTPSLTVFLLGQAARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQNTVVAEDQEWVNVYYEMPDFDVTRISPWLLRIELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKFQEDEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGINRQDTGPLMKCSFEETVDVLMEASSHGECDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGISVAGPTGMFFGSAPSPMSGMSPAMTPWNTGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSP--TPGSPGSPGPASPYIPSPGGAMSPNYSPTSPA 1597          

HSP 3 Score: 60.077 bits (144), Expect = 3.393e-8
Identity = 35/80 (43.75%), Postives = 46/80 (57.50%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYS-GNMSYSPTSPQYSPATSGYVANSPSY------GQQNTNSNSGYSPQSP 5695
            Y+PTSP +SP+   Y+P SP T    SP Y+  +  YSPTSP YSP +  Y   SP+Y      G   + ++ GYSP SP
Sbjct: 1872 YSPTSPTYSPTTPKYSPTSP-TYSPTSPTYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSP 1950          

HSP 4 Score: 54.6842 bits (130), Expect = 1.305e-6
Identity = 32/74 (43.24%), Postives = 45/74 (60.81%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYS-GNMSYSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP 5695
            Y+PTSP +SP+   Y+P SP T    +P YS  + +YSPTSP Y+P +  Y   SP+Y    + ++  YSP SP
Sbjct: 1858 YSPTSPKYSPTSPKYSPTSP-TYSPTTPKYSPTSPTYSPTSPTYTPTSPKYSPTSPTY----SPTSPKYSPTSP 1926          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Cavefish
Match: polr3a (polymerase (RNA) III (DNA directed) polypeptide A [Source:ZFIN;Acc:ZDB-GENE-050208-103])

HSP 1 Score: 519.62 bits (1337), Expect = 5.481e-156
Identity = 321/908 (35.35%), Postives = 507/908 (55.84%), Query Frame = 3
Query:   66 REVKRVQFGILSASEIKR---LSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSK-LLADVNSSNVKEILKK---TEINPRKRFDFMYDECRRNKVC---SVPNSDRDEMDLK--TQEMSRSGCGYVQPIFRRNGLEYFVTLK----XXXXXXXXKQPLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKR-----RPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKL-IITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGR-----LPKPAIYKPLRLWTGKQIFSLIIPGRVNC-IRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGS-SAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVE 2699
            +++  + FG+ SA ++++   + VV +N  +Y++ T    P   G++D R G  +K   C+TCG ++A+C GH+G+++L  P FHIG+ +  I IL+ +C  CS+ +L+        + L++     +  R     + D+CR+  VC   S  N    +  L     E  ++    V PI       + + ++     +S  S +++ L    VL +FRRI  ED  L+  NP+  +P  +I+T L VPPL +RP+V         DDLT KLTE++ +N+ I+    +G  + +++E  + LQ   A +I++E   +P  +    +  +   QRLKGK GR R NL GKR D+S RTVI+ DPNL +D+V VP  +A+ LT+PEKV   N   +++LVKNG  ++PGA F+ + +   + +KR       +    +L+ G+ VERHM++ D V+FNRQP+LHK+S+M H V              ++PY                      + +  + TK  ++TP++ +P+++ +QD LT    +T +D F +RA+   ++  +           LP+PAI KP+RLWTGKQIFSLI+    +C ++ +      +  G  + +   D+ V+I++ EL+ G L K TLGS S  ++ +I+  +    EA    + +  +   +L   G +IGI D        +  ++ +D   +   E I+  +  +LQ  PG T  +T E  + + L+  RD  GS   + L K N+  +M + G+KGS INISQ+IACVGQQ + G R+P GF+ R+LPHF K    P ++GFV +S+ +GLTPTEFFFH M GREGL+DTAVKTAETGY+QRRL+K++E +  +YD TVR+    +IQF YG DGLD A +E
Sbjct:   13 KKISHICFGMKSAEQMRQQAHIQVVSKN--LYSQDTSH-TPLSYGVLDHRMGTSEKDRPCETCGKNLADCLGHYGYLDLELPCFHIGYFKATIGILQMICKTCSRIMLSKEERQQFLDYLRRPGLAYLQKRGLKKKISDKCRKKNVCLYCSAFNGPVKKCGLLKIIHEKYKTTKKVVDPIVSDFLQSFDIAIEHNKEVESLLSRAQENLNPLVVLNLFRRIPNEDVPLLLMNPEAGKPADLILTRLLVPPLCIRPSV---------DDLTMKLTEIIFLNDVIKKHRMSGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPK-KWTRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTYPEKVNKANIELMRKLVKNGPDVHPGANFIQQRH---MQMKRFLKYGNREKMAQELKLGDVVERHMIDGDIVLFNRQPSLHKLSIMAHIVS-------------SNPY----------------------IQNNPKATKANLVTPRNGEPLIAAIQDFLTGAYLLTLKDTFFDRAKACQIVASILVGKDEKIKVTLPRPAIIKPMRLWTGKQIFSLILKPSQSCPVKANLRTKGKQYCGKGEDLCSNDSFVVIQNSELLCGSLDKGTLGSGSKNNIFYILLRDWGQLEAANAMSRLARLAPVYLSNRGFSIGIGDVTPGQGLLKAKQELLDAGYKKCDEYIEALNTGKLQQQPGCTAEETLEALILRELSVIRDHAGSACLRELDKSNSPLIMALCGSKGSFINISQMIACVGQQAISGSRVPDGFENRSLPHFEKHSKLPAAKGFVADSFYSGLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSTGDIIQFIYGGDGLDPAAME 869          

HSP 2 Score: 187.963 bits (476), Expect = 3.240e-47
Identity = 124/416 (29.81%), Postives = 213/416 (51.20%), Query Frame = 2
Query: 3170 RLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLNLVLRIXXXXXXXXXXXXXXXXXXXXYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEK 4417
            R++P   +  L   + ++ ++ ++PG  VGAL A+S+GEP TQMTL TFH+AGV++ N+TLGVPR+KEIIN S+N  TP +T  L  +   DA+ A+ +  R+E T L +++   +  + P+    +++   E +R    L   +++ ++   +R  +   K+  K   +    E +        +C  P +N                           Y+       L ++ +QGIP++++  IH    DD+            G+ ++ L  +G  L+ V+A   V+   T SN+  E+ +T GIEAAR  I  E+ + +   G  ++ RH+ LL ++M++KG ++ I R G+ + +   L  +SFE+T D L +A    + D + GVSE I++G    IGTG F +L   +K
Sbjct:  961 RITPTQLEKFLETCRDKYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKNISTPIITAHL--DTEDDADFARLVKGRIEKTLLGEISEYIDEVFLPDDCFILVKLSLERIR----LLRLEVNAET---VRYSICMSKLRVKPGDIAVHGEAV--------VCVSPREN---------------------SKSSMYYVLQWLKQELPKVVVQGIPEVARAVIH---IDDQ-----------SGRQKFKLLVEGDNLRAVMATHGVNGSRTTSNNTYEVEKTLGIEAARTTIINEIQYTMVNHGMSIDRRHVMLLADLMSYKGEILGITRFGLAKMKESVLMLASFEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHRADK 1324          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Cavefish
Match: ENSAMXT00000011874.2 (pep primary_assembly:Astyanax_mexicanus-2.0:24:12476100:12482137:1 gene:ENSAMXG00000011553.2 transcript:ENSAMXT00000011874.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 136.346 bits (342), Expect = 1.137e-32
Identity = 70/141 (49.65%), Postives = 94/141 (66.67%), Query Frame = 3
Query: 2283 NNFNLMVMSGAKGSKINISQVIACV-GQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
            NN  LMV SGAKG + NI   I+C+ GQ  +EG+R P     ++LP F   +  P S GFV   +L G+ P EFFFH M GREGL+DTAVKT+ +GY+QR +IK +E ++++YD TVR+    ++QF YGEDGLD    +F
Sbjct:   33 NNLQLMVQSGAKG-RSNI--CISCLLGQIELEGRRPPLMPSGKSLPCFQPYEAEPRSGGFVTGRFLTGIKPPEFFFHCMAGREGLVDTAVKTSRSGYLQRCVIKHLEGLVVQYDLTVRDSDGSVVQFLYGEDGLDIPKTQF 170          

HSP 2 Score: 86.2705 bits (212), Expect = 1.384e-16
Identity = 39/71 (54.93%), Postives = 56/71 (78.87%), Query Frame = 2
Query: 3209 IKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINV-SRNPKTPSLTV 3418
            ++ ++ ++L  PGE VG LAA+S+GEP+TQMTLNTFH+AG    NVTLG+PRL+EI+ + S N KTP +++
Sbjct:  340 LQLKWQRALCDPGEAVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILLIASSNIKTPMMSI 410          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Cavefish
Match: ENSAMXT00000040759.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000346.1:792765:793154:1 gene:ENSAMXG00000030278.1 transcript:ENSAMXT00000040759.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.8626 bits (172), Expect = 8.454e-14
Identity = 46/89 (51.69%), Postives = 52/89 (58.43%), Query Frame = -2
Query: 4813 GEVGQYDGDVGE*FGLVGLYDGDVGE*PGLVGLYDGDVGE*FGLVGLYDGEVGEYPGLVGLYEGDVGE*FGLVGLYDGDVGEYPGLVGL 5079
            G VGQY G VG+  G  G Y G VG+  G VG Y G  G+  G VG Y G VG+Y G VG Y G VG+  G VG Y G VG+Y G VG 
Sbjct:    6 GTVGQYVGTVGQYIGTAGQYVGTVGQYVGTVGQYIGTAGQYVGTVGQYVGTVGQYVGTVGQYVGTVGQYVGTVGQYVGTVGQYAGTVGT 94          

HSP 2 Score: 70.8626 bits (172), Expect = 9.683e-14
Identity = 46/88 (52.27%), Postives = 52/88 (59.09%), Query Frame = -2
Query: 4810 VGQYDGDVGE*FGLVGLYDGDVGE*PGLVGLYDGDVGE*FGLVGLYDGEVGEYPGLVGLYEGDVGE*FGLVGLYDGDVGEYPGLVGLY 5073
            VGQY G VG+  G VG Y G  G+  G VG Y G VG+  G  G Y G VG+Y G VG Y G VG+  G VG Y G VG+Y G VG Y
Sbjct:    1 VGQYAGTVGQYVGTVGQYIGTAGQYVGTVGQYVGTVGQYIGTAGQYVGTVGQYVGTVGQYVGTVGQYVGTVGQYVGTVGQYVGTVGQY 88          

HSP 3 Score: 63.5438 bits (153), Expect = 3.398e-11
Identity = 55/135 (40.74%), Postives = 65/135 (48.15%), Query Frame = -2
Query: 4810 GEYDGLVGEYPIAGEVGE*LMLRPSIDVPNLGEVGQYDGDVGE*FGLVGLYDGDVGE*PGLVGLYDGDVGE*FGLVGLYDGEVGEYPGLVGLYEGDVGE*FGLVGLYDGD--------------VGEYPGLVGLY 5172
            G+Y G VG+Y   G VG+            +G  GQY G VG+  G VG Y G  G+  G VG Y G VG+  G VG Y G VG+Y G VG Y G VG+  G VG    D              VG+Y G VG Y
Sbjct:    2 GQYAGTVGQY--VGTVGQ-----------YIGTAGQYVGTVGQYVGTVGQYIGTAGQYVGTVGQYVGTVGQYVGTVGQYVGTVGQYVGTVGQYVGTVGQYAGTVGTVCWDSGTVCWDSGTVCWTVGQYVGTVGQY 123          

HSP 4 Score: 49.6766 bits (117), Expect = 2.145e-6
Identity = 46/123 (37.40%), Postives = 55/123 (44.72%), Query Frame = -2
Query: 4876 GLDGEYDGLVGEYPIAGEVGE*LMLRPSIDVPNLGEVGQYDGDVGE*FGLVGLYDGDVGE*PGLVGLYDGDVGE*FGLVGLYDGEVG---------------------EYPGLVGLYEGDVGE 5181
            G  G+Y G VG+Y   G VG+            +G  GQY G VG+  G VG Y G VG+  G VG Y G VG+  G VG Y G VG                     +Y G VG Y G VG+
Sbjct:   20 GTAGQYVGTVGQY--VGTVGQ-----------YIGTAGQYVGTVGQYVGTVGQYVGTVGQYVGTVGQYVGTVGQYVGTVGQYAGTVGTVCWDSGTVCWDSGTVCWTVGQYVGTVGQYVGTVGQ 129          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Yeast
Match: RPO21 (RNA polymerase II largest subunit B220; part of central core; phosphorylation of C-terminal heptapeptide repeat domain regulates association with transcription and splicing factors; similar to bacterial beta-prime [Source:SGD;Acc:S000002299])

HSP 1 Score: 907.131 bits (2343), Expect = 0.000e+0
Identity = 467/894 (52.24%), Postives = 605/894 (67.67%), Query Frame = 3
Query:   33 MANLDLPSVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDRDEMDLKTQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQP----LRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVE 2699
            M      S PLR VK VQFG+ S  E++ +SV         ++TQ  + K  GL DPR G  D+   CQTC   + ECPGHFGHI+LA+PVFH+GF  KI K+   VC  C KLL D ++  +++ L     + +KRF  ++  C+   VC    +D    D  TQ +SR GCG  QP  R++GL+   + K D +  D+ +P    L   ++L IF+ I+ +D   +GFN  +SRPE MI+T L VPP  VRP++  N + +  DDLT KL +++K N  + T E NG     + E E+ LQ+HVAT++DN+    P A+QKSGRP+K+++ RLKGK GRIR NLMGKR D+SARTVI+ DPNL LDQVGVP+ IA+ LT+PE VTP+N   L QLV+NG   +PGA +VIR++GDRIDL+    + DIQLQYG  VERH++++D V+FNRQP+LHKMSMM HRVKV+P+STFRLNLSVTSPYNADFDGDEMNLH+PQS ET+AE+S L  V   I++PQSNKP M IVQDTL    K+T RD F+   +V+++L ++P W+G +P PAI KP  LW+GKQI S+ IP  ++  R                +SP D  +LI DG++I G++ KKT+GSS G LIH++  E+ P      F N+Q VVN WLL  G + GI D + D  T  EI +TI  AK+ V +   +A    L +  G TLR++FE  V + LN+ARDK G  A+ +L   NN   MVM+G+KGS INI+Q+ ACVGQQ+VEGKRI FGF  RTLPHF KDDY PES+GFVENSYL GLTP EFFFHAMGGREGLIDTAVKTAETGYIQRRL+KA+E +M+ YD+T RN +  +IQF YGEDG+D A +E
Sbjct:    1 MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQT-RAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIK--DSKKRFAAIWTLCKTKMVCE---TDVPSEDDPTQLVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLPVPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPGAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVIPTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEG---------TTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIE 879          

HSP 2 Score: 499.59 bits (1285), Expect = 0.000e+0
Identity = 289/682 (42.38%), Postives = 414/682 (60.70%), Query Frame = 2
Query: 2702 QSLPTFKPTMAEFEKRFRFDISNEDE-LSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETGGRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFD----IDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLNLVLRIXXXXXXXXXXXXXXXXXXXXYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALPMMSGVAHNLYMVGGATPMNSASPQLTPWTTLSSPYTFSPKPNS-----FGASFSPIAHSEIGMSPNPALAFSPMMSPKTPMDYGFGRYSPSMNPISP 4717
            QSL T   + A FEKR+R D+ N D  L   L E    EI  +      LD E+ QL KDR+ +R++   +      LP NI R++ N Q+ F ID  K +D+   DI+  V++L  +L+V++G + I + A  +A  LFCCL+RS L  ++V+ EYRL+ +AFDWVL  I+ +F +S+V PGEMVG LAA+S+GEPATQMTLNTFH+AGV++K VT GVPRLKEI+NV++N KTPSLTV+L    A D E AK I + +EHTTL+ + + SEIYYDP+P S+VI  D E ++ ++ L D +     D++SP+LLR+ L R  M DK LT+  + E+I + F+ND+     +DN +  L IR      +  D + E E+   L+ +EN +L+ I L+G+  I +V +   K D K   V +  G +  + EW+LETDG  L +V+    +D     +N   +I E  GIEA R A+ +E+++VI+ DGSYVNYRH+ALL ++MT +G L S+ RHG NR  TGAL R SFEETV+IL EAGA AE D  +GVSE+++LGQ+A IGTG FD++++ E     + +P            GG TP ++ S  +     +     FSP  +S         F+    ++ G + +P  A+    +P +P   GFG  SP  +P SP
Sbjct:  881 QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESG-SEILGDLKLQVLLDEEYKQLVKDRKFLREVFV-DGEANWPLPVNIRRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRAAMNDKDLTMGQVGERIKQTFKNDLFVIWSEDN-DEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIERVVMM--KYDRK---VPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVMIDEESL--VKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEATSPFGAYGE--APTSP---GFGVSSPGFSPTSP 1547          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Yeast
Match: RPO31 (RNA polymerase III largest subunit C160; part of core enzyme; similar to bacterial beta-prime subunit and to RPA190 and RPO21 [Source:SGD;Acc:S000005642])

HSP 1 Score: 595.119 bits (1533), Expect = 0.000e+0
Identity = 338/936 (36.11%), Postives = 527/936 (56.30%), Query Frame = 3
Query:   66 REVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSK-LLADVNSSNVKEILKKTEINPRKRFDFM---YDECRRNKVCSVPNSDRDEMDLKTQEMSRSGCGYVQPIFR----RNGLEYFVTLKXXXXXXXXKQPLRAY-----------QVLEIFRRITEEDCLLMGFNPKY--SRPEGMIMTVLSVPPLAVRPAVVMNHTGKSH-DDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNES---PFLPTAIQKSGR--PLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIREN---------GDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTW--NGRLPKPAIYKPLRLWTGKQIFSLII------PGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAG-SLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEFNL-CLHSNRQW 2732
            + +K ++F  LSA++I   S V  +     +  +D  PK +G +DP+ G       C TC G++A C GHFGH+ LA PVFHIG+ +  I+IL+ +C  CS  LL++ +       L++  ++  +R   +    D+C++ + C    +    +         +    +   FR    ++  E  + + +          L  Y           + L +F++I   DC L+G +      RPE  I   L  PP+ +RP+V+M  +  S+ DDLT KLTE+V  ++ I+   + G++   ++E  + LQ  VA +I+++S     LP +    G+  P++   QRLKGK GR R NL GKR D+S RTVI+ DPNL++D+V VP  +A+ LT+PEKVT +N+H LQ+L+ NG  ++PGA ++++ N         GDR+ L +        LQ G+ VERH+ + D V+FNRQP+LH++S++ H  K+ P+ TFRLN  V +PYNADFDGDEMNLH+PQ+ E +AE  +L  V   ++TP+S +P+++  QD +T    ++ +D F +RA +  LL  +     +  +P PAI KP  LWTGKQ+FSL+I      P  +N    +     P+       +S  D  V+I   +++SG++ K  LG     S+ + I  +  P EA    N +  +   +L   G +IGI D       +++ ++ ++ A     E I   +  EL++ PG    QT E  +  +L+  R++ G      L  +N   +M   G+KGS +N+SQ++A VGQQ + G R+P GFQ R+LPHF K+   P+S+GFV NS+ +GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K++E +  +YD+TVR   + ++QF YG DGLD   +E N   ++ NR W
Sbjct:   11 KRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIHDTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCELLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELIVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAK-------NLQIGDVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSW 939          

HSP 2 Score: 184.882 bits (468), Expect = 3.949e-47
Identity = 133/417 (31.89%), Postives = 212/417 (50.84%), Query Frame = 2
Query: 3167 YRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEY----FQNDIICHIPDDNLNLVLRIXXXXXXXXXXXXXXXXXXXXYLELVE-NLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDIL 4402
            YR+S ++    L     ++ ++ ++PG  +GA+ A+S+GEP TQMTL TFH+AGV++ NVTLGVPR+KEIIN S+   TP +   L  +   D   A+ +  R+E T L  +A                     +V+  Y+      D  S   +RI L        +LT++ IA  IT       Q   +  I  D + + +     K +      K   E+  +  + +    L ++ ++G+P IS+  I+    DD             GK E ++E  G  L+ V+    V    T +NH+ E+F   GIEAAR +I RE+++ +S  G  V+ RH+ LL ++MT+KG ++ I R G+++     L  +SFE+T D L +A  + + D ++GVSE I+LGQ   IGTG F ++
Sbjct: 1060 YRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRVEKTLLSDVAF--------------------YVQDVYK------DNLSFIQVRIDLGTIDKLQLELTIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRMQQLRRALPDVVVKGLPDISRAVINI--RDD-------------GKRELLVE--GYGLRDVMCTDGVIGSRTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Yeast
Match: RPA190 (RNA polymerase I largest subunit A190 [Source:SGD;Acc:S000005868])

HSP 1 Score: 355.14 bits (910), Expect = 1.001e-99
Identity = 248/758 (32.72%), Postives = 383/758 (50.53%), Query Frame = 3
Query:  666 IFRRITEEDCLLM-------GFNPKYSRPEGMIMTVLSVPPLAVRPAVVMN---HTGKSHDDLTHKLT----------EVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGR-PLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDL------KRR--------PDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFS-TFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLM-YLPTWNGRLPK-------PAIYKPLRLWTGKQIFSLII--------PGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDA---KTREEI-KQTIDRAKEAVFET--IDK---AHNYELQSTPGNTLRQTFET------TVNKILNDARDKTGSCA-QKSLSKY--NNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLD----GAFVEFNLCL 2714
            +FR+   E C+L          + K  + +   M VL VPP   R    +    H    +  L+  LT          ++ K+  +  + E+  V  + L+    ++Q  V  FID+      T    SG+ P+  +KQ L+ K G  R ++MGKR +Y+AR+VI+ DPN+  +++GVP + A  LT+PE VT +N   L+Q V NG   +PGA  +  E+G  + L      +R+        P S+       + V RH+ N D V+ NRQPTLHK SMM H+V+VLP   T RL+ + T  YNADFDGDEMN+H PQ+   +AE  +LA      +TP S  PV  ++QD ++A   +T++D F  R +    +   +   +G   +       P I+KP  LWTGKQI + ++        PG +N I  +    E    G        + +VL +DG L+ GIL K   G+S   ++H +     P+ A    + +  +  N++     T G+ D    A   K R +I K ++D  +EA  E   +DK   A + EL       LR   ++      T +K+          C    ++ K+  N+   M +SGAKGS +N+SQ++  +GQQ +EG+R+P     +TLP F   +    + G+V+  + +G+ P E++FH M GREGLIDTAVKT+ +GY+QR L K +E V + YD+++R+    L+QF YG D +D        +F  CL
Sbjct:  327 VFRK---EQCVLQYVFHSRPNLSRKLVKADSFFMDVLVVPPTRFRLPSKLGEEVHENSQNQLLSKVLTTSLLIRDLNDDLSKLQKDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQGRT----SGKVPIPGVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELRQAVINGPDKWPGATQIQNEDGSLVSLIGMSVEQRKALANQLLTPSSNVSTHTLNKKVYRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLLNVTPPDMPG-INLISKNKIKNEYWGKGSL------ENEVLFKDGALLCGILDKSQYGASKYGIVHSLHEVYGPEVAAKVLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGREAAAEVTNLDKDTPADDPELLKRLQEILRDNNKSGILDAVTSSKVNAITSQVVSKCVPDGTMKKFPCNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQFMYGGDAIDITKESHMTQFEFCL 1070          

HSP 2 Score: 89.3521 bits (220), Expect = 5.933e-18
Identity = 58/187 (31.02%), Postives = 101/187 (54.01%), Query Frame = 2
Query: 3854 ILDEIC----LQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDIL 4402
            I++EIC    ++ IP I +    +P+ ++ K++++     F+  A W  E          A  DVD  T  SN +  + +T+G+EAARN I  E+++V S     V++RHL L+ ++MT +G  ++ +R G+    T +  + S+E T   L +A    E + +   S  I++G+L  +GTG FD+L
Sbjct: 1488 IVEEICRKSIIRQIPHIDRCV--HPEPENGKRVLVTEGVNFQ--AMWDQE----------AFIDVDGIT--SNDVAAVLKTYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGM-ETSTSSFMKMSYETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1657          

HSP 3 Score: 86.6557 bits (213), Expect = 3.818e-17
Identity = 39/71 (54.93%), Postives = 56/71 (78.87%), Query Frame = 2
Query: 3209 IKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEII-NVSRNPKTPSLTV 3418
            ++ ++ +SL+ PGE VG +A++S+GEP+TQMTLNTFH+AG  A NVTLG+PRL+EI+   S   KTP +T+
Sbjct: 1170 MQLKYMRSLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTL 1240          

HSP 4 Score: 59.3066 bits (142), Expect = 6.734e-9
Identity = 36/99 (36.36%), Postives = 47/99 (47.47%), Query Frame = 3
Query:   69 EVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKC 365
            E+  V FGIL+A EI+ LS          +    G P   GL D   G F + + C TCG     CPGH GHI L  P ++  F  ++   LR+ C  C
Sbjct:   10 EITSVDFGILTAKEIRNLSAKQITNPTVLDNL--GHPVSGGLYDLALGAFLR-NLCSTCGLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFC 105          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Nematostella
Match: EDO39976 (DNA-directed RNA polymerase [Source:UniProtKB/TrEMBL;Acc:A7S8F9])

HSP 1 Score: 1136.71 bits (2939), Expect = 0.000e+0
Identity = 566/912 (62.06%), Postives = 696/912 (76.32%), Query Frame = 3
Query:   33 MANLDLPSVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDRDEMD--------------------LKTQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQ-PLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNGT-MYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
            MA +     PLR+VKRVQFGILS  EIK++SV  + G+ Y+E  + G+PK +GLMDPRQG  D++S CQTC G++ ECPGHFGHI LA+PVFH+GF  KI+K LR VCF CSKLL D+N+  VKEIL K+   PRKR   MYD C+   +C       DE+D                    L     +  GCG  QP FR+  LE     K  + D++ K+  L A +V EIF+RI++E+C  +G +PK +RP+ MI+TVL VPPL VRP++V++ T +S DDLTHKL ++VK NN +R  E NG A+ I+ E    LQYHVAT  DNE P LP A+QKSGRPLK++KQRLK K GRIR NLMGKR D+SAR VIT DPNL++DQVGVPR IAQNLTFPE VTPFN   +Q+LV+ G   YPGA ++IR+NG+R+DL+  P  SD+ LQ+G  VERH+ ++D ++FNRQPTLHKMSMM HRVK+LP+STFRLNLSVT+PYNADFDGDEMNLH+PQSLE+KAE++++  V + I+TPQSNKPVM IVQD+LTA  K T RDVF+ +  +M+LLM++PTW+G++P+PAI KP  LWTGKQI S+IIPG VN IRTHSTHP+ E++GPYK ISPGDTK         + ILCKK+LG+S+GSLIHIIA+E   D A  F+++VQ VVNNWLL+EGH+IGI D + D+ T +EI++   +AK+ V E I+KAHN EL+ TPGNTLRQTFE  VN+ILND RDKTG  AQKSLS++NNF  MV++G+KGSKINISQVIA VGQQNVEGKRIPFGF+ RTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKT+ETGYIQRRL+KAME + + YD TVRN  +QLIQ RYGEDG+DG  +EF
Sbjct:    1 MALVSGSPAPLRDVKRVQFGILSPDEIKQMSVTTDGGVKYSETMEGGRPKLNGLMDPRQGTIDRFSRCQTCAGNMTECPGHFGHIELAKPVFHVGFMTKIVKTLRCVCFYCSKLLVDLNNPRVKEILSKSHGQPRKRMMHMYDLCKGKNICE----GGDEVDAGVLAQDNPNEAEKKLVRIYLPNAYCNHGGCGRYQPKFRKTALELTAEWKHVNEDANEKKITLTAERVYEIFKRISDEECNALGMDPKNARPDWMIVTVLPVPPLPVRPSIVLSGTARSQDDLTHKLADIVKANNNLRRNELNGAAAHIIAEDTRLLQYHVATLTDNEIPGLPRAMQKSGRPLKSVKQRLKSKEGRIRGNLMGKRVDFSARAVITPDPNLSIDQVGVPRTIAQNLTFPEIVTPFNIDSMQELVRRGNNQYPGAKYIIRDNGERVDLRFHPKPSDLHLQFGYKVERHIRDNDVIIFNRQPTLHKMSMMGHRVKILPWSTFRLNLSVTTPYNADFDGDEMNLHVPQSLESKAEITEIMMVPRNIVTPQSNKPVMGIVQDSLTAVRKFTKRDVFIEKDAMMNLLMWIPTWDGKIPQPAILKPRPLWTGKQICSMIIPGNVNVIRTHSTHPDDEDSGPYKHISPGDTK---------ARILCKKSLGTSSGSLIHIIAMELGHDIARMFYSDVQCVVNNWLLLEGHSIGIGDCIADSDTYDEIQRATKKAKKEVIEVIEKAHNDELEPTPGNTLRQTFENQVNRILNDCRDKTGGSAQKSLSEFNNFKAMVVAGSKGSKINISQVIAVVGQQNVEGKRIPFGFRHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTSETGYIQRRLVKAMEGLSVAYDGTVRNSNNQLIQLRYGEDGMDGIAIEF 899          

HSP 2 Score: 688.337 bits (1775), Expect = 0.000e+0
Identity = 367/711 (51.62%), Postives = 481/711 (67.65%), Query Frame = 2
Query: 2687 GICGI----QSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETGGRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNL-NLVLRIXXXXX---XXXXXXXXXXXXXXXYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALP---MMSGVAHNLYMVG---GATPMNSA-SPQLTPWTTLSSPYTFSPKPNSFGA------------------SFSPIAHSEIGMSPNPALAFSPMMSPKTPMDYGFGRYSPSMNPISPA 4720
            G+ GI    Q++PT +P+   FE++F FD +N+  ++RYL E  VR+++  A  + +L+ E+++L +DRE++R I +     RV LP N++RL+ N QK F I     +D+ P+ +IE V  L   L++V G+D+ISK A  NATLLF  L+RS LC K+V +E+ LS EAF+W+LGEI+TRFN S V+PGEMVGALAA+SLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVS+ PKTPSLTVFL G AA+DAEMAK++  RLEHTTLRK+   + IYYDP+P+++VI  D+++V  YYE+PDFD+ + SP+LLRI L RK+MTDKKLT++ I+EKI   F +D+ C   DDN   LVLRIR++     + + D++  +M+D  +L  +E  +L ++ LQGI  ISKVY++ P  D KK+IV+   G F+   EW+LETDG  L +VL+ERDVD   T SN I EIF   GIEA R A+EREM HVISFDGSYVNYRHLALLC+IMT +G LM+I RHGINRQE GAL RSSFEETVD+LM+A AHAE D ++GVSE I++G+L +IGTG FD++++ EKC     +P   M  G+   +  +G   GA    SA SPQ+TPW   ++P          G+                    SP   S   MSP P    SP   P +P        SP  +P SPA
Sbjct:  891 GMDGIAIEFQNMPTMRPSKTAFERKFHFDPTNDRWMTRYLQEDLVRDLSGSATALQELEGEFNKLQEDREILRKI-QPSGNARVALPVNLSRLIWNAQKTFHITNRSASDLHPLRVIEGVRELSKKLVIVAGEDHISKQAQFNATLLFNILLRSTLCTKRVAEEFHLSSEAFEWLLGEIETRFNHSHVKPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSKKPKTPSLTVFLIGQAARDAEMAKAVLCRLEHTTLRKVTANTAIYYDPDPQNTVIAEDQDFVNVYYEMPDFDVARISPWLLRIELDRKRMTDKKLTMEQISEKINLGFGDDLNCIFNDDNAEKLVLRIRIMNNDDGKMQDDEDVDKMDDDVFLRCIEANMLTDMTLQGIESISKVYMNLPHEDKKKRIVVTEQGEFKAIQEWLLETDGVSLMRVLSERDVDPVRTTSNDICEIFSVLGIEAVRKAVEREMDHVISFDGSYVNYRHLALLCDIMTCRGHLMAITRHGINRQEVGALMRSSFEETVDVLMDAAAHAETDYLRGVSECIIMGKLPRIGTGSFDLMLDAEKCKHGMEIPTNIMGPGMGGAMAAIGVFFGAAGSPSAMSPQMTPWNMGATPAYMEAWSPGMGSGMTPGAASFSPSAASDASGMSPGGFSPSWMSPTPGSPVSP--GPTSPYIPSPAAASPGYSPSSPA 1598          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Nematostella
Match: EDO36291 (DNA-directed RNA polymerase [Source:UniProtKB/TrEMBL;Acc:A7SJ34])

HSP 1 Score: 573.548 bits (1477), Expect = 2.587e-175
Identity = 336/902 (37.25%), Postives = 503/902 (55.76%), Query Frame = 3
Query:   66 REVKRVQFGILSASEIKR---LSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLA----------DVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDRDEMDLK--TQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXX----XXKQPLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMN-HTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNGT-MYPGAAFVIRENGDRIDLKRRPDSSDI--QLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNG-----RLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGS-SAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLD 2684
            +++  + FG+ S  ++++   L  + +N  +Y +      P   G++DP  G   K   C+TCG  +A+C GH+G+I+L  PVFH+G     I IL+ VC  C ++L            +   N+  + KK               C     C   N    ++ L     E  ++    V PI       + V L+++   S     +++ L   +VL+IF++I E+D  L+ F+P  S P  +IM  +  PP+ +RP+V+    +G + DD+T KLTE+V +N+ IR     G    +++E  + LQ   A +I++E   +P  +Q   +  +   QRLKGK GR R NL GKR D+S RTVI+ DPNL +DQV VP  +A+ LT+PE+VT  N   ++QLV NG   +PGA F+ +   +     +  +   I  QL+ G+TVERH+++ D V+FNRQP+LHK+S+M H   V P  TFR N  V +PYNADFDGDEMNLHLPQ+ E KAE   L  V   ++TP++ +P+++ +QD +T    +T +DVFL+R+ +  L   +           LP PAI+KP RLWTGKQ+FS+++          +     ++    + +   D+ V+I + +L+ G L K  LGS S  S+ +++  +     A      V  +   +L   G +IGI D        +  +  +        + I++    +LQ+ PG +   T E  + K L+  RD  G    + L K N    M + G+KGS INISQ+IACVGQQ + GKRIP GF+ R+LPHF +    P ++GFV+NS+ +GLTPTEFFFHAMGGREGL+DTAVKTAETGY+QRRL+K++E +  +YD TVR     ++QFRYG DGLD
Sbjct:   13 KKISHINFGMFSPEQMQQYSHLQCISKN--LYNQDNTR-TPVPYGVLDPHMGTCSKDRMCETCGKGLADCVGHYGYIDLELPVFHVGHFRSTIIILQCVCKNCCRVLLPPAEKKQFLDTLKKPNISSLAKKGMKKKIVEKCKKISHC---PYCEDLNGFVRKVGLMKIVHEKYKTTRKIVDPIISDFQSSFDVALENNKELSPLLPKAQEVLNPLRVLDIFQQIPEQDYPLLMFSPGMSHPHDLIMRRILAPPVCIRPSVISELASGSNEDDVTMKLTEIVFLNDVIRKHRSVGAKVQMIMEDWDFLQLQCALYINSEMSGIPLNMQPK-KGTRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLRIDQVAVPIHVAKVLTYPERVTQSNLKLMKQLVLNGADQHPGANFIQQRETNTKRFLKYGNRKLIAKQLKIGDTVERHLIDGDVVLFNRQPSLHKLSIMAHLATVRPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALTLMGVKNNLVTPRNGEPLIAAIQDFITGAYLLTYKDVFLDRSHIAQLCASILAGKDTGVDIELPPPAIHKPCRLWTGKQVFSVLLRPNPKVKVRMNLRARGKQYTSGEDLCVNDSFVVIHNSDLMCGALDKAVLGSGSKNSVFYVLLRDFGQQVAADAMWRVARICPFFLSNRGFSIGIGDVTPGHGLLQAKEDLLSTGYSKCEDYINEFREGKLQTQPGCSAEDTLEAVILKELSVIRDHAGKACLRELHKSNTPLTMAVCGSKGSFINISQMIACVGQQAISGKRIPDGFEDRSLPHFKRHSKLPAAKGFVKNSFFSGLTPTEFFFHAMGGREGLVDTAVKTAETGYMQRRLVKSLEDLSTQYDITVRTSTGDIVQFRYGGDGLD 907          

HSP 2 Score: 188.348 bits (477), Expect = 7.701e-48
Identity = 127/433 (29.33%), Postives = 211/433 (48.73%), Query Frame = 2
Query: 3152 KVIDEY-RLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLNLVLRIXXXXXXXXXXXXXXXXXXXXYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALPMM 4447
            K++D   R +       L   + ++ ++ ++PG  VGA+ A+S+GEP TQMTL TFH+AGV++ N+TLGVPR+KEIIN SR   TP ++  L  +  +D E+A+++  R+E T L ++    E  + P+    +I+ D E +R    L   ++D  +       +     + +KL L     ++     + +IC  P ++    L                      Y+       L  + ++G   +++  IH           I+ + +  G+  + L  +G  LQ V++   V    T SN+  E+    GIEAAR  I  E+ + +   G  ++ RH+ LL E+M  KG ++ I RHG+ + +   L  +SFE T D L EA  H   DP+ GVSE I++G    IGTG F +L    +  +    P++
Sbjct:  997 KIVDYVNRCTETQLKLFLSMCREKYLRARMEPGSAVGAICAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASRKISTPIISAQLQDD--RDQELARAVKGRIERTLLGEVTEYIEEVFLPDNCYLLIKLDTERIR----LLKLEVDADT-------IQAAICSSRKLRLNQSQVRV---HSSAVICVYPTESAKSSLH---------------------YVMQQLRSDLPGVLIKGYKNVTRAIIH-----------IDEEQSRGGEEHYKLLVEGDDLQAVISTMGVKGNGTTSNNTIEVERVLGIEAARQTIMNEIIYTMKNHGMSIDVRHVMLLAELMAFKGEILGITRHGLAKMKESVLMLASFERTADHLFEAALHGRKDPIDGVSECIIMGMPMNIGTGMFKLLHKPTRSGDPSRRPLI 1381          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Nematostella
Match: EDO39496 (DNA-directed RNA polymerase [Source:UniProtKB/TrEMBL;Acc:A7S9W9])

HSP 1 Score: 285.034 bits (728), Expect = 2.869e-78
Identity = 187/570 (32.81%), Postives = 285/570 (50.00%), Query Frame = 3
Query: 1143 MIAQNLTFPEKVTPFNKHYLQQLVKNGTM-YPGAAFVIRENGDRIDL------KRRPDSSDIQLQYGET---------VERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFS-TFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGR---LPKPAIYKPLRLWTGKQIFSLI----IP---------GRVNCIRTHSTHPEPEENGPYKWISPGD----TKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDR-------AKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKY------------NNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLD 2684
            + A+ LT+P+ VT +N   L+Q V NG + +PGA  V  E+G +I L      +R+  +  +    G+          V RH+ N D ++ NRQPTLH+ S+M H+V+VLP   T RL+ +    YNADFDGDEMN H PQ+   +AE   +A      + P+   P+  ++QD + +   MT R    N+ +   L+     +  +   L  P I KP + W+GKQ+ S I    IP         G+      +    +P        +  GD    ++V+I DG L+ G+L K   G++   L+H          +G   + +  V  ++L   G T+G+ D L   +  +  ++ I +       A  + F   +  H  +L++        + + T  K L+    K     Q S++K             NN  LMV SGAKGS +N  Q+   +GQ  +EG+R P     R+LP F+  D  P + GFV+  +L G+ P E+FFH M GREGL+DTAVKT+ +GY+QR LIK +E + + YD TVR+    ++QF YGEDGLD
Sbjct:    2 VFAKKLTYPQPVTTWNVKELRQAVINGPLVHPGAILVESEDGKKIRLSETDVNQRQAIAKRLLTPSGDNKGSHVNCKKVYRHIQNGDVMLLNRQPTLHRPSIMAHKVRVLPSEKTIRLHYANCKAYNADFDGDEMNAHFPQNELARAEAYTIASTNFNYLVPKDGTPLSGLIQDHMVSGVLMTIRGRMFNKLDYQQLVYGALNFKNQPIELLMPCILKPTQFWSGKQVISTILLNLIPLGSKRLNLKGKAKISAKNWNTRKPRRQFLDLEVLKGDDMSESEVVIRDGHLLCGVLDKAHYGNTPYGLVHCCNELYGGVMSGELLSALARVFTSFLQFHGFTLGVKDILVTERADKIRRKLIAKGRVSGKDAATSAFGMPEDCHRSDLEARMQRAHHNS-DGTDMKELDLCMKKKTDHYQDSINKACLPLGLYQRFPGNNLQLMVQSGAKGSAVNCMQISCLLGQIELEGRRPPIMLSGRSLPSFLPYDTSPRAGGFVDGRFLTGIRPQEYFFHCMAGREGLVDTAVKTSRSGYLQRCLIKHLEGLQVAYDLTVRDSDGSIVQFYYGEDGLD 570          

HSP 2 Score: 88.9669 bits (219), Expect = 1.692e-17
Identity = 48/108 (44.44%), Postives = 69/108 (63.89%), Query Frame = 2
Query: 3227 QSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEII-NVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESS 3547
            +SLV PGE VG LAA+S+GEP+TQMTLNTFH+AG    NVTLG+PR++EI+   S N KTP++ + L     K  + AK +  +L    L ++    +++    P+ S
Sbjct:  752 RSLVDPGEAVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRMREILMTASANIKTPTMDMPLLA-GKKVIKRAKKLQQKLNRVMLSQVLRSIDVWESLSPKES 858          

HSP 3 Score: 60.077 bits (144), Expect = 1.108e-8
Identity = 47/154 (30.52%), Postives = 80/154 (51.95%), Query Frame = 2
Query: 3944 INSDGAFEGKAEWILETDGTCLQKVLAERDV-DSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDIL 4402
            IN     E K   +L+T+G  LQ      ++ + +   +N I  +  T+GIEAA  AI +E+ +V    G +V+ RHL L+ + MT++G + + +R GI         + SFE T   L  A    + + +K  S  +++G++   GTG F++L
Sbjct: 1086 INRCFLVEEKTNSVLKTEGVNLQVAFRYPNIINVDKLYTNDIHAVARTYGIEAAARAITKEVKNVFGGYGIHVDPRHLTLVSDYMTYEGKIKAFNRIGIE-SSASPFQKMSFETTTHFLRGAVLSGDMESLKSPSSRLVVGRVVGGGTGSFELL 1238          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Nematostella
Match: EDO27435 (DNA-directed RNA polymerase [Source:UniProtKB/TrEMBL;Acc:A7T993])

HSP 1 Score: 109.383 bits (272), Expect = 1.055e-24
Identity = 123/459 (26.80%), Postives = 200/459 (43.57%), Query Frame = 3
Query:  174 KPKKDGLMDPRQ-GPFDKYS--------------YCQTCGGSVAECP---GHFGHINLARPVFHIGF----KEKIIKILRSVCFKCSKLLAD----VNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVP--NSDRDEMDLKTQEMSRSGCGYVQPIFRRNGLEYF-VTLKXXXXXXXXKQ----PLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQ-KSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNGTMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLN 1448
            KP++DGL   R  GP   Y                C  CG  V E        GHINL  P+ HI +      KI  IL     K   ++      V    + + L+   +N   + DF+ +E   N + ++P  N   D+ D   + +++ G   +  +  R  L+     L+  ++   SKQ     L+   V+E FR   +          + + PE MI+ V+ V P  +RP V ++    +  DL      V+  NN ++   E      IL  ++  LQ  V +  DN      +A++ +S RPLK+L   LKGK GR R NL+GKR DYSAR+VI   P + L + G+P+ +A  L  P          +++L++ G +       ++     ID K+ P   DI          +++    V+ NR PTLH++ +   + K++     +L+
Sbjct:   37 KPERDGLFCERIFGPVKDYECACGKYKRIRYKGIVCDRCGVEVTEKKVRRDRVGHINLVVPIAHIWYFRSLPNKIGYILGLPSKKLDMIIYYERYVVIQPGIAQGLEGETLN---KLDFLTEEEYLNILDTLPMENQYLDDND-PNKFIAKMGAECIMDLLSRIDLDSLSFQLRHAANTETSKQRKTEALKRLNVVESFREANKN---------RENLPEWMILKVIPVIPPELRPLVPLDGGRFATSDLNDLYRRVIIRNNRLKRLMEIKAPEVILRNEKRMLQEAVDSLFDNTRK--ASAVKTESNRPLKSLSDSLKGKQGRFRQNLLGKRVDYSARSVIVVGPEMRLFECGLPKDMAAELYKP--------FVIRKLIERGIVK-----TVKSAKKIID-KKEPVVWDIL--------ENVIKGHPVLLNRAPTLHRLGIQAFQPKLIEGKAIQLH 458          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Nematostella
Match: EDO39497 (DNA-directed RNA polymerase [Source:UniProtKB/TrEMBL;Acc:A7S9X0])

HSP 1 Score: 56.9954 bits (136), Expect = 5.225e-10
Identity = 32/75 (42.67%), Postives = 40/75 (53.33%), Query Frame = 3
Query:   93 ILSASEIKRLSVVGENGIIYAEKTQDG--KPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFH 311
            + S  E+++LSV      I   +T D    P   GL DP  GP D+   C TCG +   CPGHFGHI L  PV+H
Sbjct:    1 LYSREEVRKLSVK----RITNPETFDALLHPNHGGLYDPVLGPTDRDDLCGTCGQNNFSCPGHFGHIELPLPVYH 71          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Medaka
Match: polr2a (RNA polymerase II subunit A [Source:NCBI gene;Acc:101160848])

HSP 1 Score: 1223.38 bits (3164), Expect = 0.000e+0
Identity = 592/897 (66.00%), Postives = 716/897 (79.82%), Query Frame = 3
Query:   54 SVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDRDEMDLK------------TQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQPLRAYQ-VLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
            + PLR +KRVQFGI+S  E+KR+SV  E GI Y E T+ G+PK  GLMDPRQG  ++   CQTC G++ ECPGHFGHI LA+PVFH+GF  KI+K+LR VCF CSKLL D N+  +K+IL K++  PRKR   +Y+ C+   +C       +EMD K            T+E    GCG  QP  RR+GLE F   K  + DS  K+ L + + V EIF+RI++E+ L++G +PK++RPE MI+TVL VPPLAVRPAVVM  + ++ DDLTHKL ++VK+NN++R  E++G A+ ++ E    LQ+HVAT +DNE P LP A+QKSGRPLK++KQRLKGK GR+R NLMGKR D+SARTVIT DPNL +DQVGVPR IA N+TFPE VTPFN   LQ+LV+ G + YPGA ++IR+NGDRIDL+  P  SD+ LQ G  VERHM + D V+FNRQPTLHKMSMM HRV++LP+STFRLNLSVT+PYNADFDGDEMNLHLPQSLET+AE+ +LA V ++I+TPQSN+PVM IVQDTLTA  K T RDVFL R EVM+LLM+L TW+G++P+PAI KP  LWTGKQIFSLIIPG +N IRTHSTHP+ E++GPYK ISPGDTKV++E+GELI GILCKK+LG+SAGSL+HI  LE   D    F++N+QTVVNNWLLIEGH+IGI D++ DAKT  +I+ TI +AK+ V E I+KAHN EL+ TPGNTLRQTFE  VN+ILNDARDKTGS AQKSLS+YNNF  MV++G+KGSKINISQVIA VGQQNVEGKRIPFGF+ RTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIK+MESVM+KYD+TVRN I+Q++Q RYGEDGL G  VEF
Sbjct:   10 ACPLRTIKRVQFGIISPDELKRMSVTTE-GIKYPETTEGGRPKLCGLMDPRQGVIERSGRCQTCAGNMTECPGHFGHIELAKPVFHVGFISKIMKVLRCVCFFCSKLLVDSNNPKIKDILTKSKGQPRKRLTHVYELCKGKNICE----GGEEMDNKFGVEQQDTEEDITKEKGHGGCGRYQPRIRRSGLELFAEWKHVNEDSQEKKILLSPERVHEIFKRISDEEDLILGMDPKFARPEWMIVTVLPVPPLAVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQSGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSIKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLQIDQVGVPRSIAANMTFPEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQIGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKMPQPAILKPRPLWTGKQIFSLIIPGHINVIRTHSTHPDDEDSGPYKHISPGDTKVIVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVVNNWLLIEGHSIGIGDSIADAKTYLDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVAGSKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGENVEF 901          

HSP 2 Score: 724.931 bits (1870), Expect = 0.000e+0
Identity = 384/723 (53.11%), Postives = 503/723 (69.57%), Query Frame = 2
Query: 2645 SIDSVPIRRGWARWGICG----IQSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETG-GRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNL-NLVLRIXXXXXXXXXXXXXXXXXXXX----YLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALPM-MSGVA----HNLYMVGGATPMNSASPQLTPWTTLSSPY--TFSPKPNS----FGASFSPIAHSEI-GMSPNPALAFSPMMSPKTPMDYG---------FGRYSPSMNPISPA 4720
            SI+ V ++  +   G+ G     Q+L + KP+   FEK+F+FD +N+  L R L E  V+++ T A     L+ E+D++ +DRE++R I    TG  +VVLPCN+ R++ N QKIF+I+    TD+ P+ ++E V+ L   LI+V GDD +S+ A ENATLLF   +RS LC K++ +E+RLS EAFDW+LGEI+T+FNQS+  PGEMVGALAA+SLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKE+IN+S+ PKTPSLTVFL G AA+DAE AK I  RLEHTTLRK+   + IYYDP P+++V+  D+EWV  YYE+PDFD+ + SP+LLRI L RK MTD+KLT++ IAEKI   F +D+ C   DDN   LVLRIR++  ++ K  E  E+ D+     +L  +E+ +L ++ LQGI QISKVY+H P+TD+KKKI+I  DG F+   EWILETDG  L +VL+E+DVD   T SN I EIF   GIEA R A+ERE++HVISFDGSYVNYRHLALLC+ MT +G LM+I RHGINRQ+TG L + SFEETVD+LMEA +H ECDPMKGVSE+IMLGQLA  GTGCFD+L++ EKC     +P  + G++      ++     +PM+  SP +TPW T ++P    +SP   S      A FSP A S+  G SP  + A+SP  +P +P   G          G  SP+ +P SPA
Sbjct:  880 SINQV-VQLRYGEDGLAGENVEFQNLASLKPSNKAFEKKFKFDCTNDRALRRVLQEDVVKDVMTNAHVQSVLEKEFDKMKEDREILRAIFP--TGDSKVVLPCNLARMIWNAQKIFRINPRTPTDLNPLRVVEGVQELSKKLIIVNGDDPLSRQAQENATLLFNIHLRSTLCSKRMTEEFRLSTEAFDWLLGEIETKFNQSIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKRPKTPSLTVFLLGQAARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQNTVVAEDQEWVNVYYEMPDFDVTRISPWLLRIELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKFQEDEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGINRQDTGPLMKCSFEETVDVLMEAASHGECDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGISVAGPTGMFFGSVPSPMSGMSPAMTPWNTGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSP--TPGSPGSPGPLSPYIPSPGGAMSPNYSPTSPA 1597          

HSP 3 Score: 60.4622 bits (145), Expect = 2.850e-8
Identity = 35/80 (43.75%), Postives = 46/80 (57.50%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYS-GNMSYSPTSPQYSPATSGYVANSPSY------GQQNTNSNSGYSPQSP 5695
            Y+PTSP +SP+   Y+P SP T    SP Y+  +  YSPTSP YSP +  Y   SP+Y      G   + ++ GYSP SP
Sbjct: 1872 YSPTSPTYSPTTPKYSPTSP-TYSPTSPTYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSP 1950          

HSP 4 Score: 55.0694 bits (131), Expect = 1.134e-6
Identity = 32/74 (43.24%), Postives = 45/74 (60.81%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYS-GNMSYSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP 5695
            Y+PTSP +SP+   Y+P SP T    +P YS  + +YSPTSP Y+P +  Y   SP+Y    + ++  YSP SP
Sbjct: 1858 YSPTSPKYSPTSPKYSPTSP-TYSPTTPKYSPTSPTYSPTSPTYTPTSPKYSPTSPTY----SPTSPKYSPTSP 1926          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Medaka
Match: polr2a (RNA polymerase II subunit A [Source:NCBI gene;Acc:101160848])

HSP 1 Score: 1222.99 bits (3163), Expect = 0.000e+0
Identity = 592/897 (66.00%), Postives = 716/897 (79.82%), Query Frame = 3
Query:   54 SVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDRDEMDLK------------TQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQPLRAYQ-VLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
            + PLR +KRVQFGI+S  E+KR+SV  E GI Y E T+ G+PK  GLMDPRQG  ++   CQTC G++ ECPGHFGHI LA+PVFH+GF  KI+K+LR VCF CSKLL D N+  +K+IL K++  PRKR   +Y+ C+   +C       +EMD K            T+E    GCG  QP  RR+GLE F   K  + DS  K+ L + + V EIF+RI++E+ L++G +PK++RPE MI+TVL VPPLAVRPAVVM  + ++ DDLTHKL ++VK+NN++R  E++G A+ ++ E    LQ+HVAT +DNE P LP A+QKSGRPLK++KQRLKGK GR+R NLMGKR D+SARTVIT DPNL +DQVGVPR IA N+TFPE VTPFN   LQ+LV+ G + YPGA ++IR+NGDRIDL+  P  SD+ LQ G  VERHM + D V+FNRQPTLHKMSMM HRV++LP+STFRLNLSVT+PYNADFDGDEMNLHLPQSLET+AE+ +LA V ++I+TPQSN+PVM IVQDTLTA  K T RDVFL R EVM+LLM+L TW+G++P+PAI KP  LWTGKQIFSLIIPG +N IRTHSTHP+ E++GPYK ISPGDTKV++E+GELI GILCKK+LG+SAGSL+HI  LE   D    F++N+QTVVNNWLLIEGH+IGI D++ DAKT  +I+ TI +AK+ V E I+KAHN EL+ TPGNTLRQTFE  VN+ILNDARDKTGS AQKSLS+YNNF  MV++G+KGSKINISQVIA VGQQNVEGKRIPFGF+ RTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIK+MESVM+KYD+TVRN I+Q++Q RYGEDGL G  VEF
Sbjct:   10 ACPLRTIKRVQFGIISPDELKRMSVTTE-GIKYPETTEGGRPKLCGLMDPRQGVIERSGRCQTCAGNMTECPGHFGHIELAKPVFHVGFISKIMKVLRCVCFFCSKLLVDSNNPKIKDILTKSKGQPRKRLTHVYELCKGKNICE----GGEEMDNKFGVEQQDTEEDITKEKGHGGCGRYQPRIRRSGLELFAEWKHVNEDSQEKKILLSPERVHEIFKRISDEEDLILGMDPKFARPEWMIVTVLPVPPLAVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQSGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSIKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLQIDQVGVPRSIAANMTFPEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQIGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKMPQPAILKPRPLWTGKQIFSLIIPGHINVIRTHSTHPDDEDSGPYKHISPGDTKVIVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVVNNWLLIEGHSIGIGDSIADAKTYLDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVAGSKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGENVEF 901          

HSP 2 Score: 709.909 bits (1831), Expect = 0.000e+0
Identity = 374/704 (53.12%), Postives = 488/704 (69.32%), Query Frame = 2
Query: 2645 SIDSVPIRRGWARWGICG----IQSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETG-GRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNL-NLVLRIXXXXXXXXXXXXXXXXXXXX----YLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALPM-MSGVAHNLYMVGGATPMNSASPQLTPWTTLSSPYTFSPKPNSFGASFSPIAHSEIGMSPNPALAFSPMMSPKTPMDYGFGRYSPSMNPISPAG 4723
            SI+ V ++  +   G+ G     Q+L + KP+   FEK+F+FD +N+  L R L E  V+++ T A     L+ E+D++ +DRE++R I    TG  +VVLPCN+ R++ N QKIF+I+    TD+ P+ ++E V+ L   LI+V GDD +S+ A ENATLLF   +RS LC K++ +E+RLS EAFDW+LGEI+T+FNQS+  PGEMVGALAA+SLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKE+IN+S+ PKTPSLTVFL G AA+DAE AK I  RLEHTTLRK+   + IYYDP P+++V+  D+EWV  YYE+PDFD+ + SP+LLRI L RK MTD+KLT++ IAEKI   F +D+ C   DDN   LVLRIR++  ++ K  E  E+ D+     +L  +E+ +L ++ LQGI QISKVY+H P+TD+KKKI+I  DG F+   EWILETDG  L +VL+E+DVD   T SN I EIF   GIEA R A+ERE++HVISFDGSYVNYRHLALLC+ MT +G LM+I RHGINRQ+TG L + SFEETVD+LMEA +H ECDPMKGVSE+IMLGQLA  GTGCFD+L++ EKC     +P  + G++     V G + M   +   +P +  S    FSP    +  ++SP   S    SP P   + P  SP   M   +   SP+  P SP G
Sbjct:  880 SINQV-VQLRYGEDGLAGENVEFQNLASLKPSNKAFEKKFKFDCTNDRALRRVLQEDVVKDVMTNAHVQSVLEKEFDKMKEDREILRAIFP--TGDSKVVLPCNLARMIWNAQKIFRINPRTPTDLNPLRVVEGVQELSKKLIIVNGDDPLSRQAQENATLLFNIHLRSTLCSKRMTEEFRLSTEAFDWLLGEIETKFNQSIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKRPKTPSLTVFLLGQAARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQNTVVAEDQEWVNVYYEMPDFDVTRISPWLLRIELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKFQEDEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGINRQDTGPLMKCSFEETVDVLMEAASHGECDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGIS-----VAGRSGMTPGAAGFSP-SAASDASGFSP---GYSPAWSPTPGSP--GSPGPLSPYIP--SPGGAMSPNYSPTSPAYEPRSPGG 1567          

HSP 3 Score: 60.4622 bits (145), Expect = 2.548e-8
Identity = 35/80 (43.75%), Postives = 46/80 (57.50%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYS-GNMSYSPTSPQYSPATSGYVANSPSY------GQQNTNSNSGYSPQSP 5695
            Y+PTSP +SP+   Y+P SP T    SP Y+  +  YSPTSP YSP +  Y   SP+Y      G   + ++ GYSP SP
Sbjct: 1834 YSPTSPTYSPTTPKYSPTSP-TYSPTSPTYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSP 1912          

HSP 4 Score: 55.0694 bits (131), Expect = 9.722e-7
Identity = 32/74 (43.24%), Postives = 45/74 (60.81%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYS-GNMSYSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP 5695
            Y+PTSP +SP+   Y+P SP T    +P YS  + +YSPTSP Y+P +  Y   SP+Y    + ++  YSP SP
Sbjct: 1820 YSPTSPKYSPTSPKYSPTSP-TYSPTTPKYSPTSPTYSPTSPTYTPTSPKYSPTSPTY----SPTSPKYSPTSP 1888          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Medaka
Match: polr3a (RNA polymerase III subunit A [Source:NCBI gene;Acc:101157164])

HSP 1 Score: 583.948 bits (1504), Expect = 9.988e-179
Identity = 342/909 (37.62%), Postives = 529/909 (58.20%), Query Frame = 3
Query:   66 REVKRVQFGILSASEIKR---LSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSK-LLADVNSSNVKEILKKTEINPRKRFDF---MYDECRRNKVC---SVPNSDRDEMDLK--TQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQPL--RAYQ------VLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMN-HTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVI-RENGDRIDLKRRPDSSDIQ-LQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGR-----LPKPAIYKPLRLWTGKQIFSLIIPGRVNC-IRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGS-SAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVE 2699
            +++  + FG+ SA ++++   + VV +N  +Y++ T+   P   G++D R G  +K   C TCG ++A+C GH+G+++L  P FH+G+ + +I IL+ +C  CS  +L         ++LK+  +   ++      + ++CR+  VC   S  N    +  L     E  ++    V P       E+  +       +   +PL  RA +      VL +FRRI +ED  L+  NP+  +P  +I+T L VPPL +RP+VV +  +G + DDLT KLTE++ +N+ I+    +G  + +++E  + LQ   A +I++E   +P  +    +  +   QRLKGK GR R NL GKR D+S RTVI+ DPNL +D+V VP  +A+ LT+PE V   N   +++LV+NG  ++PGA F+  R N  +  LK        Q L++G+ VERHM++ D V+FNRQP+LHK+S+M H  +V P  TFR N  V +PYNADFDGDEMNLHLPQ+ E KAE   L      ++TP++ +P+++ +QD LT    +T +D F +R++   ++  +           LP PAI KP+ LWTGKQIFS+I+    +C ++ +      +  G  + +   D+ V+I + EL+ G + K TLGS S  ++ +I+  +    EA    + +  +   +L   G +IGI D        +  +  +D   +   E I+     +LQ  PG +  +T E  + + L+  RD+ GS   + L K N+  +M + G+KGS INISQ+IACVGQQ + G R+P GF+ R+LPHF K    P ++GFV +S+ +GLTPTEFFFH M GREGL+DTAVKTAETGY+QRRL+K++E +  +YD TVR+ +  +IQF YG DGLD A +E
Sbjct:   13 KKISHICFGMKSAEQMRQQAHIQVVSKN--LYSQDTKH-TPLPHGVLDHRMGTSEKDRPCLTCGKNLADCLGHYGYLDLELPCFHVGYFKAVIGILQMICKTCSSIMLTKEEKLQFLDLLKRPNLAYLQKRGLKKKISEKCRKRTVCLNCSAFNGTVKKCGLLKIIHEKYKTTKKVVDPFVS----EFMQSFDTAIEHNKLIEPLLNRAQENLNPLVVLNLFRRIPDEDIPLLLMNPEAGKPADLIITRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRMSGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPK-KWTRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTYPEMVNKANLELMRKLVRNGPDVHPGANFIQNRRNQIKRFLKYGNREKIAQELRFGDIVERHMIDGDVVLFNRQPSLHKLSIMAHIARVKPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALILMGTKANLVTPRNGEPLIAAIQDFLTGAYLLTLKDTFFDRSKACQIVASILVGKDEKVRISLPHPAILKPMALWTGKQIFSMILRPSKDCPVKANLRTKGKQYCGKGEDLCYNDSFVVIHNSELMCGSMDKGTLGSGSKNNIFYILLRDWGQLEAANAMSRLARLAPVYLSNRGFSIGIGDVTPGHGLLKAKQDLLDDGYKKCDEYIEALQTGKLQQQPGCSAEETLEALILRELSVIRDRAGSACLRELDKSNSPLIMALCGSKGSFINISQMIACVGQQAISGSRVPDGFENRSLPHFEKHSKLPAAKGFVADSFYSGLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSMGDIIQFIYGGDGLDPAAME 913          

HSP 2 Score: 186.808 bits (473), Expect = 6.010e-47
Identity = 124/416 (29.81%), Postives = 213/416 (51.20%), Query Frame = 2
Query: 3170 RLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLNLVLRIXXXXXXXXXXXXXXXXXXXXYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEK 4417
            R++P   +  L   + ++ ++ ++PG  VGAL A+S+GEP TQMTL TFH+AGV++ N+TLGVPR+KEIIN S+N  TP +T  L  +   DA+ A+ +  R+E T L +++   E  + P+    +++   E +R    L   +++ ++   +R  +   K+  K   +    E +        +C  P +N                              L E+L   ++ +QGIP++++  IH  +                GK ++ L  +G  ++ V+A   V+   T SN+  E+ +T GIEAAR+ I  E+ + +   G  ++ RH+ LL ++M++KG ++ I R G+ + +   L  +SFE+T D L +A    + D + GVSE I++G    IGTG F +L   +K
Sbjct: 1005 RITPTQLEKFLETCRDKYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKNISTPIITAQL--DVEDDADFARLVKGRIEKTLLGEISEYIEEVFLPDDCFILVKLSLERIR----LLRLEVNAET---VRYSICMSKLRVKPGDIAVHGEAV--------VCVSPREN-------------------NKSSMYYVLQSLKEDL--PKVVVQGIPEVARAVIHIDEQ--------------SGKNKYKLLVEGDNMRAVMATHGVNGSRTTSNNTYEVEKTLGIEAARSTIINEIQYTMVNHGMSIDRRHVMLLADLMSYKGEILGITRFGLAKMKESVLMLASFEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADK 1368          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Medaka
Match: polr3a (RNA polymerase III subunit A [Source:NCBI gene;Acc:101157164])

HSP 1 Score: 583.948 bits (1504), Expect = 1.464e-178
Identity = 342/909 (37.62%), Postives = 529/909 (58.20%), Query Frame = 3
Query:   66 REVKRVQFGILSASEIKR---LSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSK-LLADVNSSNVKEILKKTEINPRKRFDF---MYDECRRNKVC---SVPNSDRDEMDLK--TQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQPL--RAYQ------VLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMN-HTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVI-RENGDRIDLKRRPDSSDIQ-LQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGR-----LPKPAIYKPLRLWTGKQIFSLIIPGRVNC-IRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGS-SAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVE 2699
            +++  + FG+ SA ++++   + VV +N  +Y++ T+   P   G++D R G  +K   C TCG ++A+C GH+G+++L  P FH+G+ + +I IL+ +C  CS  +L         ++LK+  +   ++      + ++CR+  VC   S  N    +  L     E  ++    V P       E+  +       +   +PL  RA +      VL +FRRI +ED  L+  NP+  +P  +I+T L VPPL +RP+VV +  +G + DDLT KLTE++ +N+ I+    +G  + +++E  + LQ   A +I++E   +P  +    +  +   QRLKGK GR R NL GKR D+S RTVI+ DPNL +D+V VP  +A+ LT+PE V   N   +++LV+NG  ++PGA F+  R N  +  LK        Q L++G+ VERHM++ D V+FNRQP+LHK+S+M H  +V P  TFR N  V +PYNADFDGDEMNLHLPQ+ E KAE   L      ++TP++ +P+++ +QD LT    +T +D F +R++   ++  +           LP PAI KP+ LWTGKQIFS+I+    +C ++ +      +  G  + +   D+ V+I + EL+ G + K TLGS S  ++ +I+  +    EA    + +  +   +L   G +IGI D        +  +  +D   +   E I+     +LQ  PG +  +T E  + + L+  RD+ GS   + L K N+  +M + G+KGS INISQ+IACVGQQ + G R+P GF+ R+LPHF K    P ++GFV +S+ +GLTPTEFFFH M GREGL+DTAVKTAETGY+QRRL+K++E +  +YD TVR+ +  +IQF YG DGLD A +E
Sbjct:   13 KKISHICFGMKSAEQMRQQAHIQVVSKN--LYSQDTKH-TPLPHGVLDHRMGTSEKDRPCLTCGKNLADCLGHYGYLDLELPCFHVGYFKAVIGILQMICKTCSSIMLTKEEKLQFLDLLKRPNLAYLQKRGLKKKISEKCRKRTVCLNCSAFNGTVKKCGLLKIIHEKYKTTKKVVDPFVS----EFMQSFDTAIEHNKLIEPLLNRAQENLNPLVVLNLFRRIPDEDIPLLLMNPEAGKPADLIITRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRMSGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPK-KWTRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTYPEMVNKANLELMRKLVRNGPDVHPGANFIQNRRNQIKRFLKYGNREKIAQELRFGDIVERHMIDGDVVLFNRQPSLHKLSIMAHIARVKPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALILMGTKANLVTPRNGEPLIAAIQDFLTGAYLLTLKDTFFDRSKACQIVASILVGKDEKVRISLPHPAILKPMALWTGKQIFSMILRPSKDCPVKANLRTKGKQYCGKGEDLCYNDSFVVIHNSELMCGSMDKGTLGSGSKNNIFYILLRDWGQLEAANAMSRLARLAPVYLSNRGFSIGIGDVTPGHGLLKAKQDLLDDGYKKCDEYIEALQTGKLQQQPGCSAEETLEALILRELSVIRDRAGSACLRELDKSNSPLIMALCGSKGSFINISQMIACVGQQAISGSRVPDGFENRSLPHFEKHSKLPAAKGFVADSFYSGLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSMGDIIQFIYGGDGLDPAAME 913          

HSP 2 Score: 186.808 bits (473), Expect = 6.197e-47
Identity = 124/416 (29.81%), Postives = 213/416 (51.20%), Query Frame = 2
Query: 3170 RLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLNLVLRIXXXXXXXXXXXXXXXXXXXXYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEK 4417
            R++P   +  L   + ++ ++ ++PG  VGAL A+S+GEP TQMTL TFH+AGV++ N+TLGVPR+KEIIN S+N  TP +T  L  +   DA+ A+ +  R+E T L +++   E  + P+    +++   E +R    L   +++ ++   +R  +   K+  K   +    E +        +C  P +N                              L E+L   ++ +QGIP++++  IH  +                GK ++ L  +G  ++ V+A   V+   T SN+  E+ +T GIEAAR+ I  E+ + +   G  ++ RH+ LL ++M++KG ++ I R G+ + +   L  +SFE+T D L +A    + D + GVSE I++G    IGTG F +L   +K
Sbjct: 1017 RITPTQLEKFLETCRDKYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKNISTPIITAQL--DVEDDADFARLVKGRIEKTLLGEISEYIEEVFLPDDCFILVKLSLERIR----LLRLEVNAET---VRYSICMSKLRVKPGDIAVHGEAV--------VCVSPREN-------------------NKSSMYYVLQSLKEDL--PKVVVQGIPEVARAVIHIDEQ--------------SGKNKYKLLVEGDNMRAVMATHGVNGSRTTSNNTYEVEKTLGIEAARSTIINEIQYTMVNHGMSIDRRHVMLLADLMSYKGEILGITRFGLAKMKESVLMLASFEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADK 1380          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Medaka
Match: polr1a (RNA polymerase I subunit A [Source:NCBI gene;Acc:101156830])

HSP 1 Score: 337.806 bits (865), Expect = 2.158e-93
Identity = 217/637 (34.07%), Postives = 318/637 (49.92%), Query Frame = 3
Query:  924 LQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDLK----RRPDSSDIQL---------QYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFS-TFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMY-LPTWNGR--LPKPAIYKPLRLWTGKQIFSL----IIP---------GRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWL-LIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGN------------------TLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLD 2684
            LQ HV    D++   L T           ++Q L+ K G  R ++MGKR DY+AR+VI  D  +  +++G+P + A  LT+P+ VTP+N   L+Q V NG  ++PGA+ VI E+G +  L      + ++   QL            + V RH+ N D ++ NRQPTLH+ S+  H  ++LP     RL+ +    YNADFDGDEMN H PQS   +AE   L    +  + P+  KP+  ++QD + +  +MT R  F  R +   L+   L    GR  L  PA+ KP  LWTGKQ+ S     +IP         GR            P     Y+  S  D++V+I  GEL+ G+L K   GSSA  L+H        + +G     +  +   +L L  G T+G+ D L      +  ++ I+ ++    + +  A N      P +                  T    F+   N++ ND           +    NN  LMV SGAKGS +N  Q+   +GQ  +EG+R P     + LP F   D  P + GFV   +L G+ P EFFFH M GREGL+DTAVKT+ +GY+QR +IK +E ++++YD TVR+    ++QF YGEDGLD
Sbjct:  382 LQSHVNIVFDSDMDKLMT------EKYPGVRQILEKKEGLFRKHMMGKRVDYAARSVICPDMYIETNEIGIPMVFATKLTYPQPVTPWNVKELRQAVLNGPNVHPGASMVINEDGRKTILSPTNFTQREAVAKQLLTPSLGPHKMSMKIVNRHIKNGDVLLLNRQPTLHRPSIQAHCARILPGEKVLRLHYANCKAYNADFDGDEMNAHFPQSELGRAEAYTLVSTNQQYLVPKDGKPLAGLIQDHMVSGTRMTIRGCFFTRDQYTELVFRGLTDKRGRVKLLPPAVLKPQHLWTGKQVVSTLLLNVIPEKAVPLNLIGRSKIPSKAWIKLPPRAAPGYQPESMCDSQVVIRQGELLVGVLDKAHYGSSAYGLVHCCYELYGGETSGKLLGCLARLFTAYLQLYRGFTLGVEDILVKPGANKRRRKIIESSRNVGSQALQAAFNLPPGVDPADARSRWQDAHLNPDQRDFSTADHKFKEVANQVNNDINKVCMPVGLHTSFPDNNLQLMVQSGAKGSTVNTMQISCLLGQIELEGRRPPLMPSGKFLPCFQPYDPSPGAGGFVSGRFLTGIKPQEFFFHCMAGREGLVDTAVKTSRSGYLQRCIIKHLEGLVVQYDLTVRDSDGSVVQFLYGEDGLD 1012          

HSP 2 Score: 86.6557 bits (213), Expect = 2.850e-16
Identity = 41/68 (60.29%), Postives = 54/68 (79.41%), Query Frame = 2
Query: 3218 RFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINV-SRNPKTPSLTV 3418
            ++ +SL  PGE VG LAA+S+GEP+TQMTLNTFH+AG    NVTLG+PRL+EI+ V S N KTP +++
Sbjct: 1179 KWQRSLCDPGEAVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILMVASSNIKTPMMSI 1246          

HSP 3 Score: 73.1738 bits (178), Expect = 3.241e-12
Identity = 38/106 (35.85%), Postives = 53/106 (50.00%), Query Frame = 3
Query:   57 VPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKL 374
            VP R +  + FG+ SA EI++LSV       + +   +  P  + L D   GP D    C TC      CPGHFGHI L  PV++  F +K+  ++R  C  C  L
Sbjct:    7 VPWRRLSGISFGMYSAEEIRKLSVKTITNPKFLDAVGNVAP--NSLYDLALGPADLKEVCSTCCQDFNNCPGHFGHIELPLPVYNPLFFDKLYLLIRGSCLSCHML 110          

HSP 4 Score: 72.7886 bits (177), Expect = 5.066e-12
Identity = 42/145 (28.97%), Postives = 77/145 (53.10%), Query Frame = 2
Query: 3968 GKAEWILETDGTCLQKVLAERDV-DSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDI 4399
            G+ E +L T+G  + ++    ++ D     SN +  +  T+GIE A   IE+E+  V +  G  V+ RHL+L+ + M  +G    ++RH I R  +  L + +FE +   L +A      D ++  S  +++G++ K GTG F++
Sbjct: 1539 GEKETVLNTEGINMHEMFKYGEILDLNRLYSNEVHAMANTYGIEVALKVIEKEIKDVFAVYGIEVDPRHLSLVADYMCFEGVYKPLNRHAI-RSNSSPLQQMTFETSYKFLKQATMLGSHDQLESPSACLVVGKVVKGGTGLFEL 1682          
BLAST of DNA-directed RNA polymerase subunit vs. Planmine SMEST
Match: SMESG000010459.1 (SMESG000010459.1)

HSP 1 Score: 1850.1 bits (4791), Expect = 0.000e+0
Identity = 890/890 (100.00%), Postives = 890/890 (100.00%), Query Frame = 3
Query:   33 MANLDLPSVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDRDEMDLKTQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQPLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNGTMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 2702
            MANLDLPSVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDRDEMDLKTQEMSRSGCGYVQPIFRRNGLEYFVTLKDDSSDSDSKQPLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNGTMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF
Sbjct:    1 MANLDLPSVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDRDEMDLKTQEMSRSGCGYVQPIFRRNGLEYFVTLKDDSSDSDSKQPLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNGTMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEF 890          

HSP 2 Score: 1364.75 bits (3531), Expect = 0.000e+0
Identity = 675/676 (99.85%), Postives = 675/676 (99.85%), Query Frame = 2
Query: 2699 IQSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETGGRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLNLVLRIXXXXXXXXXXXXXXXXXXXXYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALPMMSGVAHNLYMVGGATPMNSASPQLTPWTTLSSPYTFSPKPNSFGASFSPIAHSEIGMSPNPALAFSPMMSPKTPMDYGFGRYSPSMNPISPAGT 4726
             QSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETGGRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLNLVLRIRMLKKEDEKDDEKLEMEDRKYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALPMMSGVAHNLYMVGGATPMNSASPQLTPWTTLSSPYTFSPKPNSFGASFSPIAHSEIGMSPNPALAFSPMMSPKTPMDYGFGRYSPSMNPISPAGT
Sbjct:  890 FQSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETGGRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLNLVLRIRMLKKEDEKDDEKLEMEDRKYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALPMMSGVAHNLYMVGGATPMNSASPQLTPWTTLSSPYTFSPKPNSFGASFSPIAHSEIGMSPNPALAFSPMMSPKTPMDYGFGRYSPSMNPISPAGT 1565          

HSP 3 Score: 188.348 bits (477), Expect = 2.755e-47
Identity = 205/205 (100.00%), Postives = 205/205 (100.00%), Query Frame = 2
Query: 5081 RLGTSIEGRSINYSPTSPAMGXXXXXXXXXXXXXXFNQRSTRXXXXXXXXXXXXXATLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRYTLXXXXXXXXXXXXXXXXYTPTSPAFSPSIGSYAPQSPSTAGAVSPVYSGNMSYSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP 5695
            RLGTSIEGRSINYSPTSPAMGYSPTSPSYSPSSPSFNQRSTRYSPSSPNYSPSSPATLHYSPSSPNSPSSPNYSPSNRNYSPTSPNYSPTSPVIPASPAYSPSSPNYSPTSPRYTLASPSYSVSRSYSASPRYTPTSPAFSPSIGSYAPQSPSTAGAVSPVYSGNMSYSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP
Sbjct: 1698 RLGTSIEGRSINYSPTSPAMGYSPTSPSYSPSSPSFNQRSTRYSPSSPNYSPSSPATLHYSPSSPNSPSSPNYSPSNRNYSPTSPNYSPTSPVIPASPAYSPSSPNYSPTSPRYTLASPSYSVSRSYSASPRYTPTSPAFSPSIGSYAPQSPSTAGAVSPVYSGNMSYSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP 1902          

HSP 4 Score: 62.003 bits (149), Expect = 6.845e-9
Identity = 37/77 (48.05%), Postives = 48/77 (62.34%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYS-GNMSYSPTSPQYSPATSGYVANSPSYGQQNTN---SNSGYSPQSP 5695
            Y+PTSP +SP+  SY+P SP  +   SP YS  + +YSPTSP YSP + GY   SPSY   + N   ++  YSP SP
Sbjct: 1594 YSPTSPGYSPTSPSYSPTSPGYS-PTSPSYSPTSPNYSPTSPSYSPTSPGYSPTSPSYSPTSPNYSPTSPSYSPTSP 1669          

HSP 5 Score: 60.8474 bits (146), Expect = 1.364e-8
Identity = 37/74 (50.00%), Postives = 46/74 (62.16%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYS-GNMSYSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP 5695
            Y+PTSP +SP+  SY+P SP  +   SP YS  + +YSPTSP YSP + GY   SPSY   + N    YSP SP
Sbjct: 1622 YSPTSPNYSPTSPSYSPTSPGYS-PTSPSYSPTSPNYSPTSPSYSPTSPGYSPTSPSYSPTSPN----YSPTSP 1690          

HSP 6 Score: 59.6918 bits (143), Expect = 3.245e-8
Identity = 35/74 (47.30%), Postives = 45/74 (60.81%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYS-GNMSYSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP 5695
            Y+PTSP++SP+  +Y+P SPS +   SP YS  + SYSPTSP YSP +  Y   SP  G      +  YSP SP
Sbjct: 1643 YSPTSPSYSPTSPNYSPTSPSYS-PTSPGYSPTSPSYSPTSPNYSPTSPSYCPTSPRLGTSIEGRSINYSPTSP 1715          

HSP 7 Score: 55.4546 bits (132), Expect = 5.524e-7
Identity = 34/74 (45.95%), Postives = 45/74 (60.81%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYS-GNMSYSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP 5695
            Y+PTSP +S +  +Y+P SP  +   SP YS  +  YSPTSP YSP +  Y   SPSY    + ++ GYSP SP
Sbjct: 1580 YSPTSPGYSQTSPTYSPTSPGYS-PTSPSYSPTSPGYSPTSPSYSPTSPNYSPTSPSY----SPTSPGYSPTSP 1648          
BLAST of DNA-directed RNA polymerase subunit vs. Planmine SMEST
Match: SMESG000078620.1 (SMESG000078620.1)

HSP 1 Score: 1410.59 bits (3650), Expect = 0.000e+0
Identity = 661/838 (78.88%), Postives = 747/838 (89.14%), Query Frame = 3
Query:  195 MDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDRDEMDLKTQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQPLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNGTMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEFNL 2708
            MDPRQGP DKYS CQTC G+V+ECPGHFGHINLARPV++IG+KEKIIKILRSVCFKCSKLL +++   ++EI+KKTE + RKRFD +++EC++ K C+V   + +E +     + R GC +VQP FRRNGL+Y +  KD       KQPL A+QV+E+F+RI+ EDC++MGFN KYSRPE MI+TVL+VPP+AVRPA+VMNH+GK+HDDLTHKLTE+VKVNNEIR AEENGVASTI+LEKENSLQYHVAT +DNES FLP AIQKSGRPLK+LKQRLKGKHGR+RSNLMGKRTDY+ARTVITADPNLNLDQVGVPR IAQNLTFPE+VTPFNK +LQQLV+NGTMYPGA FVIRENGDRIDLKRRPDSSDIQL YGE VERHMLNDDFVVFNRQPTLHKMSMM HRVKVLPFSTFRLNLSVT PYNADFDGDEMNLH+PQS E  AE+++LARV KL+ITPQSN+PVMSIVQD+LTACNKMT RD FLN AE+MHLLM+LP+WNG +PKP I KP RLWTGKQ+FSLIIPG+VNC RTHSTHPE E++GPYKWIS  DT+VLIE+G+LI GILCKKTLGSS+GSL+HIIALEQ  D+ G FFNN+QTVVNNWLL EGHTIGIVD LY+A TREEIK  I++AK+ VF+TI K H+ EL STPG +L QTFE  VN ILN+ARDKTGS AQKSLSKYN+FNLMV+SGAKGSKINISQVIACVGQQNVEGKRIPFGF+QRTLPHFIK D+GPESRGFVENSYLAGLTPTEFFFHAMGGREG+IDTAVKTAETGYIQRRL+KAMESVM+KYD+TVRNQIDQLIQ RYGEDGLDG FVEF +
Sbjct:    1 MDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTCNVICDESEECEKGLNTIIRQGCNFVQPKFRRNGLDYSMETKDSDDGKG-KQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNGTMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQV 837          

HSP 2 Score: 1018.45 bits (2632), Expect = 0.000e+0
Identity = 507/678 (74.78%), Postives = 576/678 (84.96%), Query Frame = 2
Query: 2687 GICGIQSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETGGRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLNLVLRIXXXXXXXXXXXXXXXXXXXXYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALPMMSGVAHNLYMVGGATPMNSASPQLTPWTTLSSPYTFSPKPNS-FGASFSPIAHSEIGMSPNPALAFSPMMSPKTPMDYGFGRYSPSMNPISP 4717
            G    Q LPT+K     FE+ FRFDI + D+LSR+LTEKRV+EI  EAD +  +D EW+QL  DRE +R+ +K  TGGR+ LPCN+ RL+ N +  FKID+LKKTDIKP DI+ KV NLC +LIVV G+D IS TAN N+TLL CCLIRS LCCKKVI + RLS EA +W++GEI+  F +S V PGEMVG+LAAESLGEPATQMTLNTFH+AGVSAKNVTLGVPRLKEIINVSRNPKTPSLT+ L G AAKD E+AK IAA LEHTTLRKLAV SEIYYDP+PE+SV+E DR+WVRTYYE PDFD+DKKS Y+LRIVL RKK+TDKKL+LQ+IAEKITEYF+NDIICH+PD+NL+LVLRIRMLKK+DEK++E  EMEDRKYLEL++NLILDEICLQGIPQISKVY+  P TDDKK+++INS G FE   EWILETDGTCL KVLAER VDSETT SNHITEIFETFGIEAARNAIE EM +VISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLA++GTGCFDILMN+ + +EAQ LPMMSGVA NL+MVGGATPMNSASPQL+ +   S  Y +SP  ++ FG +FSP   SE GMSP+P L FSPMMSPKTP DY +G  SP MNP+SP
Sbjct:  831 GFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLDLVLRIRMLKKDDEKEEEPDEMEDRKYLELIDNLILDEICLQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPMMSGVAQNLFMVGGATPMNSASPQLSQY---SPSYNYSPNSSTGFGLAFSPSGFSEAGMSPSPGLGFSPMMSPKTPHDYFYGLNSPGMNPLSP 1505          

HSP 3 Score: 63.1586 bits (152), Expect = 2.525e-9
Identity = 37/74 (50.00%), Postives = 49/74 (66.22%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYS-GNMSYSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP 5695
            Y+PTSP++SP+   Y+ +SPS +G  SP YS  +  YSPTSP YSP + GY   SPSY    + ++ GYSP SP
Sbjct: 1539 YSPTSPSYSPTSPGYSGKSPSYSG-TSPSYSPTSPGYSPTSPGYSPTSPGYSPTSPSY----SPTSPGYSPTSP 1607          

HSP 4 Score: 51.9878 bits (123), Expect = 7.592e-6
Identity = 32/72 (44.44%), Postives = 41/72 (56.94%), Query Frame = 2
Query: 5480 TPTSPAFSPSIGSYAPQSPSTAGAVSPVYSGNMSYSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP 5695
            +P S  +SP+  SY+P SP  +G  SP YSG      TSP YSP + GY   SP Y    + ++ GYSP SP
Sbjct: 1533 SPHSQGYSPTSPSYSPTSPGYSGK-SPSYSG------TSPSYSPTSPGYSPTSPGY----SPTSPGYSPTSP 1593          

HSP 5 Score: 51.6026 bits (122), Expect = 8.541e-6
Identity = 28/57 (49.12%), Postives = 34/57 (59.65%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYSGNMSYSPTSPQYSPATSGYVANSPSY 5647
            Y+PTSP +SP+   Y+P SP  +   SP      SYSPTSP YSP + GY   SP Y
Sbjct: 1567 YSPTSPGYSPTSPGYSPTSPGYS-PTSP------SYSPTSPGYSPTSPGYSPTSPGY 1616          
BLAST of DNA-directed RNA polymerase subunit vs. Planmine SMEST
Match: SMESG000003379.1 (SMESG000003379.1)

HSP 1 Score: 1293.87 bits (3347), Expect = 0.000e+0
Identity = 615/893 (68.87%), Postives = 753/893 (84.32%), Query Frame = 3
Query:   33 MANLDLPSVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVC-SVPNSDRDEMDLKTQEMSRSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQPLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNGTMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEFNL 2708
            M+N++   VPL+ VK VQFG+LSA+EI + SV+   GIIY EK ++G  K++GLMD RQGP D+YSYC+TC  SV+ECPGHFGHINL++PV+HIGFKEKIIK+LRSVCFKCS++L D N   +K +LKKTE N + RFD + ++ ++ K C S    + D+    + E  R GC ++QP ++R GL+Y VT++ + +D  +K  L+AYQV +IF+RI+ EDCLLMGF+ ++SRPE MI+TVL+VPP+AVRPA++MNH+GK+HDDLTHKLTE+VKVN +I+ +E+NG AS I+LEK N LQYHVAT  DNES FLPTAIQKSGRPLK+LKQRLKGK GR+R+NLMGKRTD++ARTVITADPNLNLDQVGVP +IA+NLTFPE VTP N+++LQ LV NG  YPGA +VI+ENGDRIDLKR P++ DI L  GETVERHM+NDDFV+FNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVT+PYNADFDGDEMNLH+PQ+ E++AEV+ LARV +L+ITPQSNKPVMS+VQD+LTAC+KMT RDV LN+AE+M+LLM+LP WN  +P+PAI KP RLWTGKQ+FSLIIP  +N  RTHSTH + EENGPYKWI+  DTKV +EDG+L+SGILCKK+LGSS+GSLIH+IA+E + +  G FFN+VQ V NNWLLI+GH+IGI D LY+ +TR+ I+ +I  AK+ VF  ID    ++L+  PG +L +TFE +VNKILN+ RDKTG+ AQKSLSKYN+FN MVMSGAKGSKINISQVIACVGQQNVEGKRIPF F+ RTLPHF+K DYG ES+GFVENSYLAGLTP+EFFFHAMGGREG+IDTAVKTAETGYIQRRL+KAMES+ ++YD TVRNQI+ + QFRYGEDGLDGAFVEF +
Sbjct:    1 MSNINSACVPLKSVKSVQFGLLSATEILKASVLDPEGIIYPEKAENGIAKRNGLMDARQGPVDRYSYCETCSSSVSECPGHFGHINLSKPVYHIGFKEKIIKVLRSVCFKCSRILIDKNRPEIKILLKKTEFNLKARFDMIVEQSKKIKSCVSAEMMETDKEQSLSDENRREGCNFLQPKYKRKGLDYSVTIQGEHNDVTTKV-LQAYQVFDIFQRISNEDCLLMGFDYRFSRPESMILTVLAVPPMAVRPAIIMNHSGKAHDDLTHKLTEIVKVNEDIKRSEQNGAASVIILEKINQLQYHVATLFDNESTFLPTAIQKSGRPLKSLKQRLKGKGGRVRANLMGKRTDFTARTVITADPNLNLDQVGVPILIAKNLTFPEIVTPINRNFLQTLVGNGCEYPGAKYVIKENGDRIDLKRHPNTKDICLSIGETVERHMINDDFVIFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTAPYNADFDGDEMNLHMPQTQESRAEVAYLARVNRLVITPQSNKPVMSVVQDSLTACDKMTRRDVLLNKAEMMNLLMFLPCWNNVMPRPAILKPQRLWTGKQLFSLIIPKGINYTRTHSTHNDDEENGPYKWITYCDTKVYVEDGQLLSGILCKKSLGSSSGSLIHVIAVEHNYEVIGNFFNDVQRVTNNWLLIQGHSIGINDCLYNPETRDLIRSSIFVAKDNVFSKIDDCQRFKLKCLPGRSLAETFEDSVNKILNEVRDKTGTIAQKSLSKYNSFNSMVMSGAKGSKINISQVIACVGQQNVEGKRIPFNFKWRTLPHFVKSDYGSESKGFVENSYLAGLTPSEFFFHAMGGREGIIDTAVKTAETGYIQRRLVKAMESIKVEYDGTVRNQIEHVYQFRYGEDGLDGAFVEFQM 892          

HSP 2 Score: 810.831 bits (2093), Expect = 0.000e+0
Identity = 416/663 (62.75%), Postives = 509/663 (76.77%), Query Frame = 2
Query: 2699 IQSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITT-EADTICKLDTEWDQLCKDRELIRDIVKHETGGRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLNLVLRIXXXXXXXXXXXXXXXXX--XXXYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALPMMSGVAHNLYMVGGATPMNSASPQLTPWTTLSSPYTFSPKPNSFGAS-FSPIAHSEIGMSPNPALAFSPMMSPKTPMDY 4675
             Q  PT+K   ++FEK+FRF   +   L ++L EKRV+EI + ++D +   D EW+QLC DR+ IRD +K E+GGR+ LPCNI RL+ N +  FKID  K TDIKP+DI++ ++ LC  LIVVKG+D ISK  NEN+ L FC L+RS L CK VID++RLS  AF+W++GEI+  F+++LV PGEMVGALAAESLGEPATQMTLNTFH+AGVSAKNVTLGVPRL+EIINVSRNPKTPSL + L G AAKDAE+AK +AARLEHTTLRKL + S+IYYDP+P  SVI  DR+WVRTYYEL D DI    PY+LRI   RKK+ DKK++L+ IAEKI+E+F+NDI CH+ DDNL LVLRIRMLKK+D + DE       D+ +L  +ENLILDE+ LQGIPQI+KVY+  P T DK K V+N +G+FE + EWILETDG+CLQKVLAERDVD   T SNHITEIF T GIEAARNAIE EM++V+SFDGSYVNYRHL LLC++MT KG+LMS+DRHGINRQETG LARS+FEETVDIL+EAGAHA+ DPMKGVSES++ GQLAK+GTGCFDIL+N +  NEAQ+LP+M G+ ++    G  +P   +SPQ   +  +S+P  FSP    +G S FSP    E  MSP      SP  SPKTP  Y
Sbjct:  890 FQMFPTYKINNSKFEKKFRFRYDDVTYLRKHLIEKRVKEILSYKSDALILFDKEWEQLCLDRKYIRDTIKQESGGRLPLPCNIERLIWNAKTNFKIDQTKLTDIKPLDIVDGIKKLCDSLIVVKGEDKISKETNENSKLYFCILLRSTLSCKVVIDDHRLSSAAFEWIVGEIQNNFSKALVPPGEMVGALAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLREIINVSRNPKTPSLNIRLLGKAAKDAELAKKVAARLEHTTLRKLTLSSKIYYDPDPMESVIPEDRDWVRTYYELADEDISNICPYVLRIDFNRKKVIDKKMSLETIAEKISEHFKNDITCHVSDDNLELVLRIRMLKKQDNEKDESEVETIDDKSFLMKLENLILDEVTLQGIPQITKVYLSEPTTGDKLKRVVNKEGSFEIEKEWILETDGSCLQKVLAERDVDPVNTTSNHITEIFTTLGIEAARNAIEYEMNNVLSFDGSYVNYRHLGLLCDVMTQKGYLMSMDRHGINRQETGVLARSTFEETVDILLEAGAHADIDPMKGVSESVLFGQLAKMGTGCFDILINSDLLNEAQSLPVMQGIGNSFMPSGCFSP---SSPQYQ-YNPMSAP--FSP----YGCSAFSPTNSCE--MSP----GRSPYSSPKTPNFY 1536          

HSP 3 Score: 59.6918 bits (143), Expect = 3.583e-8
Identity = 35/79 (44.30%), Postives = 45/79 (56.96%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAG------AVSPVYSGNMSYSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP 5695
            Y+PTSP +SP+   Y+  SP  +       A SP YS +  YSPTSP YSP + GY   SP Y    + ++ GYSP SP
Sbjct: 1672 YSPTSPGYSPTSPGYSATSPVYSATSPGYSAKSPGYSPSPGYSPTSPGYSPTSPGYSPTSPGY----SPTSPGYSPTSP 1746          

HSP 4 Score: 58.9214 bits (141), Expect = 5.935e-8
Identity = 35/77 (45.45%), Postives = 46/77 (59.74%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYS-GNMSYSPTSPQYSPATSGYVANSPSYGQQN---TNSNSGYSPQSP 5695
            Y+PTSP +SP+   Y+P SP  +   SP YS  +  YSPTSP YSP + GY   SP Y   +   + ++ GYSP SP
Sbjct: 1609 YSPTSPGYSPTSPGYSPTSPGYS-PTSPGYSPTSPGYSPTSPGYSPISPGYSPTSPGYSATSPVYSPTSPGYSPTSP 1684          

HSP 5 Score: 58.5362 bits (140), Expect = 6.848e-8
Identity = 35/74 (47.30%), Postives = 45/74 (60.81%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYSGNMS-YSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP 5695
            Y+PTSP +SP+   Y+P SP  +   SP YS     YSPTSP YSP + GY A SP Y    + ++ GYS +SP
Sbjct: 1637 YSPTSPGYSPTSPGYSPISPGYS-PTSPGYSATSPVYSPTSPGYSPTSPGYSATSPVY----SATSPGYSAKSP 1705          

HSP 6 Score: 55.0694 bits (131), Expect = 9.058e-7
Identity = 35/76 (46.05%), Postives = 42/76 (55.26%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSP---STAGAVSPVYSGNMSYSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP 5695
            Y PTS   SP+   Y+P SP   ST+   SP   G   YSPTSP YSP + GY   SP Y    + ++ GYSP SP
Sbjct: 1581 YFPTSSGHSPTSPGYSPTSPGHLSTSPGYSPTSPG---YSPTSPGYSPTSPGYSPTSPGY----SPTSPGYSPTSP 1649          

HSP 7 Score: 51.6026 bits (122), Expect = 9.308e-6
Identity = 31/77 (40.26%), Postives = 42/77 (54.55%), Query Frame = 2
Query: 5477 YTPTSPAFSPSIGSYAPQSPSTAGAVSPVYSGNMS----YSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP 5695
            Y+  SP + P+   ++P SP      SP   G++S    YSPTSP YSP + GY   SP Y    + ++ GYSP SP
Sbjct: 1574 YSSNSPGYFPTSSGHSPTSP----GYSPTSPGHLSTSPGYSPTSPGYSPTSPGYSPTSPGY----SPTSPGYSPTSP 1642          
BLAST of DNA-directed RNA polymerase subunit vs. Planmine SMEST
Match: SMESG000069361.1 (SMESG000069361.1)

HSP 1 Score: 449.514 bits (1155), Expect = 1.337e-131
Identity = 318/960 (33.12%), Postives = 489/960 (50.94%), Query Frame = 3
Query:   33 MANLDLPSVPLREVKRVQFGILSASEIKRLSVVG-ENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNS--SNVKEILKK--TEINPRKRFDFMY---DECRRNKVCSVPNSDRDEMD-----------LKTQEMS--RSGCGYVQPIFRRNGLEYFVTLKXXXXXXXXKQPLRAYQVLEIFRRITEEDCLLMGF-NPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKS-HDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNGT-MYPGA-----AFVIRE------------NGD----RIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYL-----PTWNGRLPKPAIYKPLRLWTGKQIFSLIIP---------------GRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGG-FFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIP-FGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEFNLC 2711
            M +L  P    + V  ++FGI S  +I + S V   N  IY       KP ++GLMD R G     + C TC      C GHFG+I+L+  +F  GF + I+KIL+ +C  C  +L + +   S+ KE+ K   T I  +     +     + RR + C+  N    ++            LK Q+         Y Q I  +N L   VTL            LR Y V ++F+ I  +    +G  N K  +   +I   + VPP+ +RP+   +    S  DD+T  L   +  N                  K + +    A  I  ++  + +   K  + ++ + QRL GK GR R N+MGKRT++++RTVI+ DP+L ++++ +P   A  LTF E  T +N  +L++L+ NG   YPGA       + +E            N +    ++D ++    +  +L+ G+ V+RH+ + D V+FNRQP+LH++S     + V    TF  N    +P+NADFDGDEMN+H PQ+ E KAE  +L    K   +P S +P+ + +QD LTA   +T++D F N  E  +L++ +     P     +P+P I KP++L++GKQ+ SL+I                 R+N I   S++P         +++P DT V+I + +LI G L KK LG  +   I    L+   D A       +  +    L   G ++GI D    AK R   K+ +++      E I    N  L S PG ++ +T E+ ++  L+  RD+ G   + +L K N+  +M + G+KGS INISQ++ CVGQQ +EGKR+       RTL ++ ++   P S+GFV NS+ +GL P EF FHAM GREGLIDTAVKTAETGY+QRRLIK +E + I++D+TVR+    L+QF+YG DG D + +E   C
Sbjct:    1 MKSLVRPGTEDKAVCAIEFGINSIEDIVQQSHVKVTNHDIYDNL---AKPAENGLMDQRMGTCSS-TKCVTCDREQKYCMGHFGYIDLSNYLFPFGFLKDIVKILKCICKTCGHILLNEHDVMSHEKELRKPNLTYIQKKSIRTIIIKKSSKIRRCRFCNDSNGSVKKLKSLSMICHKKYALKEQQKKFFEQFENYSQEI--KNLLNSGVTL------------LRPYDVFKLFQAIPVKHYKFLGMSNKKNIKVSNLIFKHIPVPPICIRPSAQTSSENTSREDDITILLRMQIGDN------------------KLHDMHSEYARMIKPDATCIRSV--KDKKVIRGMIQRLAGKKGRFRGNIMGKRTNFTSRTVISPDPSLKINEISIPEYCAMKLTFTETATAYNIAHLKKLILNGARKYPGAVAYASGIISKEPQQPMSQLKLMMNSEVMWTKLDNEKWRIEAARKLKVGDFVQRHIDSTDIVLFNRQPSLHRLSFQAFNIVVKKEKTFSFNPCCCNPFNADFDGDEMNVHFPQTFEAKAEAIELISSIKNTTSPNSGEPLTAPLQDILTAAYLLTSKDTFYNEQEFRNLILPIVKCCPPNKIVMIPRPMIMKPVKLYSGKQLMSLVISPYGTLSPDSKRVIPDSRINQIVETSSNP-------VDYLNPNDTLVVIHNSKLIMGQLPKKLLGGGSKLSIFFRILKDVGDLASCQSMERLCQIALADLKSRGFSLGITDVSPSAKLRTIQKELVEQNFAICEEFIKYYENGSLISDPGCSIEETLESKISSQLSKIRDEGGKECKTTLHKRNSPLIMAICGSKGSYINISQMVFCVGQQIIEGKRVSNISGTNRTLMYYPENCRSPMSKGFVSNSFYSGLNPIEFLFHAMSGREGLIDTAVKTAETGYMQRRLIKFLEDLAIRFDNTVRDFTGNLVQFKYGTDGFDPSKLESTYC 915          

HSP 2 Score: 95.1301 bits (235), Expect = 4.370e-19
Identity = 52/153 (33.99%), Postives = 83/153 (54.25%), Query Frame = 2
Query: 3992 TDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALPMMS 4450
             +G  L  +     VD   T SNHI EI+E  GI+AA++ I  E++ V+       + RH+ LL +IM + G +    R GI++ +   L  +SFE+T+D L+EA  H + D + G+S+S+  G+   IGTG   I+ N     + +  P +S
Sbjct: 1193 VEGGKLLDLFQIEGVDGINTHSNHILEIYEVLGIDAAKDMIINELNAVMGAHNLTPDIRHVMLLADIMCYTGQICGFQRSGISKSKNSVLCLASFEKTLDHLLEAAYHNQKDKLHGISDSLTFGKTTPIGTGMSTIIFNDSSEKDLRRRPTLS 1345          

HSP 3 Score: 94.7449 bits (234), Expect = 6.444e-19
Identity = 40/101 (39.60%), Postives = 73/101 (72.28%), Query Frame = 2
Query: 3218 RFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEI 3520
            ++ +++++PG  +G +  +S+GEPATQMTL TFH+AGV++ N+T GVPR++EI+N   N KTP +TV+LT +  +    AK++  +++   L+ + ++S++
Sbjct:  996 KYFKAIIEPGTAIGVICGQSVGEPATQMTLKTFHFAGVASMNITRGVPRMQEIMNAVANIKTPIITVYLTDDVRE--SFAKTMQLKIQPVFLKNVIIQSQL 1094          
BLAST of DNA-directed RNA polymerase subunit vs. Planmine SMEST
Match: SMESG000021710.1 (SMESG000021710.1)

HSP 1 Score: 339.347 bits (869), Expect = 1.783e-94
Identity = 216/603 (35.82%), Postives = 314/603 (52.07%), Query Frame = 3
Query: 1011 LKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNG-TMYPGAAFVIRENGDRIDL--KRRP----DSSDIQLQYGETV--ERHMLNDDFVVFNRQPTLHKMSMMCHRVKVL---PFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMY-LPTWNGR---LPKPAIYKPLRLWTGKQIFSLI----IPGRVNCIRTHSTHPEPEE----NGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETT----VNKILN-----DARDKTGS----------CAQKSLSKY--NNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLD 2684
            L+Q++  K G  RSN+MGKR +++ R+VI+ DP + LD++GVP +    LT+PE + P NK +L Q V NG  +YPGA  V  + G+R  +     P    ++   QLQ  +TV   RH L+ D ++ NRQPTLH+ SM  H +K +      T R++ S    YNADFDGDEMN H PQSL  +AE   L  V     TP+   P+  ++QD + A  KM  RD    R E + L+ + L   N R   LPKPAI  P +LWTGKQI S++    IP  +       + P+       +G  + +   D +++I DG + +GI  K  LG S   L   +     P+ A     N+  ++  +L+  G +  I D   +       K  +++ +     ++ K+ N  L    G       E       +K  N     D   KT S          C      K+  NN  LM  +GAKG + N++++   +G   +EGKR P     RTLP F + D  P SRGF  + +++GL P E FF +M GR+GL+DTAVKT+ +GY+QR LIK +E + + +D TVR+ +  +IQFRYG DGLD
Sbjct:  360 LRQKIDKKDGLFRSNIMGKRVNFACRSVISPDPTIGLDEIGVPIVFLSKLTYPEPLNPMNKDFLLQCVLNGPDVYPGA--VSYQIGNRFPMVIGHNPLEVVENLKFQLQNNQTVIINRHALSGDALIMNRQPTLHRPSMQAHIIKAIHDPKAKTLRMHYSNCKAYNADFDGDEMNGHYPQSLLAQAEAKLLVNVCYQHSTPKDGSPLAGLIQDHIIAGTKMCLRDSTFTRNECLDLVYHGLHNSNQREFKLPKPAIIFPNQLWTGKQILSIVLKNSIPAGLELPNISCSEPKKNTMWRISGDEQKLKLSDVELIIIDGYICTGIFDKVHLGPSQKGLCSDLRELYGPEVALKILTNLSRLLTRYLVYTGFSTSIKDGFLNESGECARKNILNKIRSIGSTSVGKSFNVPLMEFRGEKATSLMEFAQFDKSDKFRNKMTEIDTNFKTLSSNYIHQLVETCKNNLREKFPDNNLLLMCQTGAKGGESNVTKIAIALGAIEIEGKRCPLTVGGRTLPSFKRYDLDPVSRGFCVSRFMSGLKPQELFFESMAGRDGLVDTAVKTSTSGYLQRCLIKHLEDITVCHDGTVRDNMHNIIQFRYGYDGLD 960          

HSP 2 Score: 79.337 bits (194), Expect = 3.584e-14
Identity = 43/87 (49.43%), Postives = 58/87 (66.67%), Query Frame = 2
Query: 3161 DEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNP-KTPSLTV 3418
            D   +SP+  + +   I  +   S+   GE VG LAA+S+GEP+TQMTLNTFH AG S  NVTLG+PRL+EI+ +  +  KTPS+ V
Sbjct: 1016 DFVEISPKDENLLREIIAVKSEYSICPNGEAVGLLAAQSVGEPSTQMTLNTFHNAGQSEMNVTLGIPRLREILMLGSDKIKTPSMDV 1102          

HSP 3 Score: 75.485 bits (184), Expect = 4.846e-13
Identity = 42/118 (35.59%), Postives = 68/118 (57.63%), Query Frame = 2
Query: 4055 SNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQL-AKIGTGCFDILM 4405
            SN+I ++ + +GIEAA + IE E+  V       VN RHL L+ + +TH G + + +RH +    +  L R+SFE  + +++E   +   D +K  + +IM GQL + IGT   D+LM
Sbjct: 1375 SNNIIKMSKLYGIEAAMSCIENEIKTVFKSYNIDVNSRHLRLIADFLTHSGKVGAFNRHMMTNH-SSPLQRASFETALTVIIEMLTYGTVDYIKSPTSNIMFGQLVSNIGTNAMDLLM 1491          

HSP 4 Score: 54.6842 bits (130), Expect = 1.026e-6
Identity = 28/98 (28.57%), Postives = 47/98 (47.96%), Query Frame = 3
Query:   81 VQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKL 374
            + F   +  E++ LS      +I  E    GK   +GL D   G  +    C+ C  S  +C GHFG I  ++ V++    + + K +++VCF C +L
Sbjct:   11 ICFSFYTPEEVRNLSTKEITSLISIEPVL-GKGAVNGLYDSSLGSLNDREPCRNCNLSFYDCNGHFGRIEFSKLVYNPLLFDTLAKFIKAVCFYCHRL 107          
The following BLAST results are available for this feature:
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
POLR2A2.006e-866.00RNA polymerase II subunit A [Source:HGNC Symbol;Ac... [more]
POLR2A2.006e-866.00RNA polymerase II subunit A [Source:HGNC Symbol;Ac... [more]
POLR2A0.000e+059.06RNA polymerase II subunit A [Source:HGNC Symbol;Ac... [more]
POLR3A1.022e-4538.30RNA polymerase III subunit A [Source:HGNC Symbol;A... [more]
POLR1A2.046e-9534.50RNA polymerase I subunit A [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ama-14.708e-763.03DNA-directed RNA polymerase II subunit RPB1 [Sour... [more]
ama-14.708e-763.03DNA-directed RNA polymerase II subunit RPB1 [Sour... [more]
rpc-14.060e-17838.15DNA-directed RNA polymerase subunit [Source:UniPr... [more]
rpoa-16.922e-10035.73DNA-directed RNA polymerase subunit [Source:UniPr... [more]
rpoa-13.586e-932.69DNA-directed RNA polymerase subunit [Source:UniPr... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
RpII2151.424e-664.69gene:FBgn0003277 transcript:FBtr0073542[more]
RpIIIC1601.712e-16836.29gene:FBgn0030687 transcript:FBtr0300811[more]
RpI13.879e-9534.98gene:FBgn0019938 transcript:FBtr0087511[more]
back to top
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
polr2a4.466e-865.74polymerase (RNA) II (DNA directed) polypeptide A [... [more]
polr3a5.300e-4738.33polymerase (RNA) III (DNA directed) polypeptide A ... [more]
polr1a1.255e-9034.20RNA polymerase I subunit A [Source:ZFIN;Acc:ZDB-GE... [more]
polr1a1.287e-9034.20RNA polymerase I subunit A [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctdnep18.351e-12465.70CTD nuclear envelope phosphatase 1 [Source:Xenbase... [more]
ctdnep17.129e-12465.70CTD nuclear envelope phosphatase 1 [Source:Xenbase... [more]
polr3a4.200e-4738.01polymerase (RNA) III (DNA directed) polypeptide A,... [more]
polr3a3.417e-4738.06polymerase (RNA) III (DNA directed) polypeptide A,... [more]
polr3a3.743e-4739.17polymerase (RNA) III (DNA directed) polypeptide A,... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Polr2a1.094e-866.00polymerase (RNA) II (DNA directed) polypeptide A [... [more]
Polr2a1.400e-866.00polymerase (RNA) II (DNA directed) polypeptide A [... [more]
Polr3a8.390e-4638.06polymerase (RNA) III (DNA directed) polypeptide A ... [more]
Polr3a7.287e-11236.44polymerase (RNA) III (DNA directed) polypeptide A ... [more]
Polr1a1.124e-9535.09polymerase (RNA) I polypeptide A [Source:MGI Symbo... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P08775|RPB1_MOUSE9.796e-866.00DNA-directed RNA polymerase II subunit RPB1 OS=Mus... [more]
sp|P24928|RPB1_HUMAN9.632e-866.00DNA-directed RNA polymerase II subunit RPB1 OS=Hom... [more]
sp|P11414|RPB1_CRIGR9.632e-866.00DNA-directed RNA polymerase II subunit RPB1 OS=Cri... [more]
sp|P04052|RPB1_DROME0.000e+064.69DNA-directed RNA polymerase II subunit RPB1 OS=Dro... [more]
sp|P35074|RPB1_CAEBR1.695e-663.71DNA-directed RNA polymerase II subunit RPB1 OS=Cae... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S6KMI61.027e-43100.00DNA-directed RNA polymerase subunit OS=Schmidtea m... [more]
A0A095APJ20.000e+073.11DNA-directed RNA polymerase subunit OS=Schistosoma... [more]
A0A183P3V90.000e+073.11DNA-directed RNA polymerase subunit OS=Schistosoma... [more]
A0A3Q0KQP20.000e+073.11DNA-directed RNA polymerase subunit OS=Schistosoma... [more]
A0A4E0RZ980.000e+071.75DNA-directed RNA polymerase subunit OS=Fasciola he... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
polr2a3.059e-866.26RNA polymerase II subunit A [Source:NCBI gene;Acc:... [more]
polr2a3.393e-866.26RNA polymerase II subunit A [Source:NCBI gene;Acc:... [more]
polr3a5.481e-15635.35polymerase (RNA) III (DNA directed) polypeptide A ... [more]
ENSAMXT00000011874.21.137e-3249.65pep primary_assembly:Astyanax_mexicanus-2.0:24:124... [more]
ENSAMXT00000040759.18.454e-1451.69pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
RPO210.000e+052.24RNA polymerase II largest subunit B220; part of ce... [more]
RPO313.949e-4736.11RNA polymerase III largest subunit C160; part of c... [more]
RPA1901.001e-9932.72RNA polymerase I largest subunit A190 [Source:SGD;... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO399760.000e+062.06DNA-directed RNA polymerase [Source:UniProtKB/TrE... [more]
EDO362912.587e-17537.25DNA-directed RNA polymerase [Source:UniProtKB/TrE... [more]
EDO394962.869e-7832.81DNA-directed RNA polymerase [Source:UniProtKB/TrE... [more]
EDO274351.055e-2426.80DNA-directed RNA polymerase [Source:UniProtKB/TrE... [more]
EDO394975.225e-1042.67DNA-directed RNA polymerase [Source:UniProtKB/TrE... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
polr2a2.850e-866.00RNA polymerase II subunit A [Source:NCBI gene;Acc:... [more]
polr2a2.548e-866.00RNA polymerase II subunit A [Source:NCBI gene;Acc:... [more]
polr3a9.988e-17937.62RNA polymerase III subunit A [Source:NCBI gene;Acc... [more]
polr3a1.464e-17837.62RNA polymerase III subunit A [Source:NCBI gene;Acc... [more]
polr1a2.158e-9334.07RNA polymerase I subunit A [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010459.12.755e-47100.00SMESG000010459.1[more]
SMESG000078620.12.525e-978.88SMESG000078620.1[more]
SMESG000003379.13.583e-868.87SMESG000003379.1[more]
SMESG000069361.11.337e-13133.13SMESG000069361.1[more]
SMESG000021710.11.783e-9435.82SMESG000021710.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020370 ID=SMED30020370|Name=DNA-directed RNA polymerase subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=6202bp
ATGTAATGCAATTTTTAAATTATATTTAAAATATGGCTAACTTGGATTTA
CCGAGTGTTCCACTAAGAGAAGTTAAACGAGTACAGTTTGGAATTTTAAG
TGCATCAGAAATTAAAAGATTGTCGGTAGTAGGCGAAAATGGAATTATTT
ATGCTGAAAAAACGCAGGATGGCAAACCTAAGAAAGACGGGCTAATGGAT
CCTAGGCAAGGTCCTTTTGATAAATATTCTTACTGCCAAACATGCGGAGG
TAGTGTTGCTGAATGTCCTGGTCATTTTGGACACATTAATTTGGCAAGGC
CAGTTTTTCATATTGGATTTAAGGAAAAAATTATAAAAATTTTAAGAAGT
GTATGTTTTAAATGTTCTAAATTGCTTGCAGATGTTAATTCATCGAATGT
TAAAGAAATTCTTAAGAAAACTGAAATAAATCCAAGGAAAAGATTTGATT
TTATGTATGATGAATGCAGAAGAAATAAAGTCTGTTCAGTTCCAAATAGC
GATAGAGATGAAATGGATTTGAAAACACAGGAAATGTCTCGTTCAGGTTG
TGGATATGTGCAACCTATTTTTCGTAGAAATGGATTAGAGTATTTTGTTA
CATTAAAAGATGATTCCTCGGATTCTGATAGTAAGCAACCTTTACGAGCT
TATCAAGTTTTGGAAATTTTCAGGCGTATTACTGAAGAGGATTGCTTGCT
TATGGGGTTTAATCCTAAATATTCAAGACCTGAAGGAATGATTATGACAG
TACTATCGGTACCTCCTCTAGCAGTTCGACCCGCTGTTGTAATGAATCAC
ACGGGAAAATCACACGATGACCTAACTCACAAGCTTACAGAAGTAGTCAA
AGTCAATAATGAAATAAGAACTGCTGAGGAAAATGGAGTTGCTTCTACCA
TTCTGTTAGAGAAAGAAAATTCTTTGCAGTATCACGTCGCTACATTTATT
GACAATGAAAGTCCATTTTTGCCTACTGCTATTCAAAAATCAGGACGACC
TTTGAAAACTTTAAAACAAAGATTAAAAGGCAAACACGGAAGAATTCGTT
CAAATTTGATGGGAAAACGAACTGATTATTCAGCAAGAACCGTAATTACA
GCCGATCCAAATTTAAATCTAGATCAAGTTGGTGTTCCTCGAATGATTGC
TCAAAATCTCACATTTCCAGAAAAAGTCACCCCGTTCAATAAGCATTATC
TACAGCAGCTCGTTAAAAATGGAACAATGTATCCCGGAGCAGCGTTTGTT
ATTCGCGAAAACGGTGACCGAATTGATTTGAAACGGCGCCCAGATAGTTC
AGATATCCAACTGCAATATGGAGAAACCGTTGAAAGACACATGCTTAATG
ATGATTTCGTCGTTTTCAACCGACAGCCAACTCTTCACAAAATGTCTATG
ATGTGCCATCGTGTCAAAGTTTTACCATTCTCTACATTTCGGCTGAATCT
TTCTGTCACCAGTCCGTACAATGCTGACTTTGACGGCGATGAAATGAATC
TACATTTGCCGCAATCGCTCGAAACCAAAGCCGAGGTTTCCGATCTAGCT
CGAGTGACAAAATTAATCATAACTCCTCAAAGCAATAAACCGGTCATGAG
TATTGTCCAGGATACTTTAACGGCTTGCAATAAAATGACAACCAGAGATG
TTTTCCTTAATCGTGCCGAAGTCATGCATTTGCTCATGTATTTACCGACA
TGGAATGGCAGACTTCCAAAACCAGCGATTTATAAACCGCTTCGTTTATG
GACAGGAAAACAGATATTTTCCCTCATAATTCCTGGCCGGGTGAACTGTA
TACGAACGCATAGCACTCATCCGGAACCCGAGGAGAATGGACCGTACAAA
TGGATTTCTCCTGGAGATACTAAAGTTCTCATTGAAGATGGGGAGCTTAT
TAGCGGCATTTTGTGCAAGAAAACACTTGGCAGTAGTGCCGGATCATTAA
TTCACATAATAGCTCTTGAACAGCACCCAGATGAAGCCGGTGGTTTCTTC
AATAATGTGCAAACGGTCGTCAATAATTGGCTGCTTATTGAAGGTCACAC
AATTGGTATTGTCGATGCTCTCTATGATGCTAAAACTCGAGAGGAAATCA
AACAGACTATCGATCGAGCCAAAGAAGCTGTATTTGAAACGATCGATAAA
GCACACAATTACGAGTTGCAATCAACTCCCGGAAATACTCTCAGACAGAC
ATTTGAAACAACTGTCAACAAGATTCTAAATGACGCTCGAGATAAAACCG
GAAGTTGTGCCCAAAAATCTCTCTCTAAATATAATAATTTCAATCTCATG
GTTATGTCGGGTGCAAAAGGATCAAAAATCAACATTTCCCAGGTTATCGC
CTGCGTCGGTCAGCAGAACGTCGAGGGTAAACGAATCCCTTTCGGATTCC
AACAGCGAACATTGCCACATTTCATCAAAGATGATTATGGACCGGAATCA
AGGGGATTTGTGGAAAATTCCTATTTGGCCGGTTTGACTCCGACCGAGTT
CTTTTTTCACGCTATGGGAGGTCGAGAAGGTCTCATCGATACCGCAGTTA
AAACTGCCGAAACCGGATATATTCAACGTCGATTAATCAAAGCCATGGAG
TCGGTTATGATCAAATATGACTCCACAGTTAGAAACCAGATCGATCAATT
GATTCAGTTCCGATACGGCGAGGATGGGCTCGATGGGGCATTTGTGGAAT
TCAATCTTTGCCTACATTCAAACCGACAATGGCGGAATTCGAGAAAAGAT
TTCGGTTTGATATTTCCAACGAAGACGAATTGAGTCGATATTTGACCGAG
AAGCGAGTGAGAGAAATTACAACCGAAGCCGACACGATTTGTAAGCTTGA
CACGGAATGGGATCAATTGTGCAAGGATCGCGAGTTGATTCGAGATATTG
TCAAGCACGAAACCGGTGGCAGGGTGGTTTTGCCGTGCAATATCAACCGG
CTCGTTACTAACGGCCAGAAAATATTCAAAATCGATCTGCTGAAGAAAAC
CGATATCAAGCCAATGGACATAATTGAAAAGGTGGAAAACCTGTGTACCG
ATCTCATTGTGGTGAAAGGCGATGATAATATCAGCAAAACAGCCAATGAG
AACGCAACGCTGTTGTTCTGTTGCCTTATCCGCAGCATGCTCTGCTGCAA
GAAAGTTATCGATGAGTATCGATTGAGCCCGGAAGCGTTTGATTGGGTGC
TCGGTGAAATCAAAACCCGATTCAATCAATCGTTGGTGCAACCCGGTGAA
ATGGTCGGCGCGTTGGCTGCTGAAAGTCTCGGGGAACCCGCAACCCAAAT
GACATTAAACACGTTCCATTATGCTGGTGTTTCCGCGAAAAACGTGACGC
TCGGAGTTCCCCGGCTGAAAGAAATCATCAACGTTAGTAGAAACCCGAAA
ACTCCCTCGCTGACCGTTTTCCTCACCGGGAACGCAGCAAAGGACGCGGA
AATGGCAAAAAGTATCGCCGCTCGACTGGAGCACACAACGCTGCGCAAAT
TGGCCGTGAAATCGGAAATCTATTACGATCCGGAACCGGAATCATCTGTG
ATCGAGGGGGACCGAGAATGGGTACGCACGTACTATGAGCTGCCGGATTT
CGACATCGACAAGAAAAGCCCGTATCTATTGAGAATCGTGCTGACGAGAA
AGAAAATGACAGATAAAAAGCTGACTCTCCAGGCAATCGCCGAGAAAATC
ACGGAATATTTCCAGAACGACATAATCTGTCACATTCCCGATGACAATCT
GAATCTGGTGTTGAGAATTCGAATGCTGAAGAAGGAGGATGAAAAGGACG
ACGAAAAGCTGGAAATGGAAGACCGGAAGTATTTAGAGCTGGTGGAGAAT
CTGATTCTCGATGAGATCTGTCTCCAGGGAATCCCGCAGATATCCAAGGT
TTACATTCACTATCCGAAAACCGACGACAAAAAGAAAATCGTTATCAACA
GTGACGGCGCATTCGAGGGAAAGGCGGAATGGATTCTGGAAACCGACGGA
ACGTGCTTGCAGAAAGTTCTAGCAGAACGAGATGTCGACTCGGAAACGAC
AATCAGCAATCATATCACGGAAATATTTGAGACATTTGGCATCGAGGCTG
CTCGGAACGCCATCGAACGTGAGATGCACCATGTCATATCGTTTGACGGT
TCCTATGTCAACTATCGGCACTTGGCACTGCTGTGTGAGATTATGACGCA
CAAGGGGTTCCTGATGTCGATCGACCGACACGGTATCAACCGGCAGGAAA
CGGGCGCCCTAGCCCGATCCTCATTCGAGGAAACCGTAGATATTCTCATG
GAGGCTGGAGCACACGCTGAATGTGACCCAATGAAAGGCGTTTCGGAATC
AATTATGTTGGGTCAGCTGGCAAAGATTGGAACCGGTTGTTTCGATATAT
TGATGAATTATGAGAAATGCAACGAGGCCCAGGCGTTACCTATGATGAGC
GGAGTGGCTCACAATTTGTATATGGTCGGTGGAGCTACTCCAATGAATTC
TGCATCGCCTCAATTGACTCCCTGGACAACTCTCTCGTCTCCCTACACCT
TCTCTCCGAAACCCAATTCTTTCGGCGCGTCGTTCTCACCGATCGCCCAC
TCAGAAATCGGAATGTCCCCGAATCCCGCTTTGGCGTTCAGTCCAATGAT
GAGCCCGAAAACGCCGATGGATTACGGATTTGGCAGATATTCCCCGAGCA
TGAACCCCATCAGCCCGGCTGGCACTAGTCCCAGCAACAGTGGCTATTCA
CCTGCATCAAGCCCTGGTTACAGTCCCACGAGTCCCGGCTACTCTCAAAC
CTCACCTACATATAGTCCAACCAGCCCAGGATATTCCCCTACATCTCCAT
CGTATAGTCCCACCAGTCCAAACTATTCACCAACGTCCCCCTCGTACAGC
CCAACTAGTCCGGGATACTCACCGACCTCTCCATCATACAGTCCAACAAG
CCCGAATTATTCACCAACGTCACCGTCGTACAGCCCGACGAGTCCCGGTT
ACTCTCCGACATCTCCATCATACAGTCCAACCAGTCCAAATTATTCTCCG
ACATCTCCATCGTATTGTCCGACCTCGCCGAGATTGGGAACATCAATTGA
AGGTCGAAGCATCAACTATTCCCCTACCTCTCCAGCTATGGGATATTCCC
CGACCAGCCCGTCGTATTCACCATCGAGTCCATCATTCAATCAGCGCTCC
ACCAGATATTCTCCATCCAGTCCGAATTACAGCCCGTCCTCACCAGCTAC
TCTCCATTATTCGCCGAGCTCTCCAAATTCTCCTTCATCGCCGAATTATT
CTCCATCTAACAGAAATTACTCTCCAACGTCGCCTAATTACTCTCCGACT
TCTCCAGTGATTCCCGCATCTCCAGCATATTCTCCTTCCTCTCCGAATTA
TTCTCCCACATCGCCACGATATACATTGGCTTCGCCGTCCTATTCAGTGT
CGAGAAGCTATTCAGCATCGCCGAGATATACGCCTACTTCTCCCGCCTTT
TCTCCTTCGATAGGCTCTTATGCTCCCCAATCCCCGAGTACCGCCGGTGC
CGTTTCTCCGGTTTATTCTGGAAACATGAGTTATTCTCCGACTTCTCCGC
AATATTCTCCAGCTACTTCCGGATATGTGGCAAACAGTCCAAGTTACGGG
CAGCAGAATACGAATTCCAATTCCGGATATTCGCCACAAAGCCCGTAAAA
TTGGCTAGGAAAATTTTGTTTATTTCTCGATTTCACGATGTTTATGGATT
TGAAATATATGTTAGCAGCTTTTCTAGTGTGAGACGTTTTATTCTGTTGA
TTGGTGGTATTTTACTGTAATTGTGTAGTTGGTAGGCTGTCACTTGTAGG
GAGTGCTGCTCTATGTTCTGATTGGCTTGTGGTTGGCTGACTGACGCCTG
TCTGTTACTGGGGTAGCCTATTGGCTGTTGTTACCAGTTGGAGTTTCTAT
ATACTATTTAATAAATTTATATTTTTAACTATTATTCAATCATTTGTTAT
TGGTTATTTAATCCAGCCAATTATGATTGAACTTGAGCCAAGTTATATTG
AATTGAATGAAACGGTTACTTAGCAACATTTAACATATTATTCCAATCTG
ACTTGCTAACTGGATGAGACAATAATTGCAAATCAAGATCTGTTATTCTA
TGTAATTATTAGCAACTTGTAAGGTGGTCGAATTTCGTTTGATGATCGAA
AT
back to top

protein sequence of SMED30020370-orf-1

>SMED30020370-orf-1 ID=SMED30020370-orf-1|Name=SMED30020370-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=917bp
MANLDLPSVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPK
KDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKI
IKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKV
CSVPNSDRDEMDLKTQEMSRSGCGYVQPIFRRNGLEYFVTLKDDSSDSDS
KQPLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRP
AVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQY
HVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYS
ARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNGTMY
PGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPT
LHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKA
EVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHL
LMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPE
ENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPD
EAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAV
FETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKY
NNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKD
DYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRR
LIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEFNLCLHSNRQW
RNSRKDFGLIFPTKTN*
back to top

protein sequence of SMED30020370-orf-2

>SMED30020370-orf-2 ID=SMED30020370-orf-2|Name=SMED30020370-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=990bp
MAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKD
RELIRDIVKHETGGRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIE
KVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLS
PEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAG
VSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARL
EHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYL
LRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLNLVLRIRML
KKEDEKDDEKLEMEDRKYLELVENLILDEICLQGIPQISKVYIHYPKTDD
KKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIF
ETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDR
HGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKI
GTGCFDILMNYEKCNEAQALPMMSGVAHNLYMVGGATPMNSASPQLTPWT
TLSSPYTFSPKPNSFGASFSPIAHSEIGMSPNPALAFSPMMSPKTPMDYG
FGRYSPSMNPISPAGTSPSNSGYSPASSPGYSPTSPGYSQTSPTYSPTSP
GYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPTSPSYSPTSPNYSPTSPS
YSPTSPGYSPTSPSYSPTSPNYSPTSPSYCPTSPRLGTSIEGRSINYSPT
SPAMGYSPTSPSYSPSSPSFNQRSTRYSPSSPNYSPSSPATLHYSPSSPN
SPSSPNYSPSNRNYSPTSPNYSPTSPVIPASPAYSPSSPNYSPTSPRYTL
ASPSYSVSRSYSASPRYTPTSPAFSPSIGSYAPQSPSTAGAVSPVYSGNM
SYSPTSPQYSPATSGYVANSPSYGQQNTNSNSGYSPQSP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR038120Rpb1_funnel_sf
IPR042102RNA_pol_Rpb1_3_sf
IPR007075RNA_pol_Rpb1_6
IPR007073RNA_pol_Rpb1_7
IPR000684RNA_pol_II_repeat_euk
IPR007081RNA_pol_Rpb1_5
IPR006592RNA_pol_N
IPR007080RNA_pol_Rpb1_1
IPR007083RNA_pol_Rpb1_4
IPR007066RNA_pol_Rpb1_3
IPR000722RNA_pol_asu
Vocabulary: molecular function
TermDefinition
GO:0003899DNA-directed 5'-3' RNA polymerase activity
GO:0003677DNA binding
GO:0016740transferase activity
GO:0016779nucleotidyltransferase activity
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006366transcription from RNA polymerase II promoter
Vocabulary: cellular component
TermDefinition
GO:0005665DNA-directed RNA polymerase II, core complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006592RNA polymerase, N-terminalSMARTSM00663rpolaneu7coord: 234..536
e-value: 1.5E-172
score: 589.2
NoneNo IPR availableGENE3DG3DSA:2.20.25.410coord: 857..892
e-value: 2.6E-9
score: 38.6
NoneNo IPR availableGENE3DG3DSA:1.20.120.1280coord: 254..307
e-value: 2.2E-7
score: 32.8
coord: 4..128
e-value: 3.6E-30
score: 106.5
NoneNo IPR availableGENE3DG3DSA:2.40.40.20coord: 334..503
e-value: 6.6E-71
score: 239.8
NoneNo IPR availableGENE3DG3DSA:3.30.1490.180coord: 377..439
e-value: 6.6E-71
score: 239.8
NoneNo IPR availablePANTHERPTHR19376:SF52DNA-DIRECTED RNA POLYMERASE II SUBUNIT 1coord: 13..915
NoneNo IPR availablePANTHERPTHR19376DNA-DIRECTED RNA POLYMERASEcoord: 13..915
NoneNo IPR availableCDDcd02733RNAP_II_RPB1_Ncoord: 15..863
e-value: 0.0
score: 1376.08
NoneNo IPR availableSUPERFAMILYSSF64484beta and beta-prime subunits of DNA dependent RNA-polymerasecoord: 8..915
IPR038120RNA polymerase Rpb1, funnel domain superfamilyGENE3DG3DSA:1.10.132.30coord: 674..819
e-value: 4.3E-54
score: 184.4
IPR007080RNA polymerase Rpb1, domain 1PFAMPF04997RNA_pol_Rpb1_1coord: 12..342
e-value: 6.0E-92
score: 308.3
IPR000722RNA polymerase, alpha subunitPFAMPF00623RNA_pol_Rpb1_2coord: 344..507
e-value: 8.2E-69
score: 231.1
IPR007066RNA polymerase Rpb1, domain 3PFAMPF04983RNA_pol_Rpb1_3coord: 512..678
e-value: 9.8E-49
score: 165.3
IPR007081RNA polymerase Rpb1, domain 5PFAMPF04998RNA_pol_Rpb1_5coord: 817..882
e-value: 7.4E-31
score: 107.6
IPR042102RNA polymerase Rpb1, domain 3 superfamilyGENE3DG3DSA:1.10.274.100coord: 512..673
e-value: 1.1E-50
score: 173.3
IPR007083RNA polymerase Rpb1, domain 4PFAMPF05000RNA_pol_Rpb1_4coord: 708..810
e-value: 8.1E-38
score: 128.7