Smed-NDK-3

Overview
NameSmed-NDK-3 (ADD84676.1)
Smed IDSMED30020359
Length (bp)1763
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Smed-NDK-3 (SMED30020359) t-SNE clustered cells

Violin plots show distribution of expression levels for Smed-NDK-3 (SMED30020359) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Smed-NDK-3 (SMED30020359) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Smed-NDK-3 (SMED30020359) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020359

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30020359SMESG000046244.1 SMESG000046208.1 GU592832.1smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
prepharyngeal regionSMED30020359SMESG000046244.1 SMESG000046208.1 GU592832.1smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
prepharyngeal cellSMED30020359SMESG000046244.1 SMESG000046208.1 GU592832.1smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30020359SMESG000046244.1 SMESG000046208.1 dd_Smed_v4_6604_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
prepharyngeal regionSMED30020359SMESG000046244.1 SMESG000046208.1 dd_Smed_v4_6604_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30020359SMESG000046244.1 SMESG000046208.1 dd_Smed_v4_6604_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30020359SMESG000046244.1 SMESG000046208.1 dd_Smed_v4_6604_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020359SMESG000046244.1 SMESG000046208.1 dd_Smed_v4_6604_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30020359SMESG000046244.1 SMESG000046208.1 dd_Smed_v4_6604_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30020359SMESG000046244.1 SMESG000046208.1 OX_Smed_1.0.20161ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Smed-NDK-3 vs. Ensembl Human
Match: FGFRL1 (fibroblast growth factor receptor like 1 [Source:HGNC Symbol;Acc:HGNC:3693])

HSP 1 Score: 54.299 bits (129), Expect = 4.223e-7
Identity = 77/316 (24.37%), Postives = 129/316 (40.82%), Query Frame = 3
Query:  126 IGSNMEIICPLDA---PFYQWKKYHNNKVTNIFQDDKRKLNVSLKLE----ESPTIYECGATSGFGQRSVNITVFIIDQNSK----LAQELCYVVPFDPASRVKHQVQYPCFVREQKETTFRMAK--GLSVEFDCESSG-SNVTYAWLFASSANNRKTILTNNKSS-TLKL-DVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTRNNFAISXXXXXXXXXXMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFDKSQTIPWEGNLYKLLPENQIMTPVDLENRIVSSYYFK----DVSLEMAGEYMC 1013
            +G  + + CP++    P   W K  + +  +      R L   LK++    E   +Y C AT+GFG  SVN T+ ++D  S     L  +       DPAS+   Q   P F +  K     +A+  G SV   C +SG       W+    A  R       K   TL L ++  + +G Y C V  +AGA +   +++ VI  + TR+   ++  +     +        Q   R++ +       ++W K+++   +    S TI   G  + +LP        D+ +R   SY  K        + AG Y+C
Sbjct:   43 LGRTVRLQCPVEGDPPPLTMWTK--DGRTIHSGWSRFRVLPQGLKVKQVEREDAGVYVCKATNGFGSLSVNYTLVVLDDISPGKESLGPDSSSGGQEDPASQ---QWARPRFTQPSKMRRRVIARPVGSSVRLKCVASGHPRPDITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAGA-INATYKVDVI--QRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVK-----PVIQWLKRVEYGAEGRHNS-TIDVGGQKFVVLPTG------DVWSRPDGSYLNKLLITRARQDDAGMYIC 338          
BLAST of Smed-NDK-3 vs. Ensembl Human
Match: FGFRL1 (fibroblast growth factor receptor like 1 [Source:HGNC Symbol;Acc:HGNC:3693])

HSP 1 Score: 54.299 bits (129), Expect = 4.223e-7
Identity = 77/316 (24.37%), Postives = 129/316 (40.82%), Query Frame = 3
Query:  126 IGSNMEIICPLDA---PFYQWKKYHNNKVTNIFQDDKRKLNVSLKLE----ESPTIYECGATSGFGQRSVNITVFIIDQNSK----LAQELCYVVPFDPASRVKHQVQYPCFVREQKETTFRMAK--GLSVEFDCESSG-SNVTYAWLFASSANNRKTILTNNKSS-TLKL-DVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTRNNFAISXXXXXXXXXXMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFDKSQTIPWEGNLYKLLPENQIMTPVDLENRIVSSYYFK----DVSLEMAGEYMC 1013
            +G  + + CP++    P   W K  + +  +      R L   LK++    E   +Y C AT+GFG  SVN T+ ++D  S     L  +       DPAS+   Q   P F +  K     +A+  G SV   C +SG       W+    A  R       K   TL L ++  + +G Y C V  +AGA +   +++ VI  + TR+   ++  +     +        Q   R++ +       ++W K+++   +    S TI   G  + +LP        D+ +R   SY  K        + AG Y+C
Sbjct:   43 LGRTVRLQCPVEGDPPPLTMWTK--DGRTIHSGWSRFRVLPQGLKVKQVEREDAGVYVCKATNGFGSLSVNYTLVVLDDISPGKESLGPDSSSGGQEDPASQ---QWARPRFTQPSKMRRRVIARPVGSSVRLKCVASGHPRPDITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAGA-INATYKVDVI--QRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVK-----PVIQWLKRVEYGAEGRHNS-TIDVGGQKFVVLPTG------DVWSRPDGSYLNKLLITRARQDDAGMYIC 338          
BLAST of Smed-NDK-3 vs. Ensembl Human
Match: FGFRL1 (fibroblast growth factor receptor like 1 [Source:HGNC Symbol;Acc:HGNC:3693])

HSP 1 Score: 54.299 bits (129), Expect = 4.223e-7
Identity = 77/316 (24.37%), Postives = 129/316 (40.82%), Query Frame = 3
Query:  126 IGSNMEIICPLDA---PFYQWKKYHNNKVTNIFQDDKRKLNVSLKLE----ESPTIYECGATSGFGQRSVNITVFIIDQNSK----LAQELCYVVPFDPASRVKHQVQYPCFVREQKETTFRMAK--GLSVEFDCESSG-SNVTYAWLFASSANNRKTILTNNKSS-TLKL-DVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTRNNFAISXXXXXXXXXXMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFDKSQTIPWEGNLYKLLPENQIMTPVDLENRIVSSYYFK----DVSLEMAGEYMC 1013
            +G  + + CP++    P   W K  + +  +      R L   LK++    E   +Y C AT+GFG  SVN T+ ++D  S     L  +       DPAS+   Q   P F +  K     +A+  G SV   C +SG       W+    A  R       K   TL L ++  + +G Y C V  +AGA +   +++ VI  + TR+   ++  +     +        Q   R++ +       ++W K+++   +    S TI   G  + +LP        D+ +R   SY  K        + AG Y+C
Sbjct:   43 LGRTVRLQCPVEGDPPPLTMWTK--DGRTIHSGWSRFRVLPQGLKVKQVEREDAGVYVCKATNGFGSLSVNYTLVVLDDISPGKESLGPDSSSGGQEDPASQ---QWARPRFTQPSKMRRRVIARPVGSSVRLKCVASGHPRPDITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAGA-INATYKVDVI--QRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVK-----PVIQWLKRVEYGAEGRHNS-TIDVGGQKFVVLPTG------DVWSRPDGSYLNKLLITRARQDDAGMYIC 338          
BLAST of Smed-NDK-3 vs. Ensembl Human
Match: FGFRL1 (fibroblast growth factor receptor like 1 [Source:HGNC Symbol;Acc:HGNC:3693])

HSP 1 Score: 54.299 bits (129), Expect = 4.223e-7
Identity = 77/316 (24.37%), Postives = 129/316 (40.82%), Query Frame = 3
Query:  126 IGSNMEIICPLDA---PFYQWKKYHNNKVTNIFQDDKRKLNVSLKLE----ESPTIYECGATSGFGQRSVNITVFIIDQNSK----LAQELCYVVPFDPASRVKHQVQYPCFVREQKETTFRMAK--GLSVEFDCESSG-SNVTYAWLFASSANNRKTILTNNKSS-TLKL-DVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTRNNFAISXXXXXXXXXXMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFDKSQTIPWEGNLYKLLPENQIMTPVDLENRIVSSYYFK----DVSLEMAGEYMC 1013
            +G  + + CP++    P   W K  + +  +      R L   LK++    E   +Y C AT+GFG  SVN T+ ++D  S     L  +       DPAS+   Q   P F +  K     +A+  G SV   C +SG       W+    A  R       K   TL L ++  + +G Y C V  +AGA +   +++ VI  + TR+   ++  +     +        Q   R++ +       ++W K+++   +    S TI   G  + +LP        D+ +R   SY  K        + AG Y+C
Sbjct:   43 LGRTVRLQCPVEGDPPPLTMWTK--DGRTIHSGWSRFRVLPQGLKVKQVEREDAGVYVCKATNGFGSLSVNYTLVVLDDISPGKESLGPDSSSGGQEDPASQ---QWARPRFTQPSKMRRRVIARPVGSSVRLKCVASGHPRPDITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAGA-INATYKVDVI--QRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVK-----PVIQWLKRVEYGAEGRHNS-TIDVGGQKFVVLPTG------DVWSRPDGSYLNKLLITRARQDDAGMYIC 338          
BLAST of Smed-NDK-3 vs. Ensembl Zebrafish
Match: fgfrl1a (fibroblast growth factor receptor like 1a [Source:ZFIN;Acc:ZDB-GENE-040128-2])

HSP 1 Score: 50.447 bits (119), Expect = 4.625e-6
Identity = 52/217 (23.96%), Postives = 97/217 (44.70%), Query Frame = 3
Query:   90 VGTKASINKLFFIGSNMEIICPLDA---PFYQWKKYHNNKVTNIFQDDKRKLNVSLKLEE----SPTIYECGATSGFGQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVREQKETTFRMAK--GLSVEFDCESSGS-NVTYAWLFASSANNRKTILTNNKSS-TLKL-DVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTR 704
            V  K +  +   IG  M++ CP++    P   W K   N  +   +   R L  +L+++E        + C AT+GFG  ++N T+ +ID +S   +        + ++ +  ++  P F +  K     +A+  G SV   C +SG+      WL  S     + +    K   TL L ++  + +G Y C V  +AG ++   +++ VI   N++
Sbjct:   26 VAEKIAHRQTVRIGRTMKLQCPVEGDPPPLIMWTKDGRNIHSGWMR--FRVLQQALRIKEVEADDAGTFICKATNGFGSVNINYTLIVIDDSSAGREGARPAGETEYSTDLTGKLVRPRFTQPAKMRKRVIARPVGSSVRLKCTASGNPRPDIVWLKDSRPLTPEEVGEGRKKKWTLSLKNLTPEHSGKYTCHVSNRAG-EINATYKVEVIQRTNSK 239          
BLAST of Smed-NDK-3 vs. Ensembl Xenopus
Match: pcca (propionyl-CoA carboxylase subunit alpha [Source:Xenbase;Acc:XB-GENE-944987])

HSP 1 Score: 49.6766 bits (117), Expect = 9.964e-6
Identity = 81/341 (23.75%), Postives = 144/341 (42.23%), Query Frame = 3
Query:   72 FLILLTVGTKASINKLFF-----IGSNMEIICPLDA---PFYQWKK----YHNNKVT-NIFQDDKRKLNVSLKLEESPTIYECGATSGFGQRSVNITVFIIDQNS--KLAQELCYVVPFDPASRVKH----QVQYPCFVREQKETTFRMAK--GLSVEFDCESSGS-NVTYAWLFASSANNRKTILTNNKSS-TLKL-DVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTRNNFAISXXXXXXXXXXMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFDKSQTIPWEGNLYKLLPENQIMTPVD---LENRIVSSYYFKDVSLEMAGEYMC 1013
            FL L + G     +K+       +G  ++++CP++A   P   W K     H+      ++Q   +  +V     E    Y C AT+GFG  +VN T+ +ID +S  K  Q      P  P + V+     Q   P F +  K     +A+  G SV   C +SG+      WL  +     + I  N K   TL L  +  + +G Y C+V  + G ++   +++ VI  + TR+   ++  +     +        Q   R++ +       ++W K+++   +N   S TI   G  + +LP  ++ +  D   L   I++    +D     AG Y+C
Sbjct:    4 FLFLNSSGPPRISDKVMHRQTVRLGRAIKLLCPVEADPPPLIMWMKDGRTIHSGWTRFRVYQHGMKIKDVE---SEDAGSYICKATNGFGSINVNYTLIVIDDSSSGKTNQP-----PDGPNAEVEEFSSKQWARPRFTQPAKMRKRVIARPVGSSVRLKCIASGNPRPDITWLKDNKPLTSQEIGDNKKKKWTLNLKSLKPEDSGKYTCQVYNRVG-QINATYKVEVI--QRTRSKPILTGNHPVNTTVDFGGTTSFQCKVRSDVK-----PVIQWLKRVEYGTENKYNS-TIDVGGQKFIVLPTGEVWSRPDGSYLNKLIITRAREED-----AGMYIC 322          
BLAST of Smed-NDK-3 vs. Ensembl Mouse
Match: Fgfrl1 (fibroblast growth factor receptor-like 1 [Source:MGI Symbol;Acc:MGI:2150920])

HSP 1 Score: 51.9878 bits (123), Expect = 1.651e-6
Identity = 78/321 (24.30%), Postives = 132/321 (41.12%), Query Frame = 3
Query:  126 IGSNMEIICPLDA---PFYQWKKYHNNKVTNIFQDDKRKLNVSLKLEE----SPTIYECGATSGFGQRSVNITVFIIDQNSKLAQELCYVVPF----DPASRVKHQVQYPCFVREQKETTFRMAK--GLSVEFDCESSG----------SNVTYAWLFASSANNRKTILTNNKSSTLKLDVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTRNNFAISXXXXXXXXXXMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFDKSQTIPWEGNLYKLLPENQIMTPVDLE--NRIVSSYYFKDVSLEMAGEYMC 1013
            +G  + + CP++    P   W K  + +  +      R L   LK++E       +Y C AT+GFG  SVN T+ I+D  S   +            DPAS    Q   P F +  K     +A+  G SV   C +SG           + T   L AS    +K  L      +LK ++  + +G Y C V  KAGA +   +++ VI  + TR+   ++  +     +        Q   R++ +       ++W K+++   +    S TI   G  + +LP   + +  D    N+++ S   +D     AG Y+C
Sbjct:   39 LGRTVRLQCPVEGDPPPLTMWTK--DGRTIHSGWSRFRVLPQGLKVKEVEAEDAGVYVCKATNGFGSLSVNYTLIIMDDISPGKESPGPGGSSGGQEDPAS---QQWARPRFTQPSKMRRRVIARPVGSSVRLKCVASGHPRPDIMWMKDDQTLTHLEASEHRKKKWTL------SLK-NLKPEDSGKYTCRVSNKAGA-INATYKVDVI--QRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVK-----PVIQWLKRVEYGSEGRHNS-TIDVGGQKFVVLPTGDVWSRPDGSYLNKLLISRARQD----DAGMYIC 334          
BLAST of Smed-NDK-3 vs. UniProt/SwissProt
Match: sp|Q8N441|FGRL1_HUMAN (Fibroblast growth factor receptor-like 1 OS=Homo sapiens OX=9606 GN=FGFRL1 PE=1 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 2.028e-6
Identity = 77/316 (24.37%), Postives = 129/316 (40.82%), Query Frame = 3
Query:  126 IGSNMEIICPLDA---PFYQWKKYHNNKVTNIFQDDKRKLNVSLKLE----ESPTIYECGATSGFGQRSVNITVFIIDQNSK----LAQELCYVVPFDPASRVKHQVQYPCFVREQKETTFRMAK--GLSVEFDCESSG-SNVTYAWLFASSANNRKTILTNNKSS-TLKL-DVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTRNNFAISXXXXXXXXXXMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFDKSQTIPWEGNLYKLLPENQIMTPVDLENRIVSSYYFK----DVSLEMAGEYMC 1013
            +G  + + CP++    P   W K  + +  +      R L   LK++    E   +Y C AT+GFG  SVN T+ ++D  S     L  +       DPAS+   Q   P F +  K     +A+  G SV   C +SG       W+    A  R       K   TL L ++  + +G Y C V  +AGA +   +++ VI  + TR+   ++  +     +        Q   R++ +       ++W K+++   +    S TI   G  + +LP        D+ +R   SY  K        + AG Y+C
Sbjct:   43 LGRTVRLQCPVEGDPPPLTMWTK--DGRTIHSGWSRFRVLPQGLKVKQVEREDAGVYVCKATNGFGSLSVNYTLVVLDDISPGKESLGPDSSSGGQEDPASQ---QWARPRFTQPSKMRRRVIARPVGSSVRLKCVASGHPRPDITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAGA-INATYKVDVI--QRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVK-----PVIQWLKRVEYGAEGRHNS-TIDVGGQKFVVLPTG------DVWSRPDGSYLNKLLITRARQDDAGMYIC 338          
BLAST of Smed-NDK-3 vs. TrEMBL
Match: D4P939 (Smed-NDK-3 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 846.269 bits (2185), Expect = 0.000e+0
Identity = 420/427 (98.36%), Postives = 421/427 (98.59%), Query Frame = 3
Query:   90 VGTKASINKLFFIGSNMEIICPLDAPFYQWKKYHNNKVTNIFQDDKRKLNVSLKLEESPTIYECGATSGFGQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVREQKETTFRMAKGLSVEFDCESSGSNVTYAWLFASSANNRKTILTNNKSSTLKLDVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTRNNFAISXXXXXXXXXXMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFDKSQTIPWEGNLYKLLPENQIMTPVDLENRIVSSYYFKDVSLEMAGEYMCAIITNSGTIKYKTFNVYVINNSVEEEIRQSLFFLYILIPSLIIAICSFIGIYLTINRRPARKPSNFQSGTKSETDTTRLRTTPDYSSVQYQINSPPNSQYPPNHTYFHPYYPSSDKLIV 1370
            VGTKASINKLFFIGSNMEIICPLDA FYQWKKYHNNKVTNIFQDDKRKLNVSLKLEESPTIYECGATSGFGQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVREQKE TFRMAKGLSVEFDCESSGSNVTYAWLFASSANNRKTILTNNKSSTLKLDVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENT NNFAISIENTETINITMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFDKSQTIPWEGNLYKLLPENQI+TP D  NRIVSSYYFKDVSLEMAGEYMCAIITNSGTIKYKTFNVYVINNSVEEEIRQSLFFLYILIPSLIIAICSFIGIYLTINRRPARKPSNFQSGTKSETDTTRLRTTPDYSSVQYQINSPPNSQYPPNHTYFHPYYPSSDKLIV
Sbjct:    1 VGTKASINKLFFIGSNMEIICPLDASFYQWKKYHNNKVTNIFQDDKRKLNVSLKLEESPTIYECGATSGFGQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVREQKEATFRMAKGLSVEFDCESSGSNVTYAWLFASSANNRKTILTNNKSSTLKLDVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTHNNFAISIENTETINITMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFDKSQTIPWEGNLYKLLPENQIVTPTDPGNRIVSSYYFKDVSLEMAGEYMCAIITNSGTIKYKTFNVYVINNSVEEEIRQSLFFLYILIPSLIIAICSFIGIYLTINRRPARKPSNFQSGTKSETDTTRLRTTPDYSSVQYQINSPPNSQYPPNHTYFHPYYPSSDKLIV 427          
BLAST of Smed-NDK-3 vs. TrEMBL
Match: A0A0B6VQJ8 (Uncharacterized protein OS=Dugesia japonica OX=6161 GN=ndl-3 PE=2 SV=1)

HSP 1 Score: 585.874 bits (1509), Expect = 0.000e+0
Identity = 294/442 (66.52%), Postives = 350/442 (79.19%), Query Frame = 3
Query:   51 FEMKAIGFLILLTVGTKASINKLFFIGSNMEIICPLDAPFYQWKKYHNNKVTNIFQDDKRKLNVSLKLEESPTIYECGATSGFGQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVREQKETTFRMAKGLSVEFDCESSGSNVTYAWLFASSANNRKTILTN-NKSSTLKLD-VNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTRNNFAISXXXXXXXXXXMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFDKSQTIPWEGNLYKLLPENQIMTPVDLENRIVSSYYFKDVSLEMAGEYMCAIITNSGTIKYKTFNVYVINNSVEEEIRQSLFFLYILIPSLIIAICSFIGIYLTINRRPARKPSNFQSGTKSETDTTRLRTTPDYSSVQYQINSPPNSQYPPNHTYFHPYYPSSDKLIV 1370
            F+MK +GFLILLTVG+KASINKLFFIGSN+EI+CPLDAPFYQWKKY+N+KVTNIFQDDK+KLNVSLKLEESPT YECGATSGF  R+ NIT++++DQNSK AQELCY  PF   S  K++V+YPCF+ +QKETTFR+AKG SV  DCE+SG+NV+Y W   ++ NN K  L   N S   ++D VNDKS G Y C+V T +G KLER FE+ ++ EE  R N  ISIE  E INI+ K  + Q+LNCRTN  I E I+ +KWGKKLD    N DK+Q IPWEGN YKLLPENQI + +D +++ VS+Y FKDV+ +  GEY+C +IT+SG IKYKTF V VINNS EEE  +S FFLYILIPSL+IAIC FIGIYLTINRRPARKP NFQ+  K +TDT+RLRTTPDYSSVQYQ N PPN QYPPN  +++PYYPSSDKLIV
Sbjct:    3 FDMKTLGFLILLTVGSKASINKLFFIGSNVEILCPLDAPFYQWKKYYNDKVTNIFQDDKKKLNVSLKLEESPTTYECGATSGFDNRNFNITIYVLDQNSKKAQELCYNEPFGQKSAGKYRVKYPCFLNDQKETTFRIAKGSSVRLDCEASGTNVSYQWFSVNTINNHKQFLMKYNNSYVAEVDNVNDKSIGQYLCQVNTNSGKKLERNFEISLL-EEPVRGNSLISIETPEIINISTKLNRNQKLNCRTNTLITETIRAIKWGKKLDSDSANLDKNQIIPWEGNSYKLLPENQISSRIDPDSKTVSTYLFKDVTSDTTGEYICVVITDSGQIKYKTFYVSVINNSGEEEAPRSFFFLYILIPSLVIAICLFIGIYLTINRRPARKPLNFQNCPKPDTDTSRLRTTPDYSSVQYQANPPPNHQYPPNQNFYNPYYPSSDKLIV 443          
BLAST of Smed-NDK-3 vs. TrEMBL
Match: T1DBL7 (NDK-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 5.719e-41
Identity = 128/447 (28.64%), Postives = 215/447 (48.10%), Query Frame = 3
Query:  105 SINKLFFIGSNMEIICPLDAPFYQWKKYHNNKVTNIFQD-DKRKLNVSLKLEESPTIYECGATSGFGQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVRE--QKETTFRMAKGLSVEFDCESSGSNVTYAWLFASSANNR-KTILTNNKSSTLKLDVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTRNNFAISXXXXXXXXXXMKNLKKQQLNCRTNEQIFEKIQTVKWGKKL-DLAMKNFDKSQTIPWEGNLYKLLPENQIMTPVDLENRIVSSYYFKDVSLEMAGEYMCAIITNSGTIKYKTFNVYVINNS-VEEEIRQS-LFFLYILIPSLIIAICSFIGIYLTI--------NRRPARK-----PSNFQSGTKSETD-----TTRLRTTPDYSSVQYQINS-----PPNSQYPPNHTYFHPYYPSS 1355
             I+KL  +GS   I CPL  PFY W+ +  N  + +  D D + +       +   IYEC +T+GFG   +NIT+ I+D  S++++E+C    F      +  +   CF+ +  QK+T ++M  G ++E DC+  G N+ Y W F      + K   ++N S  +  ++  ++ G Y CEV  + G+K+ R F    +S  +      I I   + +   +K  +   ++C      +++I ++KWGK++ D  M++   +  + W+ + YK+LP   I+  V   NRI S+   K++ +  +G Y+C  +   G   YK FN+ V  +  +E  +R+S  FFLYIL P+++I IC    IY  +        N  P ++     PSN   G KS         T  R   +YSS+     S      PN+  P N    + + P S
Sbjct:   32 GISKLGLVGSKFIIECPLTGPFYFWRLFQANLDSRVLLDQDSKSITFDFATTDKSGIYECKSTTGFGNAVINITIKILDPKSEISKEIC---SFRDIESSQDYLGGVCFLNDKYQKKTRYKM--GSNIELDCQGVGLNLMYTWKFIDQTGLQVKMSKSDNISRIIITNLIPENEGIYKCEVMNEQGSKIYRSFS---VSISDLSAESGIEIIGEKLVFHAVKYGENISMSCEIKNS-YQRIHSIKWGKRIDDHIMESKMSNNIVLWDQHNYKVLPTLGIIEAVKEPNRITSTLILKNLEISSSGIYICLAMNTFGGTAYKLFNLTVSPDIFMEHSVRRSQFFFLYILTPTILIFICICGVIYCCVKTNTTKSSNTVPLKQCNSSIPSN---GNKSAASNYYYPATSPRVNTNYSSLPQPTESQSSFVSPNTLMPYNSYGNYHFAPQS 466          
BLAST of Smed-NDK-3 vs. TrEMBL
Match: A0A068Q6P3 (Nou-darake like-2 protein OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 1.121e-28
Identity = 99/371 (26.68%), Postives = 170/371 (45.82%), Query Frame = 3
Query:   96 TKASINKLFFIGSNMEIICPLDAPFYQWKKYH-NNKVTNIFQDDKRKLNVSLKLEESPTIYECGATSGFGQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVREQKETTFRMAKGLSVEFDCESSGSNVTYAWLFASSANNRKTI-LTNNKSSTLKLDVNDKSAGNYFCEVRTKAGAKLERVF---------ELLVISEENTRNNFAISXXXXXXXXXXMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFD-KSQTIPWEGNLYKLLPENQIMTPVDLENRIVSSYYFKDVSLEMAGEYMCAIITNSGTIKYKTFNVYVINN-SVEEEIRQSLFF-LYILIPS--LIIAICSFI 1160
            T + I+KL F+   + + CP+ A FY WK Y  + +   + Q + + L +     +   IYEC +T+GF     NITV IID  S++  ELC       + +++   +  CF  E+     R   G ++E DC ++G+++ Y W F  S   ++++    N S  +   V  ++ G+Y C++  + G KL R F         +L +I E+       I               +K    C      + +I ++KWGK++   + + + K   + W+   Y LL E+ I   +   N + SS     +  + +G Y C  +  +G   +K FN+ V     V E   +S FF LYIL+P   L + +C+ I
Sbjct:   29 TYSGISKLGFVNEKIIVECPVKAQFYLWKLYQMHTEPQVLLQQEGKFLTIDPVTADKSGIYECKSTTGFSNTDTNITVKIIDPQSEIVTELC---SMSMSPKIRDVNKGICFFNERSSKVLRYKVGDNIEMDCTAAGTDLKYFWSFIDSNRMKRSLNREMNISKVIIKSVIPENEGSYKCDITNEYGNKLSRTFKVTLSDLPPDLKIIGEKQDDVAAYIG--------------QKIFFKCEVKSN-YNRIHSIKWGKRIRHPISDSNTKLNLVSWDQYTYSLLSESDINKIILNPNHMESSINISIIDPDQSGIYTCLAMDATGRTAHKVFNITVTTEYQVAESNSKSYFFLLYILLPVILLFLFVCAII 381          
BLAST of Smed-NDK-3 vs. TrEMBL
Match: A0A068Y8G8 (Fgfr protein OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000842900 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.276e-10
Identity = 100/459 (21.79%), Postives = 168/459 (36.60%), Query Frame = 3
Query:  117 LFFIGSNMEIICPLDAPFYQWKKYHNNKVTNIFQDDKRKLNVSLKLEESPTIYECGATSGFGQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVREQKETTFRMAK--GLSVEFDCESSGSN-----VTYAWLF----------ASSANNRKTILTNNKSS---------------------------------TLKLDVNDKS-------------AGNYFCEVRTKAG-------AKLERVFELLVISEENTRNNFAISXXXXXXXXXXMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFDKSQTIP-WEGNLYKLLPENQI-------MTPVDLENRIVSS-------------------YYFKDVSLEMAGEYMCAIITNSGTIKYKTFNVYVIN-------NSVEEEIRQSLFFLYILIPSLIIAICSFIGIYLTIN 1181
            L  + + + + CP + PFY+W +       + F D+ + L +     E    Y+C A +GFG     + + ++D NS   +E C +     +   K     PCF+R   +    + +  G  V FDC S  ++     + YAW F          +S   NR T  +N +++                                   + DV   S              G Y C V   A         K+ER F L VI    +     I   +      + +NL +   +C+ N +    + T++WGK +       + S+ +P +EG+  +++  + I       M   +  N++ SS                      + V+   AG Y+C++IT SG    K   V V +        ++EE        LYI  P +I  +C FI  Y  IN
Sbjct:  124 LVPLNTQITLSCPFETPFYKWTR---PDYPSHFLDETKNLTIKADSFEVSGRYQCSAVNGFGNSLAEMAIRVVDYNSPAVKEECAL-----SRDGKINTAGPCFLRSYTDAELVVTRYWGEDVTFDCNSVTADGRTYQLDYAWEFYKQGLGKGLSSSPIGNRLTRRSNTRATPSSGSSSGLGGTAASLGGGAGGGVASNGGVGGGGGRADVARFSESQLTIRKVTLSNMGEYRCTVTNPAPDSSSAVIPKIERTFRLHVIPR--SEGAIIIGDHDITVHVKSGENLIQ---SCKVNAEQHRSV-TIRWGKII-------EPSKAVPTYEGDGKEVIRLSNIAFIVFPLMATSEASNKLTSSTPAVSTPFAVSDPGSPESQLVIQRVTSSNAGTYICSVITESGWDDRKLVRVVVSDAQNEPSAETLEENSYPRRLALYIAAPVVIFFVCIFITSYCLIN 561          
BLAST of Smed-NDK-3 vs. Ensembl Medaka
Match: FGFRL1 (fibroblast growth factor receptor-like 1 [Source:NCBI gene;Acc:101156129])

HSP 1 Score: 49.2914 bits (116), Expect = 9.712e-6
Identity = 77/332 (23.19%), Postives = 131/332 (39.46%), Query Frame = 3
Query:   90 VGTKASINKLFFIGSNMEIICPLDA---PFYQWKKYHNNKVTNIFQDDKRKLNVSLKLEE----SPTIYECGATSGFGQRSVNITVFIIDQNSKLAQELCYVVPFDPASR-------VKHQVQYPCFVREQKETTFRMAK-------GLSVEFDCESSG-SNVTYAWLFASSANNRKTILTN-NKSSTLKL-DVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTRNNFAISXXXXXXXXXXMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFDKSQTIPWEGNLYKLLPENQIMTPVDLENRIVSSYYFKDVSLEMAGEYMC 1013
            V  K +  +   +GS +++ CP++    P   W K   N  +   +   R L + LK++E        Y C AT+GFG  ++N T+ +ID               DP S         K ++    FVR +     +M K       G SV   C +SG       WL        + +     K  TL L ++  + +G Y C V  +AG ++   +++ VI   N++         T  +N T+         C+    +   IQ   W K+++   +N   S TI  E + + +LP  ++ +  D     ++         E AG Y+C
Sbjct:   25 VSGKVAYRQTARLGSAIKMPCPVEGDPPPLIMWTKDDRNIHSGWIR--FRILRMGLKIKEVEADDAGTYICKATNGFGSVNINYTLIVID---------------DPGSDKTGKPEGAKSELSIEKFVRPRFSQPTKMRKRVIARPVGSSVRLKCAASGNPRPDIIWLKDDRPLTEQEVGEGRQKKWTLSLRNLMPQHSGRYTCRVSNQAG-EINATYKVEVIQRTNSKPVLT----GTHPVNTTVDYGGTTSFQCKVRSDVKPVIQ---WLKRVEPHEENRYNS-TIEVEDHRFAVLPAGEVWSRPD--GSYLNKLLITRAKEEDAGMYIC 328          
BLAST of Smed-NDK-3 vs. Planmine SMEST
Match: SMESG000046208.1 (SMESG000046208.1)

HSP 1 Score: 870.537 bits (2248), Expect = 0.000e+0
Identity = 432/440 (98.18%), Postives = 434/440 (98.64%), Query Frame = 3
Query:   51 FEMKAIGFLILLTVGTKASINKLFFIGSNMEIICPLDAPFYQWKKYHNNKVTNIFQDDKRKLNVSLKLEESPTIYECGATSGFGQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVREQKETTFRMAKGLSVEFDCESSGSNVTYAWLFASSANNRKTILTNNKSSTLKLDVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTRNNFAISXXXXXXXXXXMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFDKSQTIPWEGNLYKLLPENQIMTPVDLENRIVSSYYFKDVSLEMAGEYMCAIITNSGTIKYKTFNVYVINNSVEEEIRQSLFFLYILIPSLIIAICSFIGIYLTINRRPARKPSNFQSGTKSETDTTRLRTTPDYSSVQYQINSPPNSQYPPNHTYFHPYYPSSDKLIV 1370
            FEMKAIGFLILLTVGTKASINKLFFIGSNMEIICPLDA FYQWKKYHNNKVTNIFQDDKRKLNVSLKLEESPTIYECGATSGFGQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVREQKE TFRMAKGLSVEFDCESSGSNVTYAWLFASSANNRKTILTNNKSSTLKLDVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTR NFAISIENTETINITMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFDKSQ IPWEGNLYKLLPENQI+TP D ENRIVSSYYFKDVSLEMAGEYMCAIITN+GTIKYKTFNVYVINNSVEEEIRQSLFFLYILIPSLIIAICSFIGIYLTINRRPARKPSNFQSGTKSETDTTRLRTTPDYSSVQYQINSPPNSQYPPNHTYFHPYYPSSDKLIV
Sbjct:    3 FEMKAIGFLILLTVGTKASINKLFFIGSNMEIICPLDATFYQWKKYHNNKVTNIFQDDKRKLNVSLKLEESPTIYECGATSGFGQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVREQKEATFRMAKGLSVEFDCESSGSNVTYAWLFASSANNRKTILTNNKSSTLKLDVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTRKNFAISIENTETINITMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFDKSQMIPWEGNLYKLLPENQIVTPPDPENRIVSSYYFKDVSLEMAGEYMCAIITNTGTIKYKTFNVYVINNSVEEEIRQSLFFLYILIPSLIIAICSFIGIYLTINRRPARKPSNFQSGTKSETDTTRLRTTPDYSSVQYQINSPPNSQYPPNHTYFHPYYPSSDKLIV 442          
BLAST of Smed-NDK-3 vs. Planmine SMEST
Match: SMESG000046208.1 (SMESG000046208.1)

HSP 1 Score: 865.914 bits (2236), Expect = 0.000e+0
Identity = 430/438 (98.17%), Postives = 432/438 (98.63%), Query Frame = 3
Query:   57 MKAIGFLILLTVGTKASINKLFFIGSNMEIICPLDAPFYQWKKYHNNKVTNIFQDDKRKLNVSLKLEESPTIYECGATSGFGQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVREQKETTFRMAKGLSVEFDCESSGSNVTYAWLFASSANNRKTILTNNKSSTLKLDVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTRNNFAISXXXXXXXXXXMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFDKSQTIPWEGNLYKLLPENQIMTPVDLENRIVSSYYFKDVSLEMAGEYMCAIITNSGTIKYKTFNVYVINNSVEEEIRQSLFFLYILIPSLIIAICSFIGIYLTINRRPARKPSNFQSGTKSETDTTRLRTTPDYSSVQYQINSPPNSQYPPNHTYFHPYYPSSDKLIV 1370
            MKAIGFLILLTVGTKASINKLFFIGSNMEIICPLDA FYQWKKYHNNKVTNIFQDDKRKLNVSLKLEESPTIYECGATSGFGQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVREQKE TFRMAKGLSVEFDCESSGSNVTYAWLFASSANNRKTILTNNKSSTLKLDVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTR NFAISIENTETINITMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFDKSQ IPWEGNLYKLLPENQI+TP D ENRIVSSYYFKDVSLEMAGEYMCAIITN+GTIKYKTFNVYVINNSVEEEIRQSLFFLYILIPSLIIAICSFIGIYLTINRRPARKPSNFQSGTKSETDTTRLRTTPDYSSVQYQINSPPNSQYPPNHTYFHPYYPSSDKLIV
Sbjct:    1 MKAIGFLILLTVGTKASINKLFFIGSNMEIICPLDATFYQWKKYHNNKVTNIFQDDKRKLNVSLKLEESPTIYECGATSGFGQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVREQKEATFRMAKGLSVEFDCESSGSNVTYAWLFASSANNRKTILTNNKSSTLKLDVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTRKNFAISIENTETINITMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFDKSQMIPWEGNLYKLLPENQIVTPPDPENRIVSSYYFKDVSLEMAGEYMCAIITNTGTIKYKTFNVYVINNSVEEEIRQSLFFLYILIPSLIIAICSFIGIYLTINRRPARKPSNFQSGTKSETDTTRLRTTPDYSSVQYQINSPPNSQYPPNHTYFHPYYPSSDKLIV 438          
BLAST of Smed-NDK-3 vs. Planmine SMEST
Match: SMESG000046244.1 (SMESG000046244.1)

HSP 1 Score: 843.958 bits (2179), Expect = 0.000e+0
Identity = 418/429 (97.44%), Postives = 421/429 (98.14%), Query Frame = 3
Query:   84 LTVGTKASINKLFFIGSNMEIICPLDAPFYQWKKYHNNKVTNIFQDDKRKLNVSLKLEESPTIYECGATSGFGQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVREQKETTFRMAKGLSVEFDCESSGSNVTYAWLFASSANNRKTILTNNKSSTLKLDVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTRNNFAISXXXXXXXXXXMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFDKSQTIPWEGNLYKLLPENQIMTPVDLENRIVSSYYFKDVSLEMAGEYMCAIITNSGTIKYKTFNVYVINNSVEEEIRQSLFFLYILIPSLIIAICSFIGIYLTINRRPARKPSNFQSGTKSETDTTRLRTTPDYSSVQYQINSPPNSQYPPNHTYFHPYYPSSDKLIV 1370
            + +GTKASINKLFFIGSNMEIICPLDA FYQWKKYHNNKVTNIFQDDKRKLNVSLKLEESPTIYECGATSGF QRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVREQKE TFRMAKGLSVEFDCESSGSNVTYAWLFASSANNRKTILTNNKSSTLKLDVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENT NNFAISIENTETINITMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFDKSQTIPWEGNLYKLLPENQI+TP D  NRIVSSYYFKDVSLEMAGEYMCAIITNSGTIKYKTFNVYVINNSVEEEIRQSLFFLYILIPSLIIAICSFIGIYLTINRRPARKPSNFQSGTKSETDTTRLRTTPDYSSVQYQINSPPNSQYPPNHTYFHPYYPSSDKLIV
Sbjct:    1 MAIGTKASINKLFFIGSNMEIICPLDASFYQWKKYHNNKVTNIFQDDKRKLNVSLKLEESPTIYECGATSGFDQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVREQKEATFRMAKGLSVEFDCESSGSNVTYAWLFASSANNRKTILTNNKSSTLKLDVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTHNNFAISIENTETINITMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFDKSQTIPWEGNLYKLLPENQIVTPTDPGNRIVSSYYFKDVSLEMAGEYMCAIITNSGTIKYKTFNVYVINNSVEEEIRQSLFFLYILIPSLIIAICSFIGIYLTINRRPARKPSNFQSGTKSETDTTRLRTTPDYSSVQYQINSPPNSQYPPNHTYFHPYYPSSDKLIV 429          
BLAST of Smed-NDK-3 vs. Planmine SMEST
Match: SMESG000046244.1 (SMESG000046244.1)

HSP 1 Score: 843.573 bits (2178), Expect = 0.000e+0
Identity = 419/427 (98.13%), Postives = 420/427 (98.36%), Query Frame = 3
Query:   90 VGTKASINKLFFIGSNMEIICPLDAPFYQWKKYHNNKVTNIFQDDKRKLNVSLKLEESPTIYECGATSGFGQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVREQKETTFRMAKGLSVEFDCESSGSNVTYAWLFASSANNRKTILTNNKSSTLKLDVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTRNNFAISXXXXXXXXXXMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFDKSQTIPWEGNLYKLLPENQIMTPVDLENRIVSSYYFKDVSLEMAGEYMCAIITNSGTIKYKTFNVYVINNSVEEEIRQSLFFLYILIPSLIIAICSFIGIYLTINRRPARKPSNFQSGTKSETDTTRLRTTPDYSSVQYQINSPPNSQYPPNHTYFHPYYPSSDKLIV 1370
            VGTKASINKLFFIGSNMEIICPLDA FYQWKKYHNNKVTNIFQDDKRKLNVSLKLEESPTIYECGATSGF QRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVREQKE TFRMAKGLSVEFDCESSGSNVTYAWLFASSANNRKTILTNNKSSTLKLDVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENT NNFAISIENTETINITMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFDKSQTIPWEGNLYKLLPENQI+TP D  NRIVSSYYFKDVSLEMAGEYMCAIITNSGTIKYKTFNVYVINNSVEEEIRQSLFFLYILIPSLIIAICSFIGIYLTINRRPARKPSNFQSGTKSETDTTRLRTTPDYSSVQYQINSPPNSQYPPNHTYFHPYYPSSDKLIV
Sbjct:    7 VGTKASINKLFFIGSNMEIICPLDASFYQWKKYHNNKVTNIFQDDKRKLNVSLKLEESPTIYECGATSGFDQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVREQKEATFRMAKGLSVEFDCESSGSNVTYAWLFASSANNRKTILTNNKSSTLKLDVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTHNNFAISIENTETINITMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFDKSQTIPWEGNLYKLLPENQIVTPTDPGNRIVSSYYFKDVSLEMAGEYMCAIITNSGTIKYKTFNVYVINNSVEEEIRQSLFFLYILIPSLIIAICSFIGIYLTINRRPARKPSNFQSGTKSETDTTRLRTTPDYSSVQYQINSPPNSQYPPNHTYFHPYYPSSDKLIV 433          
BLAST of Smed-NDK-3 vs. Planmine SMEST
Match: SMESG000046244.1 (SMESG000046244.1)

HSP 1 Score: 838.951 bits (2166), Expect = 0.000e+0
Identity = 417/425 (98.12%), Postives = 418/425 (98.35%), Query Frame = 3
Query:   96 TKASINKLFFIGSNMEIICPLDAPFYQWKKYHNNKVTNIFQDDKRKLNVSLKLEESPTIYECGATSGFGQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVREQKETTFRMAKGLSVEFDCESSGSNVTYAWLFASSANNRKTILTNNKSSTLKLDVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTRNNFAISXXXXXXXXXXMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFDKSQTIPWEGNLYKLLPENQIMTPVDLENRIVSSYYFKDVSLEMAGEYMCAIITNSGTIKYKTFNVYVINNSVEEEIRQSLFFLYILIPSLIIAICSFIGIYLTINRRPARKPSNFQSGTKSETDTTRLRTTPDYSSVQYQINSPPNSQYPPNHTYFHPYYPSSDKLIV 1370
            TKASINKLFFIGSNMEIICPLDA FYQWKKYHNNKVTNIFQDDKRKLNVSLKLEESPTIYECGATSGF QRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVREQKE TFRMAKGLSVEFDCESSGSNVTYAWLFASSANNRKTILTNNKSSTLKLDVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENT NNFAISIENTETINITMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFDKSQTIPWEGNLYKLLPENQI+TP D  NRIVSSYYFKDVSLEMAGEYMCAIITNSGTIKYKTFNVYVINNSVEEEIRQSLFFLYILIPSLIIAICSFIGIYLTINRRPARKPSNFQSGTKSETDTTRLRTTPDYSSVQYQINSPPNSQYPPNHTYFHPYYPSSDKLIV
Sbjct:    4 TKASINKLFFIGSNMEIICPLDASFYQWKKYHNNKVTNIFQDDKRKLNVSLKLEESPTIYECGATSGFDQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVREQKEATFRMAKGLSVEFDCESSGSNVTYAWLFASSANNRKTILTNNKSSTLKLDVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTHNNFAISIENTETINITMKNLKKQQLNCRTNEQIFEKIQTVKWGKKLDLAMKNFDKSQTIPWEGNLYKLLPENQIVTPTDPGNRIVSSYYFKDVSLEMAGEYMCAIITNSGTIKYKTFNVYVINNSVEEEIRQSLFFLYILIPSLIIAICSFIGIYLTINRRPARKPSNFQSGTKSETDTTRLRTTPDYSSVQYQINSPPNSQYPPNHTYFHPYYPSSDKLIV 428          
The following BLAST results are available for this feature:
BLAST of Smed-NDK-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
FGFRL14.223e-724.37fibroblast growth factor receptor like 1 [Source:H... [more]
FGFRL14.223e-724.37fibroblast growth factor receptor like 1 [Source:H... [more]
FGFRL14.223e-724.37fibroblast growth factor receptor like 1 [Source:H... [more]
FGFRL14.223e-724.37fibroblast growth factor receptor like 1 [Source:H... [more]
back to top
BLAST of Smed-NDK-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Smed-NDK-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Smed-NDK-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fgfrl1a4.625e-623.96fibroblast growth factor receptor like 1a [Source:... [more]
back to top
BLAST of Smed-NDK-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pcca9.964e-623.75propionyl-CoA carboxylase subunit alpha [Source:Xe... [more]
back to top
BLAST of Smed-NDK-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Fgfrl11.651e-624.30fibroblast growth factor receptor-like 1 [Source:M... [more]
back to top
BLAST of Smed-NDK-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q8N441|FGRL1_HUMAN2.028e-624.37Fibroblast growth factor receptor-like 1 OS=Homo s... [more]
back to top
BLAST of Smed-NDK-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D4P9390.000e+098.36Smed-NDK-3 (Fragment) OS=Schmidtea mediterranea OX... [more]
A0A0B6VQJ80.000e+066.52Uncharacterized protein OS=Dugesia japonica OX=616... [more]
T1DBL75.719e-4128.64NDK-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A068Q6P31.121e-2826.68Nou-darake like-2 protein OS=Dugesia japonica OX=6... [more]
A0A068Y8G81.276e-1021.79Fgfr protein OS=Echinococcus multilocularis OX=621... [more]
back to top
BLAST of Smed-NDK-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Smed-NDK-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Smed-NDK-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Smed-NDK-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Smed-NDK-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
FGFRL19.712e-623.19fibroblast growth factor receptor-like 1 [Source:N... [more]
back to top
BLAST of Smed-NDK-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046208.10.000e+098.18SMESG000046208.1[more]
SMESG000046208.10.000e+098.17SMESG000046208.1[more]
SMESG000046244.10.000e+097.44SMESG000046244.1[more]
SMESG000046244.10.000e+098.13SMESG000046244.1[more]
SMESG000046244.10.000e+098.12SMESG000046244.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30020359
GenBankADD84676.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020359 ID=SMED30020359|Name=Smed-NDK-3|organism=Schmidtea mediterranea sexual|type=transcript|length=1763bp
CTCTTCCGATCTGAAATTTTATTATAATTCTTATATTACTCTAAATGTTA
TTCGAAATGAAAGCGATTGGATTTCTAATATTATTGACAGTAGGAACCAA
AGCCTCAATTAATAAATTGTTTTTCATTGGTTCAAATATGGAAATAATCT
GTCCGCTTGATGCTCCATTCTATCAATGGAAAAAATATCATAATAATAAA
GTAACGAATATTTTCCAAGATGATAAAAGAAAATTGAATGTTTCCCTAAA
ATTGGAAGAATCTCCCACAATTTATGAGTGCGGTGCTACTAGTGGATTTG
GTCAAAGAAGCGTTAATATTACTGTATTCATTATAGATCAAAACTCAAAA
TTGGCCCAAGAATTGTGCTACGTCGTTCCTTTTGATCCGGCATCGCGAGT
AAAACATCAGGTTCAATATCCTTGTTTTGTACGCGAACAAAAGGAAACTA
CTTTCAGAATGGCCAAAGGCCTTTCTGTGGAATTCGACTGTGAAAGCTCT
GGCAGCAATGTCACATATGCCTGGCTATTTGCGAGCAGTGCAAATAATCG
CAAAACAATATTGACGAACAATAAATCTTCCACTCTTAAACTCGATGTCA
ATGACAAATCAGCTGGCAACTATTTCTGTGAGGTCAGGACGAAGGCCGGC
GCGAAACTTGAGCGAGTATTTGAATTATTAGTAATATCAGAAGAAAATAC
ACGTAATAACTTCGCAATTTCGATAGAAAACACTGAAACAATCAACATTA
CAATGAAAAATTTAAAAAAACAACAATTAAATTGTCGCACAAATGAACAA
ATTTTTGAAAAGATTCAAACGGTAAAATGGGGCAAAAAGTTGGATTTAGC
AATGAAAAACTTTGATAAATCTCAAACGATTCCATGGGAAGGAAATCTTT
ACAAACTGTTGCCAGAAAATCAAATTATGACCCCAGTGGATCTAGAAAAC
CGAATAGTGAGCTCGTACTATTTCAAAGACGTCTCATTGGAAATGGCAGG
AGAATACATGTGCGCAATTATCACCAACAGCGGCACGATCAAATATAAAA
CCTTCAATGTCTATGTTATAAATAACTCTGTCGAAGAAGAAATTCGACAA
AGTTTATTCTTTTTATACATTTTAATTCCTTCGTTAATAATTGCAATTTG
CTCTTTCATTGGTATCTATTTGACAATAAACCGCCGACCGGCCCGAAAGC
CATCGAATTTTCAAAGCGGAACGAAATCAGAAACCGACACAACCAGACTG
CGAACGACGCCAGATTATTCATCGGTCCAATATCAAATTAACTCTCCGCC
GAATTCCCAATATCCTCCAAATCATACCTACTTCCATCCGTATTATCCTT
CATCCGATAAGTTAATAGTGTGAAAAGATTCTCGTGAACGATATCCGATT
TGAGAAAAGTTCCACCAAACGACCAACCAACCTCCTCCCGCGCGAGACCT
TCTTAACCCAAAATGTGATGCCATACTTTCAAAAATGTCTCTGGCGTTGA
CTTGATTCAGGATTCATTGTATTTGTCATTTCCAAACGAGGAAATCATGA
AAAAAAAATTGTTTTGTTTTTTATATTCACTGATATATATTTGCTAGAAG
GTTGAAACAAAGTGTTGATAATATTTATTGTAATGAAATTTTTGTCTGAG
ATTTGAAAGAGATTTTCAATTTCAATTGCATGCCTGTTCCGCTTGGTTAG
ATTTACCCACTGATTTTGCAGTTCAAATTCGTAATTGCTTTTAGATCTCC
AGAAGAGATCGGA
back to top

protein sequence of SMED30020359-orf-1

>SMED30020359-orf-1 ID=SMED30020359-orf-1|Name=SMED30020359-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=443bp
MLFEMKAIGFLILLTVGTKASINKLFFIGSNMEIICPLDAPFYQWKKYHN
NKVTNIFQDDKRKLNVSLKLEESPTIYECGATSGFGQRSVNITVFIIDQN
SKLAQELCYVVPFDPASRVKHQVQYPCFVREQKETTFRMAKGLSVEFDCE
SSGSNVTYAWLFASSANNRKTILTNNKSSTLKLDVNDKSAGNYFCEVRTK
AGAKLERVFELLVISEENTRNNFAISIENTETINITMKNLKKQQLNCRTN
EQIFEKIQTVKWGKKLDLAMKNFDKSQTIPWEGNLYKLLPENQIMTPVDL
ENRIVSSYYFKDVSLEMAGEYMCAIITNSGTIKYKTFNVYVINNSVEEEI
RQSLFFLYILIPSLIIAICSFIGIYLTINRRPARKPSNFQSGTKSETDTT
RLRTTPDYSSVQYQINSPPNSQYPPNHTYFHPYYPSSDKLIV*
back to top
Aliases
The feature 'Smed-NDK-3' has the following synonyms
Synonym
NDK-3
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0000419prepharyngeal region
PLANA:0000421tail
PLANA:0003118prepharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR003599Ig_sub
IPR013783Ig-like_fold
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 134..214
e-value: 9.5
score: 11.6
coord: 21..95
e-value: 12.0
score: 10.8
coord: 232..342
e-value: 15.0
score: 9.9
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 218..346
e-value: 7.5E-6
score: 27.8
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 121..217
e-value: 3.2E-7
score: 32.3
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 126..210
score: 10.208
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.586
NoneNo IPR availableTMHMMTMhelixcoord: 354..376
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 139..214