SH3 domain-containing kinase-binding protein 1

Overview
NameSH3 domain-containing kinase-binding protein 1
Smed IDSMED30020355
Length (bp)2068
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SH3 domain-containing kinase-binding protein 1 (SMED30020355) t-SNE clustered cells

Violin plots show distribution of expression levels for SH3 domain-containing kinase-binding protein 1 (SMED30020355) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SH3 domain-containing kinase-binding protein 1 (SMED30020355) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SH3 domain-containing kinase-binding protein 1 (SMED30020355) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020355

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30020355SMESG000079662.1 Contig1433GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30020355SMESG000079662.1 dd_Smed_v4_1522_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020355SMESG000079662.1 dd_Smed_v4_1522_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020355SMESG000079662.1 dd_Smed_v4_1522_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Human
Match: SH3KBP1 (SH3 domain containing kinase binding protein 1 [Source:HGNC Symbol;Acc:HGNC:13867])

HSP 1 Score: 124.79 bits (312), Expect = 3.990e-29
Identity = 99/282 (35.11%), Postives = 137/282 (48.58%), Query Frame = 1
Query:   85 IEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNT--------------------KENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKET-------------TRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI-----KEENNKPSRPNNAA-IIKAGPPPPVTAAKPKINVGKSIPPRPPQLL 813
            + F Y     DEL +  GDII  V   E+GW  G+L GK G+FPSNF K +       + D L I Q E+ + ++                      N  V      PKKV GVGFG+IF    IKL+  + + +   +  E   + + +K P  T             T++KD  +VI  Y A+N DELT++ GDI+T+ NK+  D GWW G + NG+ GVFPDNFV+ +     KE N     P  +A +IK G     T  K +I   K IPP  P++L
Sbjct:   68 VAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELS-----GESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKSEGANGTVATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPVE---KTIGKKLPATTATPDSSKTEMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEG-ELNGRRGVFPDNFVKLLPPDFEKEGNRPKKPPPPSAPVIKQG--AGTTERKHEI---KKIPPERPEML 335          

HSP 2 Score: 56.9954 bits (136), Expect = 1.080e-7
Identity = 26/61 (42.62%), Postives = 40/61 (65.57%), Query Frame = 1
Query:  511 VRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENN 693
             +V  SY  +N DEL L++GDII V    + +EGWW G   NG++G+FP NF++ +  E++
Sbjct:   66 CQVAFSYLPQNDDELELKVGDIIEVVG--EVEEGWWEG-VLNGKTGMFPSNFIKELSGESD 123          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Human
Match: SH3KBP1 (SH3 domain containing kinase binding protein 1 [Source:HGNC Symbol;Acc:HGNC:13867])

HSP 1 Score: 124.02 bits (310), Expect = 7.893e-29
Identity = 99/282 (35.11%), Postives = 137/282 (48.58%), Query Frame = 1
Query:   85 IEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNT--------------------KENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKET-------------TRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI-----KEENNKPSRPNNAA-IIKAGPPPPVTAAKPKINVGKSIPPRPPQLL 813
            + F Y     DEL +  GDII  V   E+GW  G+L GK G+FPSNF K +       + D L I Q E+ + ++                      N  V      PKKV GVGFG+IF    IKL+  + + +   +  E   + + +K P  T             T++KD  +VI  Y A+N DELT++ GDI+T+ NK+  D GWW G + NG+ GVFPDNFV+ +     KE N     P  +A +IK G     T  K +I   K IPP  P++L
Sbjct:  105 VAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELS-----GESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKSEGANGTVATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPVE---KTIGKKLPATTATPDSSKTEMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEG-ELNGRRGVFPDNFVKLLPPDFEKEGNRPKKPPPPSAPVIKQG--AGTTERKHEI---KKIPPERPEML 372          

HSP 2 Score: 92.0485 bits (227), Expect = 1.092e-18
Identity = 62/208 (29.81%), Postives = 96/208 (46.15%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENNK 696
            ++ ++EFDY A   DELTI  G+II ++R  + GW  G + G+ G+FP NF + +K++ +K    N                        P K +  V  GN     E  L+T                        K   R +   +V  SY  +N DEL L++GDII V    + +EGWW G   NG++G+FP NF++ +  E+++
Sbjct:    2 VEAIVEFDYQAQHDDELTISVGEIITNIRKEDGGWWEGQINGRRGLFPDNFVREIKKEMKKDPLTN----------------------KAPEKPLHEVPSGNSLLSSETILRTN-----------------------KRGERRRRRCQVAFSYLPQNDDELELKVGDIIEVVG--EVEEGWWEG-VLNGKTGMFPSNFIKELSGESDE 161          

HSP 3 Score: 62.003 bits (149), Expect = 2.777e-9
Identity = 32/63 (50.79%), Postives = 41/63 (65.08%), Query Frame = 1
Query:  529 YTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENNKPSRPNNA 717
            Y A++ DELT+ +G+IIT  N   ED GWW G + NG+ G+FPDNFV  IK+E  K    N A
Sbjct:   10 YQAQHDDELTISVGEIIT--NIRKEDGGWWEG-QINGRRGLFPDNFVREIKKEMKKDPLTNKA 69          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Human
Match: CD2AP (CD2 associated protein [Source:HGNC Symbol;Acc:HGNC:14258])

HSP 1 Score: 117.087 bits (292), Expect = 1.128e-26
Identity = 82/225 (36.44%), Postives = 118/225 (52.44%), Query Frame = 1
Query:   85 IEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVK----EDRRKSQEDNLII------PQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPE---ILQEKKPK----ETTRT--------KDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKE 684
            + F+Y     DEL +  GDII+     E+GW  G L  K G+FPSNF K ++     +  ++Q+D+  +      P     N +   +  V +    PKK+ G+GFG+IF  G +KL+T    ++    +EE KPE   ILQ   PK    E T+T        K+  R + +Y   N DELT + G+II + +KE  + GWWRG + NG+ GVFPDNF   I E
Sbjct:  115 VLFEYIPQNEDELELKVGDIIDINEEVEEGWWSGTLNNKLGLFPSNFVKELEVTDDGETHEAQDDSETVLAGPTSPIPSLGNVSETASGSVTQ----PKKIRGIGFGDIFKEGSVKLRTRTSSSE----TEEKKPEKPLILQSLGPKTQSVEITKTDTEGKIKAKEYCRTLFAYEGTNEDELTFKEGEIIHLISKETGEAGWWRG-ELNGKEGVFPDNFAVQINE 330          

HSP 2 Score: 97.0561 bits (240), Expect = 3.023e-20
Identity = 69/229 (30.13%), Postives = 118/229 (51.53%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSVRP-HEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENNKPSR--PNNAAIIKAGPPPPV 750
            +DY++E+DYDA   DELTI  G+II +V+   E+GW+ G L G+ G+FP NF   VKE +R+++  +  +P   ER+ N              ++++  G     +GG                   ++P    + K  +    K   +V+  Y  +N DEL L++GDII +   E+ +EGWW G  +N + G+FP NFV+ ++  ++  +    +++  + AGP  P+
Sbjct:    2 VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNF---VKEIKRETEFKDDSLPIKRERHGNV---------ASLVQRISTYGLP---AGG-------------------IQPH--PQTKNIKKKTKKRQCKVLFEYIPQNEDELELKVGDIIDIN--EEVEEGWWSGTLNN-KLGLFPSNFVKELEVTDDGETHEAQDDSETVLAGPTSPI 191          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Human
Match: SH3D21 (SH3 domain containing 21 [Source:HGNC Symbol;Acc:HGNC:26236])

HSP 1 Score: 91.2781 bits (225), Expect = 2.014e-18
Identity = 59/199 (29.65%), Postives = 88/199 (44.22%), Query Frame = 1
Query:   85 IEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKV--ISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEP 675
            + F Y  ++ADEL +  G+I+  ++  EDGW  G   G+ G FPSNF +                               +++  PP         GN     ++   +      PK+  ++ +  P+ LQ      T    +V RV+  Y  E  DEL L  GD++ V +K  ED+GWW G +  G+ GVFPDNFV P
Sbjct:   90 VNFSYSPEQADELKLQAGEIVEMIKEIEDGWWLGKKNGQLGAFPSNFVE-------------------------------LLDSGPP-------SLGN----PDMPSVSPGPQRPPKLSSLAYDSPPDYLQ------TVSHPEVYRVLFDYQPEAPDELALRRGDVVKVLSKTTEDKGWWEG-ECQGRRGVFPDNFVLP 239          

HSP 2 Score: 60.4622 bits (145), Expect = 9.628e-9
Identity = 41/110 (37.27%), Postives = 57/110 (51.82%), Query Frame = 1
Query:  481 PKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENNKPSRPNNAAIIKAGPPPPVTAAKPKINVGKSIPPRPPQL 810
            P +  R +   +V  SY+ E +DEL L+ G+I+ +  KE ED GWW G+K NGQ G FP NFVE                ++ +GPP       P ++ G   P RPP+L
Sbjct:   78 PAKHPRPQRWCKVNFSYSPEQADELKLQAGEIVEMI-KEIED-GWWLGKK-NGQLGAFPSNFVE----------------LLDSGPPSLGNPDMPSVSPG---PQRPPKL 165          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Human
Match: SH3KBP1 (SH3 domain containing kinase binding protein 1 [Source:HGNC Symbol;Acc:HGNC:13867])

HSP 1 Score: 88.9669 bits (219), Expect = 7.932e-18
Identity = 60/208 (28.85%), Postives = 96/208 (46.15%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENNK 696
            ++ ++EFDY A   DELTI  G+II ++R  + GW  G + G+ G+FP NF + +K++ +K    N                        P K +  V  GN     E  L+T  +  +                        +   +V  SY  +N DEL L++GDII V    + +EGWW G   NG++G+FP NF++ +  E+++
Sbjct:    2 VEAIVEFDYQAQHDDELTISVGEIITNIRKEDGGWWEGQINGRRGLFPDNFVREIKKEMKKDPLTN----------------------KAPEKPLHEVPSGNSLLSSETILRTNKRGER-----------------------RRRRCQVAFSYLPQNDDELELKVGDIIEVVG--EVEEGWWEG-VLNGKTGMFPSNFIKELSGESDE 161          

HSP 2 Score: 87.4261 bits (215), Expect = 2.715e-17
Identity = 70/185 (37.84%), Postives = 97/185 (52.43%), Query Frame = 1
Query:  316 NDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKET-------------TRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI-----KEENNKPSRPNNAA-IIKAGPPPPVTAAKPKINVGKSIPPRPPQLL 813
            N  V      PKKV GVGFG+IF    IKL+  + + +   +  E   + + +K P  T             T++KD  +VI  Y A+N DELT++ GDI+T+ NK+  D GWW G + NG+ GVFPDNFV+ +     KE N     P  +A +IK G     T  K +I   K IPP  P++L
Sbjct:  241 NGTVATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPVE---KTIGKKLPATTATPDSSKTEMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEG-ELNGRRGVFPDNFVKLLPPDFEKEGNRPKKPPPPSAPVIKQG--AGTTERKHEI---KKIPPERPEML 416          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Celegans
Match: nck-1 (NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family [Source:UniProtKB/TrEMBL;Acc:Q95PX0])

HSP 1 Score: 61.6178 bits (148), Expect = 8.362e-10
Identity = 49/215 (22.79%), Postives = 88/215 (40.93%), Query Frame = 1
Query:   82 LIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGIL-RGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDV-VIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENNKPSRPNNAA 720
            +++F Y+    DEL + KGD +  V    DGW  G    G  G FPSN+ + V+     +Q         E RN         ++ Q PPPK                                      LQ  +      + +VV  ++S+ A +S+EL+ + G+ + + +  + D  WW  R ++G +G+ P N++E + + ++  +   + A
Sbjct:  120 VVKFTYEPRLEDELGLTKGDFVYVVEKSTDGWWKGEAPNGGVGWFPSNYVEEVEASTNGNQ------GSIENRNPAAAAVPAPIMMQAPPPK--------------------------------------LQASRS-----SFEVVVALYSFDASSSEELSFKKGERLEIVDHPEHDPDWWMARNASGTTGLVPRNYIEVVNDSSSSKASHQDFA 285          

HSP 2 Score: 59.6918 bits (143), Expect = 3.428e-9
Identity = 63/245 (25.71%), Postives = 102/245 (41.63%), Query Frame = 1
Query:   76 DYLI-EFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIK----------EENNKPSRPNNAAIIKAGPPPPVTAAKPKINV 777
            DY++ ++DY A E  ELTI K + +  +   ++ W         G  PSN+   V+++    +    I   A  RN ++           P +++ G+           +L  +  +N        V P     K P  +++TK VV+   +Y     DEL L  GD + V   E   +GWW+G   NG  G FP N+VE ++          E  N  +    A I+   PPP + A++    V
Sbjct:    4 DYVVVKYDYLAQEEQELTIKKNERLKLLDDSKNWWKVMNDSNSVGFVPSNY---VRKESIVDKAKGTIKGLARGRNRSS--------DPEPEERLNGIA----------RLAFSLNNNCA------VTPS--SNKIPMMSSKTKAVVKF--TYEPRLEDELGLTKGDFVYVV--EKSTDGWWKGEAPNGGVGWFPSNYVEEVEASTNGNQGSIENRNPAAAAVPAPIMMQAPPPKLQASRSSFEV 215          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Celegans
Match: nck-1 (NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family [Source:UniProtKB/TrEMBL;Acc:Q95PX0])

HSP 1 Score: 60.4622 bits (145), Expect = 9.340e-10
Identity = 48/201 (23.88%), Postives = 82/201 (40.80%), Query Frame = 1
Query:   82 LIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGIL-RGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDV-VIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI 678
            +++F Y+    DEL + KGD +  V    DGW  G    G  G FPSN+ + V+     +Q         E RN         ++ Q PPPK                                      LQ  +   ++    VV  ++S+ A +S+EL+ + G+ + + +  + D  WW  R ++G +G+ P N++E +
Sbjct:    8 VVKFTYEPRLEDELGLTKGDFVYVVEKSTDGWWKGEAPNGGVGWFPSNYVEEVEASTNGNQ------GSIENRNPAAAAVPAPIMMQAPPPK--------------------------------------LQASR---SSFEIQVVVALYSFDASSSEELSFKKGERLEIVDHPEHDPDWWMARNASGTTGLVPRNYIEVV 161          

HSP 2 Score: 53.1434 bits (126), Expect = 2.479e-7
Identity = 33/106 (31.13%), Postives = 50/106 (47.17%), Query Frame = 1
Query:  490 TTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIK----------EENNKPSRPNNAAIIKAGPPPPVTAAKPKINV 777
            +++TK VV+   +Y     DEL L  GD + V  K  +  GWW+G   NG  G FP N+VE ++          E  N  +    A I+   PPP + A++    +
Sbjct:    2 SSKTKAVVKF--TYEPRLEDELGLTKGDFVYVVEKSTD--GWWKGEAPNGGVGWFPSNYVEEVEASTNGNQGSIENRNPAAAAVPAPIMMQAPPPKLQASRSSFEI 103          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Celegans
Match: nck-1 (NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family [Source:UniProtKB/TrEMBL;Acc:Q95PX0])

HSP 1 Score: 60.4622 bits (145), Expect = 9.340e-10
Identity = 48/201 (23.88%), Postives = 82/201 (40.80%), Query Frame = 1
Query:   82 LIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGIL-RGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDV-VIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI 678
            +++F Y+    DEL + KGD +  V    DGW  G    G  G FPSN+ + V+     +Q         E RN         ++ Q PPPK                                      LQ  +   ++    VV  ++S+ A +S+EL+ + G+ + + +  + D  WW  R ++G +G+ P N++E +
Sbjct:    8 VVKFTYEPRLEDELGLTKGDFVYVVEKSTDGWWKGEAPNGGVGWFPSNYVEEVEASTNGNQ------GSIENRNPAAAAVPAPIMMQAPPPK--------------------------------------LQASR---SSFEIQVVVALYSFDASSSEELSFKKGERLEIVDHPEHDPDWWMARNASGTTGLVPRNYIEVV 161          

HSP 2 Score: 53.1434 bits (126), Expect = 2.479e-7
Identity = 33/106 (31.13%), Postives = 50/106 (47.17%), Query Frame = 1
Query:  490 TTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIK----------EENNKPSRPNNAAIIKAGPPPPVTAAKPKINV 777
            +++TK VV+   +Y     DEL L  GD + V  K  +  GWW+G   NG  G FP N+VE ++          E  N  +    A I+   PPP + A++    +
Sbjct:    2 SSKTKAVVKF--TYEPRLEDELGLTKGDFVYVVEKSTD--GWWKGEAPNGGVGWFPSNYVEEVEASTNGNQGSIENRNPAAAAVPAPIMMQAPPPKLQASRSSFEI 103          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Celegans
Match: nck-1 (NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family [Source:UniProtKB/TrEMBL;Acc:Q95PX0])

HSP 1 Score: 60.4622 bits (145), Expect = 9.340e-10
Identity = 48/201 (23.88%), Postives = 82/201 (40.80%), Query Frame = 1
Query:   82 LIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGIL-RGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDV-VIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI 678
            +++F Y+    DEL + KGD +  V    DGW  G    G  G FPSN+ + V+     +Q         E RN         ++ Q PPPK                                      LQ  +   ++    VV  ++S+ A +S+EL+ + G+ + + +  + D  WW  R ++G +G+ P N++E +
Sbjct:    8 VVKFTYEPRLEDELGLTKGDFVYVVEKSTDGWWKGEAPNGGVGWFPSNYVEEVEASTNGNQ------GSIENRNPAAAAVPAPIMMQAPPPK--------------------------------------LQASR---SSFEIQVVVALYSFDASSSEELSFKKGERLEIVDHPEHDPDWWMARNASGTTGLVPRNYIEVV 161          

HSP 2 Score: 53.1434 bits (126), Expect = 2.479e-7
Identity = 33/106 (31.13%), Postives = 50/106 (47.17%), Query Frame = 1
Query:  490 TTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIK----------EENNKPSRPNNAAIIKAGPPPPVTAAKPKINV 777
            +++TK VV+   +Y     DEL L  GD + V  K  +  GWW+G   NG  G FP N+VE ++          E  N  +    A I+   PPP + A++    +
Sbjct:    2 SSKTKAVVKF--TYEPRLEDELGLTKGDFVYVVEKSTD--GWWKGEAPNGGVGWFPSNYVEEVEASTNGNQGSIENRNPAAAAVPAPIMMQAPPPKLQASRSSFEI 103          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Celegans
Match: cdap-2 (CD2AP homolog [Source:UniProtKB/TrEMBL;Acc:Q6A573])

HSP 1 Score: 62.003 bits (149), Expect = 9.720e-10
Identity = 31/66 (46.97%), Postives = 45/66 (68.18%), Query Frame = 1
Query:  487 ETTRTKDVVRVIHSYTAENSDELTL-EIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIK 681
            ETT+TK++ RV   Y  ++ DEL L EI  +I +TNK   D GW+ G + +G+ G+FPDNFVE ++
Sbjct:  187 ETTKTKEMARVKFVYNPQHDDELALKEIDMLINITNKNCGDAGWFEG-ELHGKKGLFPDNFVELVQ 251          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Fly
Match: cindr (gene:FBgn0027598 transcript:FBtr0085704)

HSP 1 Score: 87.8113 bits (216), Expect = 1.682e-17
Identity = 63/205 (30.73%), Postives = 91/205 (44.39%), Query Frame = 1
Query:   70 DMDYLIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILR--GKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI 678
            ++  ++E++Y A E DEL + KG II+ ++    GW  G L+  G  G+FP NF +                               V+E       V+  G G   SG  I++ T  +               L++K      R K    VI+SYT  N DELTL +GD+I      + +EGWWRGR  + + GVFP NFV+ I
Sbjct:    4 NICAIVEYEYAAKEPDELDLQKGAIIHRIKQMPGGWWQGTLKASGVTGMFPDNFVR-------------------------------VLE-----SGVSSNGNGTTGSGDHIEVGTAVQ---------------LRDKSATSNRRCK----VIYSYTQVNDDELTLAVGDVIEFLG--EVEEGWWRGRLRS-KVGVFPSNFVQHI 150          

HSP 2 Score: 59.3066 bits (142), Expect = 1.137e-8
Identity = 27/59 (45.76%), Postives = 39/59 (66.10%), Query Frame = 1
Query:  502 KDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI 678
            ++  RV   Y  +N DEL L++ DII V + E  D+GWW+G +  G+ GVFPDNFV+ +
Sbjct:  255 REFCRVEFPYAPQNDDELELKVDDIIAVISTELPDKGWWKG-EIRGKVGVFPDNFVKML 312          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Fly
Match: cindr (gene:FBgn0027598 transcript:FBtr0310424)

HSP 1 Score: 87.4261 bits (215), Expect = 2.271e-17
Identity = 63/205 (30.73%), Postives = 91/205 (44.39%), Query Frame = 1
Query:   70 DMDYLIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILR--GKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI 678
            ++  ++E++Y A E DEL + KG II+ ++    GW  G L+  G  G+FP NF +                               V+E       V+  G G   SG  I++ T  +               L++K      R K    VI+SYT  N DELTL +GD+I      + +EGWWRGR  + + GVFP NFV+ I
Sbjct:    4 NICAIVEYEYAAKEPDELDLQKGAIIHRIKQMPGGWWQGTLKASGVTGMFPDNFVR-------------------------------VLES-----GVSSNGNGTTGSGDHIEVGTAVQ---------------LRDKSATSNRRCK----VIYSYTQVNDDELTLAVGDVIEFLG--EVEEGWWRGRLRS-KVGVFPSNFVQHI 150          

HSP 2 Score: 59.3066 bits (142), Expect = 1.213e-8
Identity = 27/59 (45.76%), Postives = 39/59 (66.10%), Query Frame = 1
Query:  502 KDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI 678
            ++  RV   Y  +N DEL L++ DII V + E  D+GWW+G +  G+ GVFPDNFV+ +
Sbjct:  255 REFCRVEFPYAPQNDDELELKVDDIIAVISTELPDKGWWKG-EIRGKVGVFPDNFVKML 312          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Fly
Match: drk (gene:FBgn0004638 transcript:FBtr0087695)

HSP 1 Score: 60.4622 bits (145), Expect = 5.477e-10
Identity = 55/221 (24.89%), Postives = 96/221 (43.44%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSVRPHEDG-WMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVI---EQTPPPKKVT-----GVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDV-----------VRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEP 675
            M+ + + D+ A   DEL+  K  I+  +   +D  W    L GKEG+ PSN+ +    D    +   +    AE+  +N  E   +I   E +P    ++     GV    +    + K           V+      E+++  +    +R++DV           V+ ++ +  + S EL    GD+ITVT++ DE+  WW G   N + G+FP  +V P
Sbjct:    1 MEAIAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHDWYYGR---ITRADAEKLLSNKHEGAFLIRISESSPGDFSLSVKCPDGVQHFKVLRDAQSKFFLW-------VVKFNSLNELVEYHRTASVSRSQDVKLRDMIPEEMLVQALYDFVPQESGELDFRRGDVITVTDRSDEN--WWNGEIGN-RKGIFPATYVTP 208          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Fly
Match: drk (gene:FBgn0004638 transcript:FBtr0087694)

HSP 1 Score: 60.4622 bits (145), Expect = 5.477e-10
Identity = 55/221 (24.89%), Postives = 96/221 (43.44%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSVRPHEDG-WMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVI---EQTPPPKKVT-----GVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDV-----------VRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEP 675
            M+ + + D+ A   DEL+  K  I+  +   +D  W    L GKEG+ PSN+ +    D    +   +    AE+  +N  E   +I   E +P    ++     GV    +    + K           V+      E+++  +    +R++DV           V+ ++ +  + S EL    GD+ITVT++ DE+  WW G   N + G+FP  +V P
Sbjct:    1 MEAIAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHDWYYGR---ITRADAEKLLSNKHEGAFLIRISESSPGDFSLSVKCPDGVQHFKVLRDAQSKFFLW-------VVKFNSLNELVEYHRTASVSRSQDVKLRDMIPEEMLVQALYDFVPQESGELDFRRGDVITVTDRSDEN--WWNGEIGN-RKGIFPATYVTP 208          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Fly
Match: drk (gene:FBgn0004638 transcript:FBtr0087698)

HSP 1 Score: 60.4622 bits (145), Expect = 5.477e-10
Identity = 55/221 (24.89%), Postives = 96/221 (43.44%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSVRPHEDG-WMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVI---EQTPPPKKVT-----GVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDV-----------VRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEP 675
            M+ + + D+ A   DEL+  K  I+  +   +D  W    L GKEG+ PSN+ +    D    +   +    AE+  +N  E   +I   E +P    ++     GV    +    + K           V+      E+++  +    +R++DV           V+ ++ +  + S EL    GD+ITVT++ DE+  WW G   N + G+FP  +V P
Sbjct:    1 MEAIAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHDWYYGR---ITRADAEKLLSNKHEGAFLIRISESSPGDFSLSVKCPDGVQHFKVLRDAQSKFFLW-------VVKFNSLNELVEYHRTASVSRSQDVKLRDMIPEEMLVQALYDFVPQESGELDFRRGDVITVTDRSDEN--WWNGEIGN-RKGIFPATYVTP 208          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Zebrafish
Match: cd2ap (CD2-associated protein [Source:ZFIN;Acc:ZDB-GENE-030131-8078])

HSP 1 Score: 107.842 bits (268), Expect = 7.074e-24
Identity = 74/224 (33.04%), Postives = 116/224 (51.79%), Query Frame = 1
Query:   85 IEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTK------ENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNK---DNKPKV------ISEEVKPEILQ-------EKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEEN 690
            + F+Y     DEL +  G+II      E+GW  G + GK G+FPSNF K +  D  +  E++ +  + + R+  +        N V+ +    PKK+ G+GFG+IF  G +KL+T+ K   +N  K       +    KP  L        EK+ +   + K+  +    Y A N DEL L+ G++I + +K+  + GWWRG + NG+ GVFPDNFV  + E +
Sbjct:  130 VLFEYVPQNEDELELKVGEIIEITEEVEEGWWSGSMNGKSGLFPSNFVKEI--DSTEDAENSDVTEEQDTRDGTSSPTSPHPGNGVMAQ----PKKIKGIGFGDIFREGSVKLRTSLKGPSENMEKTEKPIPPLPSATKPTPLSTPEHPKGEKEAESKAKVKEYCKATFHYEATNQDELDLKEGEVILILSKDTGEPGWWRG-EVNGKQGVFPDNFVSLLPESD 346          

HSP 2 Score: 77.7962 bits (190), Expect = 1.946e-14
Identity = 63/197 (31.98%), Postives = 97/197 (49.24%), Query Frame = 1
Query:  115 DELTIHKGDIINSVRP-HEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTG--------VGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI 678
            DELT+  GDII +VR   E+GWM G L GK G+FP NF K V++D           P+++E +   KE   V E++   ++ +G        +    I +GG I L+  +                  + +  +    K   +V+  Y  +N DEL L++G+   +   E+ +EGWW G   NG+SG+FP NFV+ I
Sbjct:   16 DELTLRLGDIIKNVRRIEEEGWMEGDLNGKRGLFPDNFVKEVRKDE----------PKSKEESKEPKEAKEVKEESTIQRRASGNVASLVQRISTYGIPAGG-IGLQPHS------------------QPRASKKKLKKRQCKVLFEYVPQNEDELELKVGE--IIEITEEVEEGWWSG-SMNGKSGLFPSNFVKEI 180          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Zebrafish
Match: CR936282.1 (SH3-domain kinase binding protein 1 [Source:NCBI gene;Acc:793623])

HSP 1 Score: 106.686 bits (265), Expect = 1.507e-23
Identity = 80/256 (31.25%), Postives = 113/256 (44.14%), Query Frame = 1
Query:   91 FDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKEND----------------VVIEQTPPPKKVTGVG---------------------------------------FGNIFSGGEIKLK-----TTNKDNKPKVISEEVKPEILQEKKPKE---TTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFV 669
            F Y     DEL +  GD+I+ +   E+GW  G+LRGK G+FPSNF K V  +     ED  + PQ + R+  T  N                    + + PP K    G                                       FG+IF    IKL+       N+  KP+++ ++  P I QE    E     + K+  +VI  Y A+N DEL+++ GDI+T+ NK+  D GWW G + NG+ GVFPDNFV
Sbjct:   79 FSYTPQNEDELELKIGDVIDVLGEVEEGWWEGVLRGKTGMFPSNFTKEVLAE----VED--LTPQDDTRSTRTTLNSGQTYSNSPAVYKAACKSPCKCSDPPVKCVCAGIKDSTGSESDGGDSSSLRSDTGSVSSSSEIQPKKVRGFGFGDIFKDQPIKLRPRSVDMDNEAEKPQMV-KKATPAIGQETMKAEHENKAKAKEFCKVIFPYEAQNEDELSIKEGDIVTIINKDCADAGWWLG-ELNGKKGVFPDNFV 326          

HSP 2 Score: 54.6842 bits (130), Expect = 3.385e-7
Identity = 33/109 (30.28%), Postives = 50/109 (45.87%), Query Frame = 1
Query:  502 KDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEE-----------------NNKPSRPNNAAIIKAGPPPPVTAAKPKINV 777
            K   +   SYT +N DEL L+IGD+I V    + +EGWW G    G++G+FP NF + +  E                 N+  +  N+ A+ KA    P   + P +  
Sbjct:   72 KRRCKAAFSYTPQNEDELELKIGDVIDVLG--EVEEGWWEG-VLRGKTGMFPSNFTKEVLAEVEDLTPQDDTRSTRTTLNSGQTYSNSPAVYKAACKSPCKCSDPPVKC 177          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Zebrafish
Match: sh3kbp1 (SH3-domain kinase binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-091204-186])

HSP 1 Score: 105.916 bits (263), Expect = 3.006e-23
Identity = 80/256 (31.25%), Postives = 113/256 (44.14%), Query Frame = 1
Query:   91 FDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKEND----------------VVIEQTPPPKKVTGVG---------------------------------------FGNIFSGGEIKLK-----TTNKDNKPKVISEEVKPEILQEKKPKE---TTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFV 669
            F Y     DEL +  GD+I+ +   E+GW  G+LRGK G+FPSNF K V  +     ED  + PQ + R+  T  N                    + + PP K    G                                       FG+IF    IKL+       N+  KP+++ ++  P I QE    E     + K+  +VI  Y A+N DEL+++ GDI+T+ NK+  D GWW G + NG+ GVFPDNFV
Sbjct:  107 FSYTPQNEDELELKIGDVIDVLGEVEEGWWEGVLRGKTGMFPSNFTKEVLAE----VED--LTPQDDTRSTRTTLNSGQTYSNSPAVYKAACKSPCKCSDPPVKCVCAGIKDSTGSESDGGDSSSLRSDTGSVSSSSEIQPKKVRGFGFGDIFKDQPIKLRPRSVDMDNEAEKPQMV-KKATPAIGQETMKAEHENKAKAKEFCKVIFPYEAQNEDELSIKEGDIVTIINKDCADAGWWLG-ELNGKKGVFPDNFV 354          

HSP 2 Score: 61.6178 bits (148), Expect = 2.196e-9
Identity = 25/51 (49.02%), Postives = 35/51 (68.63%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNF 225
            ++ ++EFDY +   DELTI  GDII+++R  E GW  G L G+ G+FP NF
Sbjct:    1 VEAIVEFDYQSQHDDELTIAVGDIISNIRKDEGGWWEGELDGRRGLFPDNF 51          

HSP 3 Score: 54.6842 bits (130), Expect = 3.694e-7
Identity = 32/106 (30.19%), Postives = 49/106 (46.23%), Query Frame = 1
Query:  511 VRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEE-----------------NNKPSRPNNAAIIKAGPPPPVTAAKPKINV 777
             +   SYT +N DEL L+IGD+I V    + +EGWW G    G++G+FP NF + +  E                 N+  +  N+ A+ KA    P   + P +  
Sbjct:  103 CKAAFSYTPQNEDELELKIGDVIDVLG--EVEEGWWEG-VLRGKTGMFPSNFTKEVLAEVEDLTPQDDTRSTRTTLNSGQTYSNSPAVYKAACKSPCKCSDPPVKC 205          

HSP 4 Score: 51.9878 bits (123), Expect = 2.223e-6
Identity = 24/54 (44.44%), Postives = 36/54 (66.67%), Query Frame = 1
Query:  517 VIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI 678
            V   Y +++ DELT+ +GDII+  N   ++ GWW G + +G+ G+FPDNFV  I
Sbjct:    5 VEFDYQSQHDDELTIAVGDIIS--NIRKDEGGWWEG-ELDGRRGLFPDNFVREI 55          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Zebrafish
Match: sh3kbp1 (SH3-domain kinase binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-091204-186])

HSP 1 Score: 105.916 bits (263), Expect = 3.014e-23
Identity = 80/256 (31.25%), Postives = 113/256 (44.14%), Query Frame = 1
Query:   91 FDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVV----------------IEQTPPPKKVTGVG---------------------------------------FGNIFSGGEIKLK-----TTNKDNKPKVISEEVKPEILQEKKPKE---TTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFV 669
            F Y     DEL +  GD+I+ +   E+GW  G+LRGK G+FPSNF K V  +     ED  + PQ + R+  T  N                    + + PP K    G                                       FG+IF    IKL+       N+  KP+++ ++  P I QE    E     + K+  +VI  Y A+N DEL+++ GDI+T+ NK+  D GWW G + NG+ GVFPDNFV
Sbjct:  108 FSYTPQNEDELELKIGDVIDVLGEVEEGWWEGVLRGKTGMFPSNFTKEVLAE----VED--LTPQDDTRSTRTTLNSGQTYSNSPAVYKAACKSPCKCSDPPVKCVCAGIKDSTGSESDGGDSSSLRSDTGSVSSSSEIQPKKVRGFGFGDIFKDQPIKLRPRSVDMDNEAEKPQMV-KKATPAIGQETMKAEHENKAKAKEFCKVIFPYEAQNEDELSIKEGDIVTIINKDCADAGWWLG-ELNGKKGVFPDNFV 355          

HSP 2 Score: 61.6178 bits (148), Expect = 2.315e-9
Identity = 25/51 (49.02%), Postives = 35/51 (68.63%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNF 225
            ++ ++EFDY +   DELTI  GDII+++R  E GW  G L G+ G+FP NF
Sbjct:    2 VEAIVEFDYQSQHDDELTIAVGDIISNIRKDEGGWWEGELDGRRGLFPDNF 52          

HSP 3 Score: 54.6842 bits (130), Expect = 3.729e-7
Identity = 32/106 (30.19%), Postives = 49/106 (46.23%), Query Frame = 1
Query:  511 VRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEE-----------------NNKPSRPNNAAIIKAGPPPPVTAAKPKINV 777
             +   SYT +N DEL L+IGD+I V    + +EGWW G    G++G+FP NF + +  E                 N+  +  N+ A+ KA    P   + P +  
Sbjct:  104 CKAAFSYTPQNEDELELKIGDVIDVLG--EVEEGWWEG-VLRGKTGMFPSNFTKEVLAEVEDLTPQDDTRSTRTTLNSGQTYSNSPAVYKAACKSPCKCSDPPVKC 206          

HSP 4 Score: 51.9878 bits (123), Expect = 2.244e-6
Identity = 24/54 (44.44%), Postives = 36/54 (66.67%), Query Frame = 1
Query:  517 VIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI 678
            V   Y +++ DELT+ +GDII+  N   ++ GWW G + +G+ G+FPDNFV  I
Sbjct:    6 VEFDYQSQHDDELTIAVGDIIS--NIRKDEGGWWEG-ELDGRRGLFPDNFVREI 56          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Zebrafish
Match: sh3d21 (SH3 domain containing 21 [Source:ZFIN;Acc:ZDB-GENE-051120-57])

HSP 1 Score: 102.064 bits (253), Expect = 1.526e-22
Identity = 78/249 (31.33%), Postives = 120/249 (48.19%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSV-RPHEDGWMYGILRGKEGVFPSNFGK--PVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFG----------------------NIFSGGEIK-LKTTNKDN---KPKVISEEVKPEILQEKKP---KETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENNKPSRPNNAAI 723
            M+ L+   ++A   DELT+H GDI+ +V +  E+GW+ G LRGK G+FP NF K  PV      ++E    I + ++    T++ +VV    P  +    +  G                        F    +K +   +KD+   +PK+       E   +++P   K+T+  K+  +V+  Y A   DEL L+ GD+ITV NK  ED+GWW G + NG+ G FPDNFV  I  E  +      A +
Sbjct:    1 MEVLVLLGFEATMPDELTVHVGDIVKNVSKAKEEGWLEGDLRGKRGMFPGNFVKEVPVYLIGDSNREPR-SIRKTKKTTVQTRKCEVVFPYVPTHEDELQLLVGETIEILREIEDGWWMGKKNNQIGAFPSNFVKEIFVPSKDDAKARPKLSGSVFGKEGKLQQRPSLRKKTSNVKECCQVMFDYAAVAEDELNLKKGDVITVINKSTEDDGWWEG-EVNGRRGFFPDNFVMLIPAETLQTGNAGQAPV 247          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Xenopus
Match: lrrc10 (leucine rich repeat containing 10 [Source:Xenbase;Acc:XB-GENE-5959561])

HSP 1 Score: 114.39 bits (285), Expect = 1.019e-25
Identity = 97/290 (33.45%), Postives = 140/290 (48.28%), Query Frame = 1
Query:   85 IEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVK-EDRRKSQED------NLIIPQAEERN---NNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPK-------ETTRT--------KDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI----KEENNKPSRPNNAAIIKAGPPP--------PVTAAKPKINVGKSIPPRPPQLLEKQAS--KPA 837
            + ++Y     DEL +  G++++ +   E+GW  G   GK G+FPSNF K +   D  +SQE       ++  P A   +   +     D     T  PKKV GVGFG+IF  G +KLKT     +P+V   E KP  +Q    K       + +RT        K++ + + +Y + N DEL+ + GDII +T+KE  D GWW+G + NG+ GVFPDNFV  I    KE + +  +P      K   P         P+   KP       +PP+ P L  K  S  KPA
Sbjct:  104 VLYEYIPQNEDELELKVGEVLDIIEEVEEGWWSGSNSGKSGLFPSNFVKEIDLSDDGESQESTEDSEPSVTTPIATPASPVLSPANGPDASPLATAQPKKVMGVGFGDIFKEGSVKLKTRLPAPEPEVKKPE-KPLPVQPSGTKVLRSTSSDASRTETDSKPKAKEICKALFNYESVNEDELSFKEGDIIHLTSKETGDPGWWKG-ELNGKEGVFPDNFVAIIQDSEKEVSLRAPKPELRIAEKKSTPTKTEEKDEKPLVDLKPPKPAAPQVPPKKPNLTSKSNSILKPA 391          

HSP 2 Score: 66.2402 bits (160), Expect = 1.248e-10
Identity = 29/54 (53.70%), Postives = 38/54 (70.37%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSV-RPHEDGWMYGILRGKEGVFPSNFGK 231
            M+Y++E+DYDA   DELTI  GD+I +V +  EDGW+ G + GK G FP NF K
Sbjct:    9 MEYIVEYDYDAVNEDELTIRVGDVIKNVNKLEEDGWLEGEVNGKRGAFPDNFVK 62          

HSP 3 Score: 54.299 bits (129), Expect = 6.121e-7
Identity = 27/51 (52.94%), Postives = 34/51 (66.67%), Query Frame = 1
Query:  517 VIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFV 669
            V + Y A N DELT+ +GD+I   NK +ED GW  G + NG+ G FPDNFV
Sbjct:   13 VEYDYDAVNEDELTIRVGDVIKNVNKLEED-GWLEG-EVNGKRGAFPDNFV 61          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Xenopus
Match: tmprss9 (transmembrane serine protease 9 [Source:Xenbase;Acc:XB-GENE-993973])

HSP 1 Score: 113.62 bits (283), Expect = 1.512e-25
Identity = 86/278 (30.94%), Postives = 135/278 (48.56%), Query Frame = 1
Query:   85 IEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKP-VKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQT-------PPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVI------SEEVKPEIL-QEKKPKET---TRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENNKPSRPNNAAIIKAGPPPPVTAAKPKINVGKSIPPRPPQLLEKQASKPANTVKDDGIS 864
            + F Y     DEL +  G+II  +   E+GW  G+L GK G+FPSNF +  V E    + E  +     +   + +   D  +E T          K++ G GFG+IF    IKL+  + + + +++       +++ P +  QE    ET   T+ K+  +V+  Y A N DELT+  GDI+TV +KE  D GWW G + NG+ GVFPDNFV+ +  +  K     N        P PV+    +    + IPP  P  L ++  +   + +D  +S
Sbjct:  141 VAFSYLPQNEDELELKVGEIIEVLGEVEEGWWEGVLNGKTGMFPSNFIREIVTETEIGNFEQQIKTAFKDTTGSESDGGDSKLEGTNGTSGGETQSKRIRGFGFGDIFKDKPIKLRPRSIEMESEIVPIEKAMGKKMPPTVTSQEPMKIETESKTKRKEYCKVLFPYEAMNEDELTIRDGDIVTVLSKECVDAGWWEG-ELNGKKGVFPDNFVKLLPSDFEKECPVGNFMC-----PCPVSGTSERKQDIRKIPPERPDTLPQRPDEKERSERDHKVS 412          

HSP 2 Score: 99.3673 bits (246), Expect = 5.761e-21
Identity = 63/205 (30.73%), Postives = 94/205 (45.85%), Query Frame = 1
Query:   76 DYLIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEEN 690
            D ++EFDY A   DELTI  GDII  ++  + GW  G L+G+ G+FP NF + +K+D +K Q              N+K         PP +   G+  GN     E  +++                        +     +   +V  SY  +N DEL L++G+II V    + +EGWW G   NG++G+FP NF+  I  E 
Sbjct:   39 DAIVEFDYKAQHEDELTITAGDIITKIKKEDGGWWEGELKGRRGLFPDNFVRELKKDTKKEQ--------------NSK---------PPDRPTQGISNGNALLSSEAVIRSAG----------------------RGERTRRRRCQVAFSYLPQNEDELELKVGEIIEVLG--EVEEGWWEG-VLNGKTGMFPSNFIREIVTET 195          

HSP 3 Score: 57.7658 bits (138), Expect = 5.986e-8
Identity = 33/69 (47.83%), Postives = 42/69 (60.87%), Query Frame = 1
Query:  529 YTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI-----KEENNK-PSRPNNA 717
            Y A++ DELT+  GDIIT   KED   GWW G +  G+ G+FPDNFV  +     KE+N+K P RP   
Sbjct:   46 YKAQHEDELTITAGDIITKIKKEDG--GWWEG-ELKGRRGLFPDNFVRELKKDTKKEQNSKPPDRPTQG 111          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Xenopus
Match: lrrc10 (leucine rich repeat containing 10 [Source:Xenbase;Acc:XB-GENE-5959561])

HSP 1 Score: 110.538 bits (275), Expect = 1.736e-25
Identity = 80/225 (35.56%), Postives = 119/225 (52.89%), Query Frame = 1
Query:   85 IEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVK-EDRRKSQED------NLIIPQAEERN---NNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPK-------ETTRT--------KDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKE 684
            + ++Y     DEL +  G++++ +   E+GW  G   GK G+FPSNF K +   D  +SQE       ++  P A   +   +     D     T  PKKV GVGFG+IF  G +KLKT     +P+V   E KP  +Q    K       + +RT        K++ + + +Y + N DEL+ + GDII +T+KE  D GWW+G + NG+ GVFPDNFV  I++
Sbjct:  112 VLYEYIPQNEDELELKVGEVLDIIEEVEEGWWSGSNSGKSGLFPSNFVKEIDLSDDGESQESTEDSEPSVTTPIATPASPVLSPANGPDASPLATAQPKKVMGVGFGDIFKEGSVKLKTRLPAPEPEVKKPE-KPLPVQPSGTKVLRSTSSDASRTETDSKPKAKEICKALFNYESVNEDELSFKEGDIIHLTSKETGDPGWWKG-ELNGKEGVFPDNFVAIIQD 334          

HSP 2 Score: 99.3673 bits (246), Expect = 7.536e-22
Identity = 66/203 (32.51%), Postives = 103/203 (50.74%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSV-RPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI 678
            ++Y++E+DYDA   DELTI  GD+I +V +  EDGW+ G + GK G FP NF K +KE            P+A + +N   ++    E     K+                L+ TN    P+ +++E K               K   +V++ Y  +N DEL L++G+++ +   E+ +EGWW G  S G+SG+FP NFV+ I
Sbjct:    1 VEYIVEYDYDAVNEDELTIRVGDVIKNVNKLEEDGWLEGEVNGKRGAFPDNFVKEIKEHPG---------PKAAKVSNCRNKSGGCTELVACIKRYL--------------LRATNPPRLPRPLNKESK---------------KRQCKVLYEYIPQNEDELELKVGEVLDII--EEVEEGWWSGSNS-GKSGLFPSNFVKEI 162          

HSP 3 Score: 60.8474 bits (146), Expect = 3.752e-9
Identity = 40/105 (38.10%), Postives = 58/105 (55.24%), Query Frame = 1
Query:  517 VIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENNKPSRPNNAAIIKAGPPPPVTAAKPKINVGKSIPPRPPQLLEKQASK 831
            V + Y A N DELT+ +GD+I   NK +ED GW  G + NG+ G FPDNFV+ IKE     +   +    K+G    + A   +  +  + PPR P+ L K++ K
Sbjct:    5 VEYDYDAVNEDELTIRVGDVIKNVNKLEED-GWLEG-EVNGKRGAFPDNFVKEIKEHPGPKAAKVSNCRNKSGGCTELVACIKRYLLRATNPPRLPRPLNKESKK 107          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Xenopus
Match: tmprss9 (transmembrane serine protease 9 [Source:Xenbase;Acc:XB-GENE-993973])

HSP 1 Score: 109.383 bits (272), Expect = 2.290e-24
Identity = 74/213 (34.74%), Postives = 111/213 (52.11%), Query Frame = 1
Query:   85 IEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKP-VKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQT-------PPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVI------SEEVKPEIL-QEKKPKET---TRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFV 669
            + F Y     DEL +  G+II  +   E+GW  G+L GK G+FPSNF +  V E    + E  +     +   + +   D  +E T          K++ G GFG+IF    IKL+  + + + +++       +++ P +  QE    ET   T+ K+  +V+  Y A N DELT+  GDI+TV +KE  D GWW G + NG+ GVFPDNFV
Sbjct:   43 VAFSYLPQNEDELELKVGEIIEVLGEVEEGWWEGVLNGKTGMFPSNFIREIVTETEIGNFEQQIKTAFKDTTGSESDGGDSKLEGTNGTSGGETQSKRIRGFGFGDIFKDKPIKLRPRSIEMESEIVPIEKAMGKKMPPTVTSQEPMKIETESKTKRKEYCKVLFPYEAMNEDELTIRDGDIVTVLSKECVDAGWWEG-ELNGKKGVFPDNFV 254          

HSP 2 Score: 54.299 bits (129), Expect = 5.480e-7
Identity = 29/76 (38.16%), Postives = 45/76 (59.21%), Query Frame = 1
Query:  463 ILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEEN 690
            +L  ++ + T R +   +V  SY  +N DEL L++G+II V    + +EGWW G   NG++G+FP NF+  I  E 
Sbjct:   27 VLYSEQGERTRRRR--CQVAFSYLPQNEDELELKVGEIIEVLG--EVEEGWWEG-VLNGKTGMFPSNFIREIVTET 97          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Xenopus
Match: tmprss9 (transmembrane serine protease 9 [Source:Xenbase;Acc:XB-GENE-993973])

HSP 1 Score: 108.612 bits (270), Expect = 6.202e-24
Identity = 76/220 (34.55%), Postives = 113/220 (51.36%), Query Frame = 1
Query:   85 IEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKE-------DRRKSQEDNLIIP-QAEERNNNTKENDVVIEQT-------PPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVI------SEEVKPEIL-QEKKPKET---TRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFV 669
            + F Y     DEL +  G+II  +   E+GW  G+L GK G+FPSNF + +         D     E +LI   Q +   + +   D  +E T          K++ G GFG+IF    IKL+  + + + +++       +++ P +  QE    ET   T+ K+  +V+  Y A N DELT+  GDI+TV +KE  D GWW G + NG+ GVFPDNFV
Sbjct:  107 VAFSYLPQNEDELELKVGEIIEVLGEVEEGWWEGVLNGKTGMFPSNFIREIVTETEIGNFDLSSFLELSLIFHLQNDTTGSESDGGDSKLEGTNGTSGGETQSKRIRGFGFGDIFKDKPIKLRPRSIEMESEIVPIEKAMGKKMPPTVTSQEPMKIETESKTKRKEYCKVLFPYEAMNEDELTIRDGDIVTVLSKECVDAGWWEG-ELNGKKGVFPDNFV 325          

HSP 2 Score: 94.3597 bits (233), Expect = 1.727e-19
Identity = 62/209 (29.67%), Postives = 92/209 (44.02%), Query Frame = 1
Query:   64 IFDMDYLIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEEN 690
            +     L  FDY A   DELTI  GDII  ++  + GW  G L+G+ G+FP NF + +K+D +K Q              N+K         PP +   G+  GN     E  +++                        +     +   +V  SY  +N DEL L++G+II V    + +EGWW G   NG++G+FP NF+  I  E 
Sbjct:    1 MIRFQLLENFDYKAQHEDELTITAGDIITKIKKEDGGWWEGELKGRRGLFPDNFVRELKKDTKKEQ--------------NSK---------PPDRPTQGISNGNALLSSEAVIRSAG----------------------RGERTRRRRCQVAFSYLPQNEDELELKVGEIIEVLG--EVEEGWWEG-VLNGKTGMFPSNFIREIVTET 161          

HSP 3 Score: 57.7658 bits (138), Expect = 4.751e-8
Identity = 33/69 (47.83%), Postives = 42/69 (60.87%), Query Frame = 1
Query:  529 YTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI-----KEENNK-PSRPNNA 717
            Y A++ DELT+  GDIIT   KED   GWW G +  G+ G+FPDNFV  +     KE+N+K P RP   
Sbjct:   12 YKAQHEDELTITAGDIITKIKKEDG--GWWEG-ELKGRRGLFPDNFVRELKKDTKKEQNSKPPDRPTQG 77          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Mouse
Match: Sh3kbp1 (SH3-domain kinase binding protein 1 [Source:MGI Symbol;Acc:MGI:1889583])

HSP 1 Score: 122.865 bits (307), Expect = 1.991e-29
Identity = 101/280 (36.07%), Postives = 136/280 (48.57%), Query Frame = 1
Query:   85 IEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNT--------------------KENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLK----TTNKDNKP--KVISEEVKPEILQEKKPKET-----TRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI-----KEENNKPSRPNNAA-IIKAGPPPPVTAAKPKINVGKSIPPRPPQLL 813
            + F Y     DEL +  GDII  V   E+GW  G+L GK G+FPSNF K +       + D L I Q E+ + ++                      N  +      PKKV GVGFG+IF    IKL+        D  P  K I +++ P       P +T     T+TKD  +VI  Y A+N DELT++ GDI+T+ NK+  D GWW G + NG+ GVFPDNFV+ +     KE N     P  +A ++K G     T  K +I   K IPP  P+ L
Sbjct:   68 VAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELS-----GESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKSEGANGTMATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPVEKTIGKKLPPAT-STPDPSKTEMDSRTKTKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEG-ELNGRRGVFPDNFVKLLPSDFDKEGNRPKKPPPPSAPVVKQG--AGTTERKHEI---KKIPPERPETL 335          

HSP 2 Score: 56.225 bits (134), Expect = 8.214e-8
Identity = 26/62 (41.94%), Postives = 41/62 (66.13%), Query Frame = 1
Query:  511 VRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENNK 696
             +V  SY  +N DEL L++GDII V    + +EGWW G   NG++G+FP NF++ +  E+++
Sbjct:   66 CQVAFSYLPQNDDELELKVGDIIEVVG--EVEEGWWEG-VLNGKTGMFPSNFIKELSGESDE 124          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Mouse
Match: Sh3kbp1 (SH3-domain kinase binding protein 1 [Source:MGI Symbol;Acc:MGI:1889583])

HSP 1 Score: 124.02 bits (310), Expect = 4.066e-29
Identity = 101/280 (36.07%), Postives = 136/280 (48.57%), Query Frame = 1
Query:   85 IEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNT--------------------KENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLK----TTNKDNKP--KVISEEVKPEILQEKKPKET-----TRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI-----KEENNKPSRPNNAA-IIKAGPPPPVTAAKPKINVGKSIPPRPPQLL 813
            + F Y     DEL +  GDII  V   E+GW  G+L GK G+FPSNF K +       + D L I Q E+ + ++                      N  +      PKKV GVGFG+IF    IKL+        D  P  K I +++ P       P +T     T+TKD  +VI  Y A+N DELT++ GDI+T+ NK+  D GWW G + NG+ GVFPDNFV+ +     KE N     P  +A ++K G     T  K +I   K IPP  P+ L
Sbjct:   68 VAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELS-----GESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKSEGANGTMATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPVEKTIGKKLPPAT-STPDPSKTEMDSRTKTKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEG-ELNGRRGVFPDNFVKLLPSDFDKEGNRPKKPPPPSAPVVKQG--AGTTERKHEI---KKIPPERPETL 335          

HSP 2 Score: 56.9954 bits (136), Expect = 6.806e-8
Identity = 26/61 (42.62%), Postives = 40/61 (65.57%), Query Frame = 1
Query:  511 VRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENN 693
             +V  SY  +N DEL L++GDII V    + +EGWW G   NG++G+FP NF++ +  E++
Sbjct:   66 CQVAFSYLPQNDDELELKVGDIIEVVG--EVEEGWWEG-VLNGKTGMFPSNFIKELSGESD 123          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Mouse
Match: Sh3kbp1 (SH3-domain kinase binding protein 1 [Source:MGI Symbol;Acc:MGI:1889583])

HSP 1 Score: 124.02 bits (310), Expect = 5.978e-29
Identity = 101/280 (36.07%), Postives = 136/280 (48.57%), Query Frame = 1
Query:   85 IEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNT--------------------KENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLK----TTNKDNKP--KVISEEVKPEILQEKKPKET-----TRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI-----KEENNKPSRPNNAA-IIKAGPPPPVTAAKPKINVGKSIPPRPPQLL 813
            + F Y     DEL +  GDII  V   E+GW  G+L GK G+FPSNF K +       + D L I Q E+ + ++                      N  +      PKKV GVGFG+IF    IKL+        D  P  K I +++ P       P +T     T+TKD  +VI  Y A+N DELT++ GDI+T+ NK+  D GWW G + NG+ GVFPDNFV+ +     KE N     P  +A ++K G     T  K +I   K IPP  P+ L
Sbjct:  105 VAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELS-----GESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKSEGANGTMATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPVEKTIGKKLPPAT-STPDPSKTEMDSRTKTKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEG-ELNGRRGVFPDNFVKLLPSDFDKEGNRPKKPPPPSAPVVKQG--AGTTERKHEI---KKIPPERPETL 372          

HSP 2 Score: 97.4413 bits (241), Expect = 1.527e-20
Identity = 61/207 (29.47%), Postives = 96/207 (46.38%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENN 693
            ++ ++EFDY A   DELTI  G++I ++R  + GW  G + G+ G+FP NF + +K+D +K                       ++    P K +  V  GN     E  L+T                        K   R +   +V  SY  +N DEL L++GDII V    + +EGWW G   NG++G+FP NF++ +  E++
Sbjct:    2 VEAIVEFDYQAQHDDELTISVGEVITNIRKEDGGWWEGQINGRRGLFPDNFVREIKKDMKKD----------------------LLSNKAPEKPMHDVSSGNALLSSETILRTN-----------------------KRGERRRRRCQVAFSYLPQNDDELELKVGDIIEVVG--EVEEGWWEG-VLNGKTGMFPSNFIKELSGESD 160          

HSP 3 Score: 60.4622 bits (145), Expect = 5.837e-9
Identity = 30/63 (47.62%), Postives = 41/63 (65.08%), Query Frame = 1
Query:  529 YTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENNKPSRPNNA 717
            Y A++ DELT+ +G++IT  N   ED GWW G + NG+ G+FPDNFV  IK++  K    N A
Sbjct:   10 YQAQHDDELTISVGEVIT--NIRKEDGGWWEG-QINGRRGLFPDNFVREIKKDMKKDLLSNKA 69          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Mouse
Match: Cd2ap (CD2-associated protein [Source:MGI Symbol;Acc:MGI:1330281])

HSP 1 Score: 115.546 bits (288), Expect = 1.512e-26
Identity = 84/235 (35.74%), Postives = 115/235 (48.94%), Query Frame = 1
Query:   85 IEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDV-VIEQTPP-----------------PKKVTGVGFGNIFSGGEIKLKTTN--------KDNKPKVIS---------EEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKE 684
            + FDY     DEL +  GD+I+ +   E+GW  G L  K G+FPSNF   VKE   +S ED        E +N  +E++V +   T P                 PKK+ G+GFG+IF  G +KL+T          K  KP ++          E  KP++  + K KE  RT      +  YT  N DELT   G+II + +KE  + GWW+G + NG+ GVFPDNF   I E
Sbjct:   10 VLFDYSPQNEDELELIVGDVIDVIEEVEEGWWSGTLNNKLGLFPSNF---VKE--LESTEDG-------ETHNAQEESEVPLTGPTSPLPSPGNGSEPAPGSVAQPKKIRGIGFGDIFKEGSVKLRTRTSSSETEEKKTEKPLILQPLGSRTQNVEVTKPDVDGKIKAKEYCRT------LFPYTGTNEDELTFREGEIIHLISKETGEAGWWKG-ELNGKEGVFPDNFAVQISE 225          

HSP 2 Score: 52.373 bits (124), Expect = 1.849e-6
Identity = 24/53 (45.28%), Postives = 35/53 (66.04%), Query Frame = 1
Query:  511 VRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFV 669
             +V+  Y+ +N DEL L +GD+I V   E+ +EGWW G  +N + G+FP NFV
Sbjct:    8 CKVLFDYSPQNEDELELIVGDVIDVI--EEVEEGWWSGTLNN-KLGLFPSNFV 57          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Mouse
Match: Cd2ap (CD2-associated protein [Source:MGI Symbol;Acc:MGI:1330281])

HSP 1 Score: 114.775 bits (286), Expect = 4.344e-26
Identity = 82/235 (34.89%), Postives = 114/235 (48.51%), Query Frame = 1
Query:   85 IEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDV-VIEQTPP-----------------PKKVTGVGFGNIFSGGEIKLKTTN--------KDNKPKVIS---------EEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKE 684
            + FDY     DEL +  GD+I+ +   E+GW  G L  K G+FPSNF K +     +S ED        E +N  +E++V +   T P                 PKK+ G+GFG+IF  G +KL+T          K  KP ++          E  KP++  + K KE  RT      +  YT  N DELT   G+II + +KE  + GWW+G + NG+ GVFPDNF   I E
Sbjct:  115 VLFDYSPQNEDELELIVGDVIDVIEEVEEGWWSGTLNNKLGLFPSNFVKEL-----ESTEDG-------ETHNAQEESEVPLTGPTSPLPSPGNGSEPAPGSVAQPKKIRGIGFGDIFKEGSVKLRTRTSSSETEEKKTEKPLILQPLGSRTQNVEVTKPDVDGKIKAKEYCRT------LFPYTGTNEDELTFREGEIIHLISKETGEAGWWKG-ELNGKEGVFPDNFAVQISE 330          

HSP 2 Score: 92.4337 bits (228), Expect = 5.993e-19
Identity = 65/204 (31.86%), Postives = 103/204 (50.49%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSVRP-HEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIK 681
            +DY++E+DYDA   DELTI  G+II +V+   E+GW+ G L G+ G+FP NF   VKE +R+++  +  +P   ER  N                V  +    + +GG                   ++P    + K  +    K   +V+  Y+ +N DEL L +GD+I V   E+ +EGWW G  +N + G+FP NFV+ ++
Sbjct:    2 VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNF---VKEIKRETEPKDDNLPIKRERQGNVA------------SLVQRISTYGLPAGG-------------------IQPH--PQTKAIKKKTKKRQCKVLFDYSPQNEDELELIVGDVIDVI--EEVEEGWWSGTLNN-KLGLFPSNFVKELE 166          

HSP 3 Score: 51.6026 bits (122), Expect = 3.612e-6
Identity = 28/57 (49.12%), Postives = 37/57 (64.91%), Query Frame = 1
Query:  517 VIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEE 687
            V + Y A + DELT+ +G+II    K  E EGW  G + NG+ G+FPDNFV+ IK E
Sbjct:    6 VEYDYDAVHDDELTIRVGEIIRNVKKLQE-EGWLEG-ELNGRRGMFPDNFVKEIKRE 60          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q96B97|SH3K1_HUMAN (SH3 domain-containing kinase-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3KBP1 PE=1 SV=2)

HSP 1 Score: 124.02 bits (310), Expect = 3.790e-28
Identity = 99/282 (35.11%), Postives = 137/282 (48.58%), Query Frame = 1
Query:   85 IEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNT--------------------KENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKET-------------TRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI-----KEENNKPSRPNNAA-IIKAGPPPPVTAAKPKINVGKSIPPRPPQLL 813
            + F Y     DEL +  GDII  V   E+GW  G+L GK G+FPSNF K +       + D L I Q E+ + ++                      N  V      PKKV GVGFG+IF    IKL+  + + +   +  E   + + +K P  T             T++KD  +VI  Y A+N DELT++ GDI+T+ NK+  D GWW G + NG+ GVFPDNFV+ +     KE N     P  +A +IK G     T  K +I   K IPP  P++L
Sbjct:  105 VAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELS-----GESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKSEGANGTVATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPVE---KTIGKKLPATTATPDSSKTEMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEG-ELNGRRGVFPDNFVKLLPPDFEKEGNRPKKPPPPSAPVIKQG--AGTTERKHEI---KKIPPERPEML 372          

HSP 2 Score: 92.0485 bits (227), Expect = 5.244e-18
Identity = 62/208 (29.81%), Postives = 96/208 (46.15%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENNK 696
            ++ ++EFDY A   DELTI  G+II ++R  + GW  G + G+ G+FP NF + +K++ +K    N                        P K +  V  GN     E  L+T                        K   R +   +V  SY  +N DEL L++GDII V    + +EGWW G   NG++G+FP NF++ +  E+++
Sbjct:    2 VEAIVEFDYQAQHDDELTISVGEIITNIRKEDGGWWEGQINGRRGLFPDNFVREIKKEMKKDPLTN----------------------KAPEKPLHEVPSGNSLLSSETILRTN-----------------------KRGERRRRRCQVAFSYLPQNDDELELKVGDIIEVVG--EVEEGWWEG-VLNGKTGMFPSNFIKELSGESDE 161          

HSP 3 Score: 62.003 bits (149), Expect = 1.333e-8
Identity = 32/63 (50.79%), Postives = 41/63 (65.08%), Query Frame = 1
Query:  529 YTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENNKPSRPNNA 717
            Y A++ DELT+ +G+IIT  N   ED GWW G + NG+ G+FPDNFV  IK+E  K    N A
Sbjct:   10 YQAQHDDELTISVGEIIT--NIRKEDGGWWEG-QINGRRGLFPDNFVREIKKEMKKDPLTNKA 69          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q9Y5K6|CD2AP_HUMAN (CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 5.417e-26
Identity = 82/225 (36.44%), Postives = 118/225 (52.44%), Query Frame = 1
Query:   85 IEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVK----EDRRKSQEDNLII------PQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPE---ILQEKKPK----ETTRT--------KDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKE 684
            + F+Y     DEL +  GDII+     E+GW  G L  K G+FPSNF K ++     +  ++Q+D+  +      P     N +   +  V +    PKK+ G+GFG+IF  G +KL+T    ++    +EE KPE   ILQ   PK    E T+T        K+  R + +Y   N DELT + G+II + +KE  + GWWRG + NG+ GVFPDNF   I E
Sbjct:  115 VLFEYIPQNEDELELKVGDIIDINEEVEEGWWSGTLNNKLGLFPSNFVKELEVTDDGETHEAQDDSETVLAGPTSPIPSLGNVSETASGSVTQ----PKKIRGIGFGDIFKEGSVKLRTRTSSSE----TEEKKPEKPLILQSLGPKTQSVEITKTDTEGKIKAKEYCRTLFAYEGTNEDELTFKEGEIIHLISKETGEAGWWRG-ELNGKEGVFPDNFAVQINE 330          

HSP 2 Score: 97.0561 bits (240), Expect = 1.452e-19
Identity = 69/229 (30.13%), Postives = 118/229 (51.53%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSVRP-HEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENNKPSR--PNNAAIIKAGPPPPV 750
            +DY++E+DYDA   DELTI  G+II +V+   E+GW+ G L G+ G+FP NF   VKE +R+++  +  +P   ER+ N              ++++  G     +GG                   ++P    + K  +    K   +V+  Y  +N DEL L++GDII +   E+ +EGWW G  +N + G+FP NFV+ ++  ++  +    +++  + AGP  P+
Sbjct:    2 VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNF---VKEIKRETEFKDDSLPIKRERHGNV---------ASLVQRISTYGLP---AGG-------------------IQPH--PQTKNIKKKTKKRQCKVLFEYIPQNEDELELKVGDIIDIN--EEVEEGWWSGTLNN-KLGLFPSNFVKELEVTDDGETHEAQDDSETVLAGPTSPI 191          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q9JLQ0|CD2AP_MOUSE (CD2-associated protein OS=Mus musculus OX=10090 GN=Cd2ap PE=1 SV=3)

HSP 1 Score: 114.775 bits (286), Expect = 3.039e-25
Identity = 82/235 (34.89%), Postives = 114/235 (48.51%), Query Frame = 1
Query:   85 IEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDV-VIEQTPP-----------------PKKVTGVGFGNIFSGGEIKLKTTN--------KDNKPKVIS---------EEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKE 684
            + FDY     DEL +  GD+I+ +   E+GW  G L  K G+FPSNF K +     +S ED        E +N  +E++V +   T P                 PKK+ G+GFG+IF  G +KL+T          K  KP ++          E  KP++  + K KE  RT      +  YT  N DELT   G+II + +KE  + GWW+G + NG+ GVFPDNF   I E
Sbjct:  115 VLFDYSPQNEDELELIVGDVIDVIEEVEEGWWSGTLNNKLGLFPSNFVKEL-----ESTEDG-------ETHNAQEESEVPLTGPTSPLPSPGNGSEPAPGSVAQPKKIRGIGFGDIFKEGSVKLRTRTSSSETEEKKTEKPLILQPLGSRTQNVEVTKPDVDGKIKAKEYCRT------LFPYTGTNEDELTFREGEIIHLISKETGEAGWWKG-ELNGKEGVFPDNFAVQISE 330          

HSP 2 Score: 92.4337 bits (228), Expect = 4.192e-18
Identity = 65/204 (31.86%), Postives = 103/204 (50.49%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSVRP-HEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIK 681
            +DY++E+DYDA   DELTI  G+II +V+   E+GW+ G L G+ G+FP NF   VKE +R+++  +  +P   ER  N                V  +    + +GG                   ++P    + K  +    K   +V+  Y+ +N DEL L +GD+I V   E+ +EGWW G  +N + G+FP NFV+ ++
Sbjct:    2 VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNF---VKEIKRETEPKDDNLPIKRERQGNVA------------SLVQRISTYGLPAGG-------------------IQPH--PQTKAIKKKTKKRQCKVLFDYSPQNEDELELIVGDVIDVI--EEVEEGWWSGTLNN-KLGLFPSNFVKELE 166          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. UniProt/SwissProt
Match: sp|F1LRS8|CD2AP_RAT (CD2-associated protein OS=Rattus norvegicus OX=10116 GN=Cd2ap PE=1 SV=2)

HSP 1 Score: 114.005 bits (284), Expect = 5.859e-25
Identity = 79/226 (34.96%), Postives = 113/226 (50.00%), Query Frame = 1
Query:   85 IEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVK-------EDRRKSQEDNLIIPQA--EERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTN--------KDNKPKVIS---------EEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKE 684
            + F+Y     DEL +  GD+I+ +   E+GW  G L  K G+FPSNF K ++        D ++  E +L  P +      N ++     + Q   PKK+ GVGFG+IF  G +KL+T          K  KP ++          E  KP+I  + K KE  +T      +  YT  N DELT   G+II + +KE  + GWW+G + NG+ GVFPDNF   I E
Sbjct:  115 VLFEYSPQNEDELELTVGDVIDVIEEVEEGWWSGTLNNKLGLFPSNFVKELESTDDGEMHDAQEESEVSLTGPTSPMPSPGNGSEPAPGSVTQ---PKKIRGVGFGDIFKEGSVKLRTRTSSSETEEKKSEKPLILQSLGSRTQNVEVTKPDIDGKIKAKEYCKT------VFPYTGTNEDELTFREGEIIHLISKETGEAGWWKG-ELNGKEGVFPDNFAVQISE 330          

HSP 2 Score: 91.2781 bits (225), Expect = 8.505e-18
Identity = 65/204 (31.86%), Postives = 103/204 (50.49%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSVRP-HEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIK 681
            +DY++E+DYDA   DELTI  G+II +V+   E+GW+ G L G+ G+FP NF   VKE +R+++  +  +P   ER  N                V  +    + +GG                   ++P    + K  +    K   +V+  Y+ +N DEL L +GD+I V   E+ +EGWW G  +N + G+FP NFV+ ++
Sbjct:    2 VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNF---VKEIKRETEPKDDNLPIKRERPGNVA------------SLVQRISTYGLPAGG-------------------IQPH--PQTKAMKKKTKKRQCKVLFEYSPQNEDELELTVGDVIDVI--EEVEEGWWSGTLNN-KLGLFPSNFVKELE 166          

HSP 3 Score: 52.7582 bits (125), Expect = 9.244e-6
Identity = 33/78 (42.31%), Postives = 43/78 (55.13%), Query Frame = 1
Query:  517 VIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENN--------KPSRPNNAAII 726
            V + Y A + DELT+ +G+II    K  E EGW  G + NG+ G+FPDNFV+ IK E          K  RP N A +
Sbjct:    6 VEYDYDAVHDDELTIRVGEIIRNVKKLQE-EGWLEG-ELNGRRGMFPDNFVKEIKRETEPKDDNLPIKRERPGNVASL 81          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q925Q9|SH3K1_RAT (SH3 domain-containing kinase-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Sh3kbp1 PE=1 SV=2)

HSP 1 Score: 111.694 bits (278), Expect = 3.332e-24
Identity = 103/319 (32.29%), Postives = 137/319 (42.95%), Query Frame = 1
Query:   85 IEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVK-----------EDRRKSQEDNLI------IPQAEERNNNTKENDVVIEQTP------------------------------------------PPKKVTGVGFGNIFSGGEIKLK----TTNKDNKP--KVISEEVKPEILQEKKPKET-----TRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI-----KEENNKPSRPNNAA-IIKAGPPPPVTAAKPKINVGKSIPPRPPQLL 813
            + F Y     DEL +  GDII  V   E+GW  G+L GK G+FPSNF K +            E   KS+ +  +       P    +   T E  ++    P                                           PKKV GVGFG+IF    IKL+        D  P  K I +++ P       P +T     T+TKD  +VI  Y A+N DELT++ GDI+T+ NK+  D GWW G + NG+ GVFPDNFV+ +     KE N     P  +A +IK G     T  K +I   K IPP  P+ L
Sbjct:  105 VAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELSGESDELGISQDEQLSKSRPEGFLPASLLPFPAHGAKGKTTFEGTILYRAAPGKTEGHRRYYSLRETTGSESDGGDSSSTKSEGANGTVATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPVEKTIGKKLPPAT-STPDPSKTEMDSRTKTKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEG-ELNGRRGVFPDNFVKLLPSDFDKEGNRPKKPPPPSAPVIKQG--AGTTERKHEI---KKIPPERPETL 416          

HSP 2 Score: 96.2857 bits (238), Expect = 2.785e-19
Identity = 70/251 (27.89%), Postives = 110/251 (43.82%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENNKPSRPNNAAIIKAGP---------PPPVTAAKPKINVGKSIPPR 798
            ++ ++EFDY A   DELTI  G++I ++R  + GW  G + G+ G+FP NF + +K+D +K                       ++    P K +  V  GN     E  L+T                        K   R +   +V  SY  +N DEL L++GDII V    + +EGWW G   NG++G+FP NF++ +  E+++     +  + K+ P         P P   AK K     +I  R
Sbjct:    2 VEAIVEFDYQAQHDDELTISVGEVITNIRKEDGGWWEGQINGRRGLFPDNFVREIKKDVKKD----------------------LLSNKAPEKPMHDVSSGNSLLSSETILRTN-----------------------KRGERRRRRCQVAFSYLPQNDDELELKVGDIIEVVG--EVEEGWWEG-VLNGKTGMFPSNFIKELSGESDELGISQDEQLSKSRPEGFLPASLLPFPAHGAKGKTTFEGTILYR 204          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. TrEMBL
Match: A0A4E0RWI9 (SH3 domain-containing kinase-binding protein 1 OS=Fasciola hepatica OX=6192 GN=D915_006853 PE=4 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 4.197e-34
Identity = 98/256 (38.28%), Postives = 136/256 (53.12%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLII-----PQAEERN-NNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTN--------KDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRK-SNGQSGVFPDNFVEPIKEE-NNKPSRPNNAAI--IKAGPPPPVTAAKPKINVGKS 786
            M+ L+EFDY A+E DELTI KGDII  V   E+GW  G L GK GVFP NF K ++      ++   ++     P+AE +    T+  +  +  T   +KVTG+G GNIFSG  I+L+ T+        + N  K +S       ++     ++TRT D VR    Y  +  DEL L + DII + ++   DEGWW+G+  +  + GVFPDNFV P+ E  N+   R  N A       P PP  AAKP   +G S
Sbjct:    1 MEVLVEFDYAAEEPDELTIKKGDIIKDVSQFEEGWYIGNLNGKVGVFPDNFVKTIESSAGSKKQTIPVVETVKEPRAESKKVTETESEENRLGSTAKSQKVTGIGLGNIFSGQPIQLRQTSLKEVIKDTESNTDKTVSS------VKGDGSNQSTRT-DHVRARFDYQPKQLDELELHVDDIIQILDRNLPDEGWWKGKNLTTKKIGVFPDNFVIPVTEVPNDAVDRTQNTASTNTNTAPEPPKVAAKPSPLLGNS 249          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. TrEMBL
Match: A0A2C9JR72 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106064565 PE=4 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 2.054e-30
Identity = 116/345 (33.62%), Postives = 168/345 (48.70%), Query Frame = 1
Query:   91 FDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTT-----NKDNKPKVISE-EVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI-KEENNKPSRPNNAAIIKAGPPPPVTAAKPKINVGKSIPPRPPQLLEKQASKPA-NTVKDDGISFD-------APVNHKPLVGPNAGRAKRPGKKLPSNINIVTGNTEKPNDDEDSTPVSRSNSNENILIIDTT--PAIKLKP 1074
            F+Y  +  DEL +  GDII   +  E+GW  G L GK GVFPSNF + + E++  S E      + +++ + ++  D    Q    KK+ GVG GNIF GG IKL+ T      +D K     E E+ PE+   K+ K+ T  + +VR   SY AE  DEL+L  G II + +KE EDEGWW+G + +G+ GVFPDNFVE +  EE +KP +          PP P    K  +         P ++ EK     + + +K + ISF          V H     P  G+  +  ++L   +  V     +   DEDS  + R +S   I     +  P+I  KP
Sbjct:  113 FEYKKENDDELELQVGDIIEFHKQVEEGWWEGSLNGKHGVFPSNFVEMI-EEQSSSDESGQTNSEDKDKTSESQGKDENF-QAIKGKKIVGVGLGNIFGGGPIKLRPTADSGKKEDGKSGSKGEPEITPEVA--KREKQNTFERAIVRF--SYNAEQPDELSLVEGQIIRILDKELEDEGWWKG-ELHGKVGVFPDNFVELLPNEETSKPKK----------PPLPTNTTKQSV---------PVKVSEKSMLDSSDDKIKAENISFSNARKGKKYSVTHSSRHSPGLGKRSQMSRELSCILEAV-----EQMRDEDSMVLYRPDSRSKIHYYYESLGPSITKKP 426          

HSP 2 Score: 61.2326 bits (147), Expect = 6.099e-6
Identity = 27/56 (48.21%), Postives = 39/56 (69.64%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVK 240
            ++ ++EF+Y A++ DEL++  GDII +V   E GW  G L GK+G+FP NF K VK
Sbjct:    7 VEAVVEFEYQAEQEDELSLKVGDIITNVVTAEGGWWEGELNGKKGMFPENFVKLVK 62          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. TrEMBL
Match: A0A2C9JR75 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106064565 PE=4 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 5.731e-30
Identity = 116/347 (33.43%), Postives = 169/347 (48.70%), Query Frame = 1
Query:   85 IEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTT-----NKDNKPKVISE-EVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI-KEENNKPSRPNNAAIIKAGPPPPVTAAKPKINVGKSIPPRPPQLLEKQASKPA-NTVKDDGISFD-------APVNHKPLVGPNAGRAKRPGKKLPSNINIVTGNTEKPNDDEDSTPVSRSNSNENILIIDTT--PAIKLKP 1074
            + F+Y  +  DEL +  GDII   +  E+GW  G L GK GVFPSNF + + E++  S E      + +++ + ++  D    Q    KK+ GVG GNIF GG IKL+ T      +D K     E E+ PE+   K+ K+ T  + +VR   SY AE  DEL+L  G II + +KE EDEGWW+G + +G+ GVFPDNFVE +  EE +KP +          PP P    K  +         P ++ EK     + + +K + ISF          V H     P  G+  +  ++L   +  V     +   DEDS  + R +S   I     +  P+I  KP
Sbjct:  111 VLFEYKKENDDELELQVGDIIEFHKQVEEGWWEGSLNGKHGVFPSNFVEMI-EEQSSSDESGQTNSEDKDKTSESQGKDENF-QAIKGKKIVGVGLGNIFGGGPIKLRPTADSGKKEDGKSGSKGEPEITPEVA--KREKQNTFERAIVRF--SYNAEQPDELSLVEGQIIRILDKELEDEGWWKG-ELHGKVGVFPDNFVELLPNEETSKPKK----------PPLPTNTTKQSV---------PVKVSEKSMLDSSDDKIKAENISFSNARKGKKYSVTHSSRHSPGLGKRSQMSRELSCILEAV-----EQMRDEDSMVLYRPDSRSKIHYYYESLGPSITKKP 426          

HSP 2 Score: 61.2326 bits (147), Expect = 7.135e-6
Identity = 27/56 (48.21%), Postives = 39/56 (69.64%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVK 240
            ++ ++EF+Y A++ DEL++  GDII +V   E GW  G L GK+G+FP NF K VK
Sbjct:    7 VEAVVEFEYQAEQEDELSLKVGDIITNVVTAEGGWWEGELNGKKGMFPENFVKLVK 62          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. TrEMBL
Match: A0A2C9JR83 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106064565 PE=4 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 6.068e-30
Identity = 116/345 (33.62%), Postives = 168/345 (48.70%), Query Frame = 1
Query:   91 FDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTT-----NKDNKPKVISE-EVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI-KEENNKPSRPNNAAIIKAGPPPPVTAAKPKINVGKSIPPRPPQLLEKQASKPA-NTVKDDGISFD-------APVNHKPLVGPNAGRAKRPGKKLPSNINIVTGNTEKPNDDEDSTPVSRSNSNENILIIDTT--PAIKLKP 1074
            F+Y  +  DEL +  GDII   +  E+GW  G L GK GVFPSNF + + E++  S E      + +++ + ++  D    Q    KK+ GVG GNIF GG IKL+ T      +D K     E E+ PE+   K+ K+ T  + +VR   SY AE  DEL+L  G II + +KE EDEGWW+G + +G+ GVFPDNFVE +  EE +KP +          PP P    K  +         P ++ EK     + + +K + ISF          V H     P  G+  +  ++L   +  V     +   DEDS  + R +S   I     +  P+I  KP
Sbjct:  113 FEYKKENDDELELQVGDIIEFHKQVEEGWWEGSLNGKHGVFPSNFVEMI-EEQSSSDESGQTNSEDKDKTSESQGKDENF-QAIKGKKIVGVGLGNIFGGGPIKLRPTADSGKKEDGKSGSKGEPEITPEVA--KREKQNTFERAIVRF--SYNAEQPDELSLVEGQIIRILDKELEDEGWWKG-ELHGKVGVFPDNFVELLPNEETSKPKK----------PPLPTNTTKQSV---------PVKVSEKSMLDSSDDKIKAENISFSNARKGKKYSVTHSSRHSPGLGKRSQMSRELSCILEAV-----EQMRDEDSMVLYRPDSRSKIHYYYESLGPSITKKP 426          

HSP 2 Score: 61.2326 bits (147), Expect = 7.484e-6
Identity = 27/56 (48.21%), Postives = 39/56 (69.64%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVK 240
            ++ ++EF+Y A++ DEL++  GDII +V   E GW  G L GK+G+FP NF K VK
Sbjct:    7 VEAVVEFEYQAEQEDELSLKVGDIITNVVTAEGGWWEGELNGKKGMFPENFVKLVK 62          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. TrEMBL
Match: A0A0L8H4C0 (Uncharacterized protein (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22022992mg PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 9.149e-30
Identity = 85/205 (41.46%), Postives = 115/205 (56.10%), Query Frame = 1
Query:   85 IEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTK-----ENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVI--HSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI 678
            ++F+Y  +  DEL +H GD++   R  E+GW  G L GK G+FPSNF   ++E+           P  EER  + K     + D  I+     KKV GVGFGNIF  G IKL+ ++   K +  +EE K E +         ++K +   I   SY AEN DELTL+ GD IT+  K+ ED GWW+G + NG+ GVFPDNFVE I
Sbjct:   12 VQFEYIPEAEDELELHIGDVLEVYREVEEGWWEGQLNGKVGMFPSNF-VEIREN-----------PDEEEREKSVKTDEPEKKDSSIDPETKGKKVKGVGFGNIFGSGPIKLRPSSGVWKGE--TEESKVEKVSGSASTTVKKSKQLEMAIARFSYHAENEDELTLKEGDTITILKKDLEDVGWWKG-ELNGRIGVFPDNFVEII 201          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Cavefish
Match: sh3kbp1 (SH3-domain kinase binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-091204-186])

HSP 1 Score: 110.153 bits (274), Expect = 1.018e-24
Identity = 78/220 (35.45%), Postives = 112/220 (50.91%), Query Frame = 1
Query:   91 FDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVK---------EDRRKSQ---EDNLIIPQAEERNNNTKEN--DVVIEQTPPPKKVTGVGFGNIFSGGEIKLK--TTNKDNK-----------PKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFV 669
            F Y     DEL +  GD+I+ +   E+GW  G L GK G+FPSNF K +          ED R ++   +D+         +++ + +   V       PKKV G GFG+IF    IKL+  + + DN+           P V  E +K E      P    R K+  +V+  Y A+N DEL+++ G+I+T+ NKE  D GWW G + NG+ GVFPDNFV
Sbjct:  125 FSYIPQNEDELELKIGDVIDILGEVEEGWWEGSLSGKTGMFPSNFTKEILAEEEELATPEDTRSTKTSVKDSTGSESDGGDSSSARSDAGSVASSTEIQPKKVRGFGFGDIFKDQPIKLRPRSVDMDNELEKQPTAKKAAPAVAPETMKTE------PDNKARAKEFCKVLFPYDAQNEDELSIKEGEIVTIINKECADAGWWLG-ELNGKQGVFPDNFV 337          

HSP 2 Score: 91.2781 bits (225), Expect = 1.122e-18
Identity = 59/200 (29.50%), Postives = 93/200 (46.50%), Query Frame = 1
Query:   67 FDMDYLIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNF 666
            F ++ ++EFDY A   DELTI  G+II+++R  E GW  G + G+ G+FP NF + +K++                     K+   +  QT  PK  + +  G+   G +  L+   K +  +                      K   +   SY  +N DEL L+IGD+I +    + +EGWW G  S G++G+FP NF
Sbjct:   17 FSVEAIVEFDYQAQHDDELTISVGEIISNIRKDEGGWWEGEVDGRRGLFPDNFVREIKKE--------------------VKKEASLASQTAGPK--SDLSNGSTSPGSDSCLRPAKKGDAIR----------------------KRRCKAAFSYIPQNEDELELKIGDVIDILG--EVEEGWWEGSLS-GKTGMFPSNF 169          

HSP 3 Score: 55.4546 bits (132), Expect = 1.468e-7
Identity = 30/70 (42.86%), Postives = 45/70 (64.29%), Query Frame = 1
Query:  529 YTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENNKPSRPNNAAIIKAGP 738
            Y A++ DELT+ +G+II+  N   ++ GWW G + +G+ G+FPDNFV  IK+E  K +   + A   AGP
Sbjct:   27 YQAQHDDELTISVGEIIS--NIRKDEGGWWEG-EVDGRRGLFPDNFVREIKKEVKKEA---SLASQTAGP 90          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Cavefish
Match: sh3d21 (SH3 domain containing 21 [Source:NCBI gene;Acc:103034682])

HSP 1 Score: 106.301 bits (264), Expect = 7.001e-24
Identity = 75/241 (31.12%), Postives = 117/241 (48.55%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSVRP-HEDGWMYGILRGKEGVFPSNFGK----------------------PVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFG--------NIFSGGEIK-------LKTTNKDNKPKVISEEVKPEILQEKKP-KETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI 678
            M+ L+  D++    DEL++  GD++ +V+   EDGW+ G LRGK G+FPSNF K                      P+K+  RK +     +PQ E+      E D+ + +T    +    G+           F    +K       L+  +K ++PK+       E  Q++   ++ T  K+  +V+  YTA   DEL L+ GDI+T+ +K  ED+GWW G + NG+ G FPDNFV  I
Sbjct:    1 MEVLVLIDFEGTLGDELSVQAGDVVKNVKAASEDGWLEGELRGKRGIFPSNFVKEVPVHLMGDSKREPRSMRTSKMPLKDLCRKCEVTYTYMPQNED------ELDLAVGETVEILREIEDGWWMGKKNNKIGAFPSNFVKEIFPKDGLQHESK-SRPKLSDSLFTKEAPQQRASIRKKTNVKECCQVMFDYTAVAEDELNLKKGDIVTIISKASEDDGWWEG-ELNGRRGFFPDNFVMVI 233          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Cavefish
Match: cd2ap (CD2 associated protein [Source:NCBI gene;Acc:103029908])

HSP 1 Score: 102.064 bits (253), Expect = 4.319e-22
Identity = 77/221 (34.84%), Postives = 113/221 (51.13%), Query Frame = 1
Query:   85 IEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERN---NNTKENDVVIEQTPPPKKVTGVGFGNIFSGG---EIKLKTTNKDNKPKVI---SEEVKPEILQ-------EKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENNKP 699
            + F+Y     DEL +  GDII      E+GW  G + GK G+FPSNF K V+ +  +   D    P +++      +    + VI Q   PKKV GVGFG+IF      +++L +  +D K K I       KP  L        EK  +   + K+  +   +Y A N DEL ++ GD+I + +K+  + GWWRG  S G+ GVFPDNFV  + E + +P
Sbjct:  138 VVFEYVPQNEDELELKVGDIIEITEEVEEGWWSGSMNGKSGLFPSNFVKEVEMNEEEEISDVPDDPDSKDEAMSPTSPHPGNGVIAQ---PKKVKGVGFGDIFRDSVKLKVRLPSETEDKKEKPIPSLPSAAKPTNLSTSDAQKLEKDGESKGKVKEYCKATFAYEATNQDELDIKEGDVIHLLSKDTGEPGWWRGELS-GKQGVFPDNFVVLLSESDKEP 354          

HSP 2 Score: 53.9138 bits (128), Expect = 4.587e-7
Identity = 29/60 (48.33%), Postives = 40/60 (66.67%), Query Frame = 1
Query:  103 ADEADELTIHKGDIINSVRP-HEDGWMYGILRGKEGVFPSNFGK-----PVKEDRRKSQE 264
            A   DELT+ +GDII +VR   E+GWM G L G+ G+FP NF K     PVKE+ ++++E
Sbjct:   12 AAHEDELTLRQGDIIKNVRRIEEEGWMEGDLNGRRGLFPDNFVKEVRKEPVKEEVKEAKE 71          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Cavefish
Match: cd2ap (CD2 associated protein [Source:NCBI gene;Acc:103029908])

HSP 1 Score: 99.3673 bits (246), Expect = 2.733e-21
Identity = 76/218 (34.86%), Postives = 111/218 (50.92%), Query Frame = 1
Query:   85 IEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERN---NNTKENDVVIEQTPPPKKVTGVGFGNIFSGG---EIKLKTTNKDNKPKVI---SEEVKPEILQ-------EKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEEN 690
            + F+Y     DEL +  GDII      E+GW  G + GK G+FPSNF K V+ +  +   D    P +++      +    + VI Q   PKKV GVGFG+IF      +++L +  +D K K I       KP  L        EK  +   + K+  +   +Y A N DEL ++ GD+I + +K+  + GWWRG  S G+ GVFPDNFV  + E +
Sbjct:  102 VVFEYVPQNEDELELKVGDIIEITEEVEEGWWSGSMNGKSGLFPSNFVKEVEMNEEEEISDVPDDPDSKDEAMSPTSPHPGNGVIAQ---PKKVKGVGFGDIFRDSVKLKVRLPSETEDKKEKPIPSLPSAAKPTNLSTSDAQKLEKDGESKGKVKEYCKATFAYEATNQDELDIKEGDVIHLLSKDTGEPGWWRGELS-GKQGVFPDNFVVLLSESD 315          

HSP 2 Score: 67.3958 bits (163), Expect = 2.748e-11
Identity = 58/192 (30.21%), Postives = 82/192 (42.71%), Query Frame = 1
Query:  103 ADEADELTIHKGDIINSVRP-HEDGWMYGILRGKEGVFPSNF--GKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFV 669
            A   DELT+ +GDII +VR   E+GWM G L G+ G+FP NF   K VKE R      +L+                        ++++  G      G + +     K  + KV+ E                           Y  +N DEL L++GD   +   E+ +EGWW G   NG+SG+FP NFV
Sbjct:   12 AAHEDELTLRQGDIIKNVRRIEEEGWMEGDLNGRRGLFPDNFVKTKEVKERRSAGNVASLV------------------------QRISTYGIPTGGLGFQPRSSKKKKKRQCKVVFE---------------------------YVPQNEDELELKVGD--IIEITEEVEEGWWSG-SMNGKSGLFPSNFV 149          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Cavefish
Match: itsn1 (intersectin 1 (SH3 domain protein) [Source:ZFIN;Acc:ZDB-GENE-030616-226])

HSP 1 Score: 70.8626 bits (172), Expect = 3.837e-12
Identity = 57/211 (27.01%), Postives = 94/211 (44.55%), Query Frame = 1
Query:   79 YLIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKED-----------RRKSQEDNLIIPQ---AEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFV 669
            Y+  + Y+++E  +LT  +GD+I  ++   D W  G + GK GVFPSN+ KP   D            +K +   +I P      E+        ++I +  P     G   G + + G+ +       N  K++S     +++                 ++ Y A+N DEL    G II V ++ED D  WW+G + NG  G+FP N+V
Sbjct:  859 YIAMYTYESNEQGDLTFQQGDVITVLKKEGDWWT-GTVSGKTGVFPSNYVKPKDSDGLGPAGKTGSLGKKPEIAQVIAPYTATGAEQLTLAPGQLILIRKKNP----GGWWEGELQARGKKRQIGWFPANYVKLLSPSTMCQVIG----------------MYDYAAQNDDELPFGKGQIINVLSREDPD--WWKG-ELNGSVGLFPSNYV 1045          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008112.1 (pep scaffold:Pmarinus_7.0:GL482163:8897:24902:-1 gene:ENSPMAG00000007333.1 transcript:ENSPMAT00000008112.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 1.267e-12
Identity = 40/115 (34.78%), Postives = 64/115 (55.65%), Query Frame = 1
Query:  499 TKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVE----PIKEENNKPSRPNNAAIIKAGPPPPVTAAKPKINVGKSIPPRPPQLLEKQASK 831
             ++  + + SY A+N+DEL+L+ G+++ +  K+  D GWW G + NG+ GVFPDNFV+     +++E  KP +            PP+ A   K+N+G    P  P+L  KQ  K
Sbjct:    1 AREYCKALFSYEAQNNDELSLKEGELVEIIAKDCGDAGWWEG-EVNGKRGVFPDNFVKLLPAEVEKEYEKPKK------------PPLPATLVKVNLGDK--PERPELPFKQEEK 100          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003067.1 (pep scaffold:Pmarinus_7.0:GL477025:38822:89389:-1 gene:ENSPMAG00000002795.1 transcript:ENSPMAT00000003067.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 2.379e-9
Identity = 38/92 (41.30%), Postives = 51/92 (55.43%), Query Frame = 1
Query:  508 VVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENNKPSRPNNAAIIKAGPPPPVT--AAKPKINV 777
            VVR   ++   N DEL+ E GD+ITVT    E  GWW G   NG +G FP N+V  +K  +++P+ P  A   K G  PP +  AAK   +V
Sbjct:  170 VVRAKFTFQRTNEDELSFEKGDVITVTRV--EHGGWWEG-AFNGHTGWFPSNYVRELK-ASDRPTSP-KAVGSKGGAKPPESPPAAKGYYDV 256          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Sea Lamprey
Match: grb2a (growth factor receptor-bound protein 2a [Source:ZFIN;Acc:ZDB-GENE-041121-1])

HSP 1 Score: 55.8398 bits (133), Expect = 4.702e-9
Identity = 56/231 (24.24%), Postives = 99/231 (42.86%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSVRPHED-GWMYGILRGKEGVFPSNF--GKPVKEDRRKSQEDNLIIPQ--AEERNNNTKENDVVI---EQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKP----EILQEKKPKETTRTKDV---------------VRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKE 684
            M+ + ++D++A   DEL+  +GD++  +    D  W    L G++G  P N+   KP      K       IP+  AEE  N  K +   +    ++ P      V FGN     +++     +D   K     VK     E+++  +    +RT+ +               V+ +  +  +   EL    GD ITV +  D +  WW+G   +G++G+FP N+V   K+
Sbjct:    1 MEAVAKYDFNATAEDELSFKRGDVLKVLNEDCDQNWYKAELNGRDGFIPKNYIDMKPHPWFTGK-------IPRVKAEEMLNRQKFDGAFLVRESESAPGDFSLSVKFGN-----DVQHFKVLRDGAGKYFLWVVKFNSLNELVEYHRSTSVSRTQQIFLRDMEQLPQQAATRVQALFDFEPQEDGELGFRRGDFITVVDSSDPN--WWKG-SCHGRAGMFPRNYVTLAKD 216          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Sea Lamprey
Match: ABI1 (abl interactor 1 [Source:HGNC Symbol;Acc:HGNC:11320])

HSP 1 Score: 56.225 bits (134), Expect = 1.608e-8
Identity = 24/61 (39.34%), Postives = 36/61 (59.02%), Query Frame = 1
Query:   61 KIFDMDYLIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKE 243
            KI+    +  +DY  D+ DEL+ H+G II  VR ++DGW  G   G  G+FP N+ +P+  
Sbjct:  391 KIYIEKVVAVYDYVQDKDDELSFHEGSIIYVVRKNDDGWYEGATNGHTGLFPGNYVEPIMH 451          

HSP 2 Score: 51.9878 bits (123), Expect = 3.520e-7
Identity = 24/58 (41.38%), Postives = 34/58 (58.62%), Query Frame = 1
Query:  511 VRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKE 684
            V  ++ Y  +  DEL+   G II V  K D+  GW+ G  +NG +G+FP N+VEPI  
Sbjct:  397 VVAVYDYVQDKDDELSFHEGSIIYVVRKNDD--GWYEG-ATNGHTGLFPGNYVEPIMH 451          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009021.1 (pep scaffold:Pmarinus_7.0:GL482604:596:7954:-1 gene:ENSPMAG00000008160.1 transcript:ENSPMAT00000009021.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 2.023e-8
Identity = 23/54 (42.59%), Postives = 33/54 (61.11%), Query Frame = 1
Query:   91 FDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRR 252
            FD+  +  DEL+  KGD+I   RP + GW  G L G+ G FPSN+ + +K + R
Sbjct:   16 FDFQRNNEDELSFSKGDVITVTRPEDGGWWEGTLGGRSGWFPSNYVRELKGNER 69          

HSP 2 Score: 51.6026 bits (122), Expect = 2.767e-7
Identity = 29/65 (44.62%), Postives = 37/65 (56.92%), Query Frame = 1
Query:  508 VVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENNKPS 702
            VVR    +   N DEL+   GD+ITVT    ED GWW G    G+SG FP N+V  +K  N +P+
Sbjct:   11 VVRARFDFQRNNEDELSFSKGDVITVTRP--EDGGWWEG-TLGGRSGWFPSNYVRELK-GNERPT 71          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Yeast
Match: LSB3 (Protein containing a C-terminal SH3 domain; binds Las17p, which is a homolog of human Wiskott-Aldrich Syndrome protein involved in actin patch assembly and actin polymerization; protein abundance increases in response to DNA replication stress; LSB3 has a paralog, YSC84, that arose from the whole genome duplication [Source:SGD;Acc:S000002968])

HSP 1 Score: 53.9138 bits (128), Expect = 4.997e-8
Identity = 22/54 (40.74%), Postives = 32/54 (59.26%), Query Frame = 1
Query:  517 VIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI 678
             ++S+  E S +L    GD+IT+  K D    WW GR  NG+ G+FP N+VE +
Sbjct:  407 ALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGR-VNGREGIFPANYVELV 459          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Yeast
Match: YSC84 (Actin-binding protein; involved in bundling of actin filaments and endocytosis of actin cortical patches; activity stimulated by Las17p; contains SH3 domain similar to Rvs167p; YSC84 has a paralog, LSB3, that arose from the whole genome duplication [Source:SGD;Acc:S000001058])

HSP 1 Score: 48.9062 bits (115), Expect = 1.671e-6
Identity = 19/52 (36.54%), Postives = 31/52 (59.62%), Query Frame = 1
Query:  517 VIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVE 672
             ++++  E   +L  + GD+IT+  K D    WW GR +NG+ G+FP N+V 
Sbjct:  416 ALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGR-TNGKEGIFPANYVR 466          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Yeast
Match: HSE1 (Subunit of the endosomal Vps27p-Hse1p complex; complex is required for sorting of ubiquitinated membrane proteins into intralumenal vesicles prior to vacuolar degradation, as well as for recycling of Golgi proteins and formation of lumenal membranes [Source:SGD;Acc:S000000994])

HSP 1 Score: 48.1358 bits (113), Expect = 3.352e-6
Identity = 23/56 (41.07%), Postives = 31/56 (55.36%), Query Frame = 1
Query:  511 VRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI 678
            VR ++  T    DEL+   GD+ITV  +   D  WW+G    G  G+FP N+V PI
Sbjct:  222 VRALYDLTTNEPDELSFRKGDVITVLEQVYRD--WWKG-ALRGNMGIFPLNYVTPI 274          

HSP 2 Score: 46.595 bits (109), Expect = 9.646e-6
Identity = 19/49 (38.78%), Postives = 27/49 (55.10%), Query Frame = 1
Query:   91 FDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPV 237
            +D   +E DEL+  KGD+I  +      W  G LRG  G+FP N+  P+
Sbjct:  226 YDLTTNEPDELSFRKGDVITVLEQVYRDWWKGALRGNMGIFPLNYVTPI 274          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Yeast
Match: RVS167 (Calmodulin-binding actin-associated protein; roles in endocytic membrane tabulation and constriction, and exocytosis; N-BAR domain protein that interacts with Rvs161p to regulate actin cytoskeleton, endocytosis, and viability following starvation or osmotic stress; recruited to bud tips by Gyl1p and Gyp5p during polarized growth; homolog of mammalian amphiphysin [Source:SGD;Acc:S000002796])

HSP 1 Score: 47.7506 bits (112), Expect = 4.294e-6
Identity = 19/56 (33.93%), Postives = 32/56 (57.14%), Query Frame = 1
Query:  505 DVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVE 672
            + V  ++ Y A+ + +L+   G +I +  +  +   WW GR  NGQ GVFP N+V+
Sbjct:  424 ETVTALYDYQAQAAGDLSFPAGAVIEIVQRTPDVNEWWTGR-YNGQQGVFPGNYVQ 478          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Yeast
Match: LSB1 (Negative regulator of actin nucleation-promoting factor activity; interacts with Las17p, a homolog of human Wiskott-Aldrich Syndrome protein (WASP), via an N-terminal SH3 domain, and along with PIN3 cooperatively inhibits the nucleation of actin filaments; overexpression blocks receptor-mediated endocytosis; protein increases in abundance and forms nuclear foci in response to DNA replication stress; LSB1 has a paralog, PIN3, that arose from the whole genome duplication [Source:SGD;Acc:S000003368])

HSP 1 Score: 46.595 bits (109), Expect = 5.354e-6
Identity = 28/86 (32.56%), Postives = 46/86 (53.49%), Query Frame = 1
Query:  499 TKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENNKPSRPNNAA---IIKAGPPPP 747
            T++ V  ++ + A+   +L+L+ GD I V  K   D  W+RG KSN + G+FP N+V+P    +  P     A+   + +   PPP
Sbjct:   54 TEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPD--WYRG-KSNNKIGIFPANYVKPAFTRSASPKSAEAASSSTVSRPSVPPP 136          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Nematostella
Match: EDO38710 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC74])

HSP 1 Score: 65.855 bits (159), Expect = 2.993e-12
Identity = 68/217 (31.34%), Postives = 101/217 (46.54%), Query Frame = 1
Query:   91 FDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNF-------GKPVKEDRRKSQEDNLIIPQAEERNNNTKEN---DVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVI-SEEVKPEILQEKKPKETTRTKD--------VVR--VIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI 678
            F+Y+A E DEL++   DII  +   + GW  G L GK+G+FP NF        +  K   + S +  L+   + +     K     D   E       VTG+   N+    E        D +  V  S  VK + + E  P +T R  +        V+R  V + Y  +N DEL L++GDIIT+  KE  D   W   + +G++G+FPDNFVE +
Sbjct:    1 FEYEAAEPDELSLQIDDIIEDIVDEDVGWARGDLNGKKGLFPVNFVDFIENNAELAKSAGKASYKRKLLSFSSTDSIAGRKACVLFDYEAENADELSLVTGIEI-NVIREVEDGWWEGTVDGRKGVFPSNFVKLKPIDET-PTKTKRQPEKQPPAEEPVLRAKVTYDYEQQNEDELELKVGDIITIVKKEVFDTPGWMEGELDGKTGLFPDNFVEIL 215          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Nematostella
Match: EDO29744 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2S0])

HSP 1 Score: 59.3066 bits (142), Expect = 1.487e-9
Identity = 57/210 (27.14%), Postives = 98/210 (46.67%), Query Frame = 1
Query:   91 FDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKS--QEDNLIIPQAEERNNNTKENDVVIEQ-TPPPKKV--------TGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTR---TKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI 678
            + Y+ +E D L+  +GD+I  +   E  W  G LR   G+FP+N+ K  KE  RKS    ++L    +E     +    +  +Q +  P ++        +G   G + + G+ +       N  K++++   P   Q      T +     + V  +  YTA+  DELT   G +  V +K+ E   WW+G + NGQ G+FP N+V+ +
Sbjct:    6 YTYNGEEGD-LSFKEGDVIG-ITKDEGEWWEGRLRENYGLFPANYVKK-KEAERKSTLSLNSLFCLFSEIATVVSPYTAIAADQLSLAPGQLIRVTRKDPSGWWEGELQARGKKRQSGIFPANHVKILAK--GPGGSQSGSCTSTQQPPEGGNQVLAMFPYTAQKGDELTFYKGSVFNVMSKDGE---WWKG-ELNGQVGMFPSNYVQSL 206          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Nematostella
Match: EDO43872 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXM7])

HSP 1 Score: 58.151 bits (139), Expect = 6.775e-9
Identity = 28/56 (50.00%), Postives = 36/56 (64.29%), Query Frame = 1
Query:  511 VRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI 678
             + I+ Y A  SDELT+  GDIITVT +   D GWW+G   N Q G+FP ++VE I
Sbjct:  439 CKAIYDYQATQSDELTIHPGDIITVTAR--LDNGWWQG-DLNNQQGIFPASYVEEI 491          

HSP 2 Score: 52.373 bits (124), Expect = 4.021e-7
Identity = 20/45 (44.44%), Postives = 31/45 (68.89%), Query Frame = 1
Query:   91 FDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNF 225
            +DY A ++DELTIH GDII      ++GW  G L  ++G+FP+++
Sbjct:  443 YDYQATQSDELTIHPGDIITVTARLDNGWWQGDLNNQQGIFPASY 487          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Nematostella
Match: EDO41303 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4L5])

HSP 1 Score: 51.2174 bits (121), Expect = 1.064e-8
Identity = 22/53 (41.51%), Postives = 36/53 (67.92%), Query Frame = 1
Query:  511 VRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFV 669
            V V++ Y A  +DELT+  GD+ITV  +++E+  WW G  ++G+ G FP N++
Sbjct:    1 VLVMYPYEANRADELTITPGDVITVLYQDNEN--WWMGELADGRQGYFPSNYI 51          

HSP 2 Score: 45.4394 bits (106), Expect = 9.777e-7
Identity = 21/49 (42.86%), Postives = 34/49 (69.39%), Query Frame = 1
Query:   82 LIEFDYDADEADELTIHKGDIINSV-RPHEDGWMYGILRGKEGVFPSNF 225
            L+ + Y+A+ ADELTI  GD+I  + + +E+ WM  +  G++G FPSN+
Sbjct:    2 LVMYPYEANRADELTITPGDVITVLYQDNENWWMGELADGRQGYFPSNY 50          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Nematostella
Match: EDO31290 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYD1])

HSP 1 Score: 55.4546 bits (132), Expect = 1.442e-8
Identity = 31/75 (41.33%), Postives = 42/75 (56.00%), Query Frame = 1
Query:  454 KPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI 678
            +PE L E  P E T        ++ Y   + +E+T +  DIIT  N E  DEGWWRG   +G+ G+FP N+VE I
Sbjct:  174 EPEDLYENAPAEDTGV--TATALYDYQQADDNEITFDPDDIIT--NIEQIDEGWWRGTGPDGRHGMFPANYVEII 244          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Medaka
Match: sh3kbp1 (SH3 domain containing kinase binding protein 1 [Source:NCBI gene;Acc:101157013])

HSP 1 Score: 120.553 bits (301), Expect = 3.384e-28
Identity = 86/268 (32.09%), Postives = 129/268 (48.13%), Query Frame = 1
Query:   91 FDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGK-------------PVKEDRRKSQEDNLI---IPQAEERNNNTK-ENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVI----SEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENNKPSRPNNAAIIKAGPPPPVTAAKPKINVGKSIPPRPPQLLEKQASK 831
            F Y     DEL +  GD+I  +   E+GW  G+L GK G+FPSNF +             P   D  +SQ         P +E    +++ E    I     PKKV G GFG IF    IKL+  + +  P+ +    +  V  E ++  +P   ++ ++  +V+  Y A+N DELTL+ GDII +  K+  D GWW G +  G+ GVFPDNFV   K++ N+        ++ A  PP       K  V K+ P RP  L ++ + +
Sbjct:   88 FSYAPQHEDELELRVGDVIEIITEVEEGWWEGVLNGKTGMFPSNFTREIAAESDMPLADTPTSHDELRSQTSETTSKDSPGSESDGGDSRSETGSEIH----PKKVKGFGFGEIFKDQVIKLRPRSIEVDPEGVKVRKASSVATETMK-TEPDTKSKGREQCKVLFPYEAQNEDELTLKEGDIINIITKDCADAGWWMG-EFGGRQGVFPDNFV---KDQRNR--------LLPAHHPPSTPWVTKKSEVKKAPPERPEHLPQRDSDR 338          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Medaka
Match: cd2ap (CD2 associated protein [Source:NCBI gene;Acc:101154913])

HSP 1 Score: 104.76 bits (260), Expect = 5.548e-23
Identity = 73/220 (33.18%), Postives = 105/220 (47.73%), Query Frame = 1
Query:   85 IEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVK-------------EDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLK---TTNKDNKPKVISEEVKPEILQEKKPKETT----RTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKE 684
            + FDY     DEL + KGD+I      E+GW  G L GK G+FPSNF K +              +D   S  D    P + +  + +      I Q   PKKV   G+G+IF     KLK   +     KP   +    P    + K K+ +      K+  RV+ ++   + DEL+L+ GDI+ + +K+  + GWWRG +  G+ GVFPDNFV  I E
Sbjct:  121 VLFDYQPQNEDELELKKGDLIEITEEVEEGWWSGSLNGKSGLFPSNFVKEMDAAGEDVESSDATPDDAEGSGTDGATTPTSPQSASGSG----AIAQ---PKKVQRFGYGDIFKESSFKLKPVPSLPSSAKPTPPNTTEPPRAEADAKLKDASVSVPSAKEFCRVMFAFEGTHEDELSLKEGDIVQILSKDTGETGWWRG-EIGGERGVFPDNFVVVISE 332          

HSP 2 Score: 98.5969 bits (244), Expect = 5.789e-21
Identity = 73/208 (35.10%), Postives = 106/208 (50.96%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSVRP-HEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQ--------EDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFV 669
            M+ L+EFDY+A   DELT+  GD+I +VR   EDGWM G L GK GVFP NF K +K+++   +        ++   +PQ  E++ +   N V        ++++ +GF             T     P  +           KKPK     K   +V+  Y  +N DEL L+ GD+I +T  E+ +EGWW G   NG+SG+FP NFV
Sbjct:    1 MEVLVEFDYEALHDDELTLRPGDVIRNVRYIEEDGWMEGDLNGKRGVFPDNFVKEIKKEKEPKEVKETKHEPKEETSVPQKREKSAHVA-NLV--------QRMSTIGF------------PTGGFQPPTTV-----------KKPK-----KRHCKVLFDYQPQNEDELELKKGDLIEIT--EEVEEGWWSG-SLNGKSGLFPSNFV 168          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Medaka
Match: sh3d21 (SH3 domain containing 21 [Source:NCBI gene;Acc:101167234])

HSP 1 Score: 99.3673 bits (246), Expect = 1.352e-21
Identity = 69/236 (29.24%), Postives = 114/236 (48.31%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDII-NSVRPHEDGWMYGILRGKEGVFPSNFGKPV---------KEDR--------RKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIK----------------LKTTNKDNKPKVISEEVKPEILQEKKPKETTRTK---DVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFV 669
            M+ L+  D++    DELT+  GD++ N  + +E+GW++G LRGK G+FP NF K +         +E R        ++ ++  +I P   +   N  E ++V+ +T    +    G+       ++                 LK     ++PK+       EI   +KP   +  K   +  +V+  Y A++ DEL L+ GD++ +  KE EDEGWW G + NG+ G FPDNFV
Sbjct:    1 MEVLVLMDFEGTAGDELTVKTGDVLKNVTKANEEGWLHGELRGKWGIFPVNFVKEIPVYLIGDSKREPRSIRKPKKVKQVRKCEVIFPYCPQ---NDDELELVVGETIEIIREIEDGWWMGVRNAKVGAFPSNFVTEIIFPPKDLKQIEGKSRPKLSDAMFTKEI--SRKPSVRSHAKTNVEYCQVMFDYKAQSEDELDLKKGDVVVLLRKETEDEGWWEG-ELNGRCGFFPDNFV 230          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Medaka
Match: ENSORLT00000029133.1 (pep primary_assembly:ASM223467v1:15:615592:625392:1 gene:ENSORLG00000023954.1 transcript:ENSORLT00000029133.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.2629 bits (199), Expect = 2.727e-17
Identity = 61/211 (28.91%), Postives = 94/211 (44.55%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVI------------HSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFV 669
            ++YL  + Y++ E  +L+  +GDI+   R   D W  G + GK GVFPSN+ KP    R  + E   +                 ++ +   +K+T   F +  SG      T  +D K +   EEV        +    + T   V  +            + Y A+N DEL    G +ITV NKED D  WW+G + NG+ G+FP N++
Sbjct:    1 VEYLAMYTYESSEQGDLSFQQGDIVMVTRKEGDWWT-GTVGGKTGVFPSNYVKP----RDSAMEVRALF---------------FLQWSGLDQKLTVFPFLSSVSG------TCRQDRKSR---EEVGDHCFMCFRALGFSLTSRCVLTLCLSAAVCQVIGMYDYVAQNDDELAFLKGQVITVLNKEDCD--WWKG-ELNGREGLFPSNYL 179          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Medaka
Match: pacsin1a (protein kinase C and casein kinase substrate in neurons 1 [Source:NCBI gene;Acc:101164231])

HSP 1 Score: 63.1586 bits (152), Expect = 3.720e-10
Identity = 27/56 (48.21%), Postives = 38/56 (67.86%), Query Frame = 1
Query:  511 VRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI 678
            VR ++ Y  +  DEL+ + GD +T T  EDE +GW RGR  +GQ G++P N+VEPI
Sbjct:  317 VRALYDYDGQEQDELSFKAGDELTKTEDEDE-QGWCRGRLDSGQEGLYPANYVEPI 371          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Planmine SMEST
Match: SMESG000079662.1 (SMESG000079662.1)

HSP 1 Score: 996.882 bits (2576), Expect = 0.000e+0
Identity = 513/513 (100.00%), Postives = 513/513 (100.00%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENNKPSRPNNAAIIKAGPPPPVTAAKPKINVGKSIPPRPPQLLEKQASKPANTVKDDGISFDAPVNHKPLVGPNAGRAKRPGKKLPSNINIVTGNTEKPNDDEDSTPVSRSNSNENILIIDTTPAIKLKPKESSISNFDRNVDHVTKLKSKDTILTEKPIESPIGKDKPKDTIIPTSTVAPVEKEPEVSPLKPTQNFKANTLPXXXXXXXXXXANIASLKNENDHKNDIMKLKSKISDLEEKNTDLHKELLELRKYSNEQTNMLKIKINKLTNELDEEKTKRAANEVNFSRLKEKVEDLEMSMQSLLHK 1611
            MDYLIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENNKPSRPNNAAIIKAGPPPPVTAAKPKINVGKSIPPRPPQLLEKQASKPANTVKDDGISFDAPVNHKPLVGPNAGRAKRPGKKLPSNINIVTGNTEKPNDDEDSTPVSRSNSNENILIIDTTPAIKLKPKESSISNFDRNVDHVTKLKSKDTILTEKPIESPIGKDKPKDTIIPTSTVAPVEKEPEVSPLKPTQNFKANTLPKNVDVVKVDNANIASLKNENDHKNDIMKLKSKISDLEEKNTDLHKELLELRKYSNEQTNMLKIKINKLTNELDEEKTKRAANEVNFSRLKEKVEDLEMSMQSLLHK
Sbjct:    1 MDYLIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENNKPSRPNNAAIIKAGPPPPVTAAKPKINVGKSIPPRPPQLLEKQASKPANTVKDDGISFDAPVNHKPLVGPNAGRAKRPGKKLPSNINIVTGNTEKPNDDEDSTPVSRSNSNENILIIDTTPAIKLKPKESSISNFDRNVDHVTKLKSKDTILTEKPIESPIGKDKPKDTIIPTSTVAPVEKEPEVSPLKPTQNFKANTLPKNVDVVKVDNANIASLKNENDHKNDIMKLKSKISDLEEKNTDLHKELLELRKYSNEQTNMLKIKINKLTNELDEEKTKRAANEVNFSRLKEKVEDLEMSMQSLLHK 513          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Planmine SMEST
Match: SMESG000001129.1 (SMESG000001129.1)

HSP 1 Score: 130.954 bits (328), Expect = 5.203e-33
Identity = 85/205 (41.46%), Postives = 105/205 (51.22%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKED-RRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGFGNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKE 684
            MD + E+DY A  ADEL++ KGDII SV   E GW  G L GKEGVFP NF K +K D +  S ++N   P  E+ N NTK                             KLKT + D K K   E  K  I        +     +V  I SY AEN DE+T+E+GDII V NK   D+GWW+G K  G+ G+FP NFV+P  E
Sbjct:    1 MDCIAEYDYSATHADELSLKKGDIIKSVIFFETGWKKGWLNGKEGVFPDNFVKVIKTDFKNTSNKENGTNPNVED-NLNTK----------------------------TKLKTHSSDQKTKTTKE--KSHI------NNSLNEPLIVEAIFSYKAENPDEITIEVGDIIKVLNKNLIDDGWWKGIKRTGEIGIFPSNFVQPFSE 168          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Planmine SMEST
Match: SMESG000001129.1 (SMESG000001129.1)

HSP 1 Score: 74.7146 bits (182), Expect = 7.183e-16
Identity = 42/81 (51.85%), Postives = 51/81 (62.96%), Query Frame = 1
Query:   73 MDYLIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSNFGKPVKED-RRKSQEDNLIIPQAEERNNNTK 312
            MD + E+DY A  ADEL++ KGDII SV   E GW  G L GKEGVFP NF K +K D +  S ++N   P  E+ N NTK
Sbjct:    1 MDCIAEYDYSATHADELSLKKGDIIKSVIFFETGWKKGWLNGKEGVFPDNFVKVIKTDFKNTSNKENGTNPNVED-NLNTK 80          

HSP 2 Score: 46.2098 bits (108), Expect = 7.018e-6
Identity = 29/67 (43.28%), Postives = 40/67 (59.70%), Query Frame = 1
Query:  523 HSYTAENSDELTLEIGDII-TVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENNKPSRPNNAA 720
            + Y+A ++DEL+L+ GDII +V   E    GW +G   NG+ GVFPDNFV+ IK +    S   N  
Sbjct:    7 YDYSATHADELSLKKGDIIKSVIFFE---TGWKKGW-LNGKEGVFPDNFVKVIKTDFKNTSNKENGT 69          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Planmine SMEST
Match: SMESG000073128.1 (SMESG000073128.1)

HSP 1 Score: 57.3806 bits (137), Expect = 3.197e-8
Identity = 28/69 (40.58%), Postives = 44/69 (63.77%), Query Frame = 1
Query:  472 EKKPKETTRTKDVVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPI 678
            E +  +T +TK   + +  Y  ++SDE+  E+G+IIT  + E+ DEGWW G   +G+ G+FP N+VE I
Sbjct:  547 ENQDTKTPKTKSA-KAVFEYECQDSDEIDFEVGEIIT--DIEEIDEGWWIGCNKSGKRGMFPSNYVELI 612          

HSP 2 Score: 50.0618 bits (118), Expect = 5.700e-6
Identity = 22/54 (40.74%), Postives = 32/54 (59.26%), Query Frame = 1
Query:  508 VVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFV 669
             V  ++SY A   DE++ E G+ I   N+ DE  GWW+G   +G  G+FP N+V
Sbjct:  644 TVVAVYSYHALQDDEISFEEGEHIYNVNQIDE--GWWQGETKDGDKGMFPSNYV 695          
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Planmine SMEST
Match: SMESG000004952.1 (SMESG000004952.1)

HSP 1 Score: 52.373 bits (124), Expect = 2.132e-7
Identity = 24/64 (37.50%), Postives = 40/64 (62.50%), Query Frame = 1
Query:  508 VVRVIHSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVEPIKEENNKP 699
            VVR I+SY A+++DEL+ E GD++ + +     + WW+ R +NG+ G+ P N+V    E  + P
Sbjct:   16 VVRAIYSYEAQSADELSFEEGDLLYIFDMISSQD-WWKAR-ANGKEGLIPSNYVSKQTESIDNP 77          
The following BLAST results are available for this feature:
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SH3KBP13.990e-2935.11SH3 domain containing kinase binding protein 1 [So... [more]
SH3KBP17.893e-2935.11SH3 domain containing kinase binding protein 1 [So... [more]
CD2AP1.128e-2636.44CD2 associated protein [Source:HGNC Symbol;Acc:HGN... [more]
SH3D212.014e-1829.65SH3 domain containing 21 [Source:HGNC Symbol;Acc:H... [more]
SH3KBP17.932e-1828.85SH3 domain containing kinase binding protein 1 [So... [more]
back to top
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nck-18.362e-1022.79NCK (Non-Catalytic region of tyrosine Kinase) adap... [more]
nck-19.340e-1023.88NCK (Non-Catalytic region of tyrosine Kinase) adap... [more]
nck-19.340e-1023.88NCK (Non-Catalytic region of tyrosine Kinase) adap... [more]
nck-19.340e-1023.88NCK (Non-Catalytic region of tyrosine Kinase) adap... [more]
cdap-29.720e-1046.97CD2AP homolog [Source:UniProtKB/TrEMBL;Acc:Q6A573... [more]
back to top
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cindr1.682e-1730.73gene:FBgn0027598 transcript:FBtr0085704[more]
cindr2.271e-1730.73gene:FBgn0027598 transcript:FBtr0310424[more]
drk5.477e-1024.89gene:FBgn0004638 transcript:FBtr0087695[more]
drk5.477e-1024.89gene:FBgn0004638 transcript:FBtr0087694[more]
drk5.477e-1024.89gene:FBgn0004638 transcript:FBtr0087698[more]
back to top
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cd2ap7.074e-2433.04CD2-associated protein [Source:ZFIN;Acc:ZDB-GENE-0... [more]
CR936282.11.507e-2331.25SH3-domain kinase binding protein 1 [Source:NCBI g... [more]
sh3kbp13.006e-2331.25SH3-domain kinase binding protein 1 [Source:ZFIN;A... [more]
sh3kbp13.014e-2331.25SH3-domain kinase binding protein 1 [Source:ZFIN;A... [more]
sh3d211.526e-2231.33SH3 domain containing 21 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc101.019e-2533.45leucine rich repeat containing 10 [Source:Xenbase;... [more]
tmprss91.512e-2530.94transmembrane serine protease 9 [Source:Xenbase;Ac... [more]
lrrc101.736e-2535.56leucine rich repeat containing 10 [Source:Xenbase;... [more]
tmprss92.290e-2434.74transmembrane serine protease 9 [Source:Xenbase;Ac... [more]
tmprss96.202e-2434.55transmembrane serine protease 9 [Source:Xenbase;Ac... [more]
back to top
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sh3kbp11.991e-2936.07SH3-domain kinase binding protein 1 [Source:MGI Sy... [more]
Sh3kbp14.066e-2936.07SH3-domain kinase binding protein 1 [Source:MGI Sy... [more]
Sh3kbp15.978e-2936.07SH3-domain kinase binding protein 1 [Source:MGI Sy... [more]
Cd2ap1.512e-2635.74CD2-associated protein [Source:MGI Symbol;Acc:MGI:... [more]
Cd2ap4.344e-2634.89CD2-associated protein [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of SH3 domain-containing kinase-binding protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96B97|SH3K1_HUMAN3.790e-2835.11SH3 domain-containing kinase-binding protein 1 OS=... [more]
sp|Q9Y5K6|CD2AP_HUMAN5.417e-2636.44CD2-associated protein OS=Homo sapiens OX=9606 GN=... [more]
sp|Q9JLQ0|CD2AP_MOUSE3.039e-2534.89CD2-associated protein OS=Mus musculus OX=10090 GN... [more]
sp|F1LRS8|CD2AP_RAT5.859e-2534.96CD2-associated protein OS=Rattus norvegicus OX=101... [more]
sp|Q925Q9|SH3K1_RAT3.332e-2432.29SH3 domain-containing kinase-binding protein 1 OS=... [more]
back to top
BLAST of SH3 domain-containing kinase-binding protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RWI94.197e-3438.28SH3 domain-containing kinase-binding protein 1 OS=... [more]
A0A2C9JR722.054e-3033.62Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9JR755.731e-3033.43Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9JR836.068e-3033.62Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A0L8H4C09.149e-3041.46Uncharacterized protein (Fragment) OS=Octopus bima... [more]
back to top
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sh3kbp11.018e-2435.45SH3-domain kinase binding protein 1 [Source:ZFIN;A... [more]
sh3d217.001e-2431.12SH3 domain containing 21 [Source:NCBI gene;Acc:103... [more]
cd2ap4.319e-2234.84CD2 associated protein [Source:NCBI gene;Acc:10302... [more]
cd2ap2.733e-2134.86CD2 associated protein [Source:NCBI gene;Acc:10302... [more]
itsn13.837e-1227.01intersectin 1 (SH3 domain protein) [Source:ZFIN;Ac... [more]
back to top
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008112.11.267e-1234.78pep scaffold:Pmarinus_7.0:GL482163:8897:24902:-1 g... [more]
ENSPMAT00000003067.12.379e-941.30pep scaffold:Pmarinus_7.0:GL477025:38822:89389:-1 ... [more]
grb2a4.702e-924.24growth factor receptor-bound protein 2a [Source:ZF... [more]
ABI11.608e-839.34abl interactor 1 [Source:HGNC Symbol;Acc:HGNC:1132... [more]
ENSPMAT00000009021.12.023e-842.59pep scaffold:Pmarinus_7.0:GL482604:596:7954:-1 gen... [more]
back to top
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
LSB34.997e-840.74Protein containing a C-terminal SH3 domain; binds ... [more]
YSC841.671e-636.54Actin-binding protein; involved in bundling of act... [more]
HSE13.352e-641.07Subunit of the endosomal Vps27p-Hse1p complex; com... [more]
RVS1674.294e-633.93Calmodulin-binding actin-associated protein; roles... [more]
LSB15.354e-632.56Negative regulator of actin nucleation-promoting f... [more]
back to top
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO387102.993e-1231.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297441.487e-927.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438726.775e-950.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO413031.064e-841.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO312901.442e-841.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sh3kbp13.384e-2832.09SH3 domain containing kinase binding protein 1 [So... [more]
cd2ap5.548e-2333.18CD2 associated protein [Source:NCBI gene;Acc:10115... [more]
sh3d211.352e-2129.24SH3 domain containing 21 [Source:NCBI gene;Acc:101... [more]
ENSORLT00000029133.12.727e-1728.91pep primary_assembly:ASM223467v1:15:615592:625392:... [more]
pacsin1a3.720e-1048.21protein kinase C and casein kinase substrate in ne... [more]
back to top
BLAST of SH3 domain-containing kinase-binding protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079662.10.000e+0100.00SMESG000079662.1[more]
SMESG000001129.15.203e-3341.46SMESG000001129.1[more]
SMESG000001129.17.183e-1651.85SMESG000001129.1[more]
SMESG000073128.13.197e-840.58SMESG000073128.1[more]
SMESG000004952.12.132e-737.50SMESG000004952.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020355 ID=SMED30020355|Name=SH3 domain-containing kinase-binding protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2068bp
AATAATTAAATTGTTTTAAATTATCAAATAATTACTTTTTCCTGCCTACT
GTTTGATCGGAAAATATTTGATATGGATTATTTAATAGAATTTGATTACG
ATGCTGATGAAGCTGATGAATTAACAATTCATAAAGGTGATATTATAAAT
AGTGTTAGGCCTCATGAAGATGGTTGGATGTATGGTATCCTAAGAGGAAA
AGAAGGTGTATTTCCGAGTAATTTTGGAAAACCTGTGAAAGAAGACCGAA
GAAAAAGTCAAGAGGACAATTTGATAATACCCCAAGCTGAGGAGAGAAAC
AACAACACCAAAGAGAACGATGTAGTAATTGAACAAACTCCACCTCCAAA
AAAGGTGACAGGTGTTGGATTCGGCAATATATTTAGCGGGGGCGAAATTA
AATTAAAAACCACTAATAAAGATAATAAGCCTAAGGTTATCAGTGAAGAG
GTGAAGCCTGAAATTTTACAAGAAAAGAAACCTAAAGAAACTACAAGAAC
TAAAGATGTTGTCAGAGTTATACACAGTTATACCGCTGAAAATTCAGATG
AGTTGACACTAGAGATTGGAGATATTATAACCGTTACTAATAAAGAAGAT
GAGGATGAAGGCTGGTGGAGAGGACGAAAATCGAATGGCCAAAGCGGAGT
TTTTCCTGATAATTTTGTTGAACCTATCAAAGAAGAAAATAACAAGCCTT
CTCGCCCAAATAATGCAGCAATTATCAAGGCCGGACCCCCACCGCCAGTA
ACGGCCGCAAAACCAAAGATTAATGTGGGTAAAAGCATCCCCCCTCGCCC
ACCTCAGTTGTTAGAAAAACAAGCCTCTAAACCAGCAAATACTGTAAAAG
ACGACGGAATCAGTTTCGACGCTCCAGTAAATCACAAACCGTTAGTAGGG
CCAAATGCTGGCCGCGCTAAAAGGCCGGGGAAAAAACTGCCTAGCAATAT
TAACATAGTAACAGGAAATACCGAAAAACCAAACGATGATGAGGATTCCA
CGCCCGTTTCTAGATCGAATTCTAATGAAAACATATTGATTATTGACACA
ACACCAGCAATAAAGCTTAAACCCAAAGAGAGTTCAATTTCCAATTTCGA
CAGAAATGTCGACCATGTGACGAAATTGAAATCTAAAGATACTATTTTAA
CTGAAAAGCCAATCGAATCACCAATTGGAAAAGACAAACCGAAAGATACA
ATTATACCTACTTCTACTGTGGCTCCTGTTGAAAAGGAACCGGAAGTATC
ACCGTTAAAACCCACACAAAATTTCAAAGCCAATACTTTGCCGAAAAATG
TCGACGTTGTCAAGGTTGACAATGCCAATATAGCTTCCTTGAAAAATGAA
AATGACCACAAAAATGATATTATGAAACTTAAATCAAAAATTTCTGATCT
CGAGGAGAAAAATACAGATTTACACAAAGAGCTATTGGAATTGCGCAAGT
ACTCAAATGAACAGACAAATATGTTGAAAATCAAAATAAATAAATTAACC
AATGAGCTGGATGAAGAAAAGACTAAAAGAGCTGCAAATGAGGTGAATTT
CAGCAGGCTGAAAGAAAAGGTGGAAGATCTAGAGATGTCAATGCAATCTT
TACTCCATAAGTGATAATGCAAGAAATCAAATGAAAAATAACAATATAAT
AAATGTTTCTGTTACTGTTGTTATTATTATCAATAATGTGATTTTGATTC
ACGATTGTTTTGATATAATACATATAAATCACCATAGTGACATAAATTTT
AGTGCCTGTTTTTTTGATTCGATTACATTGAGTAATTGTTTGTGCGTGTG
TGCGTGTGTGCGTGTGATTTGTACAAGCATTAGCTTCCTTGCTCTGCTCT
GTTTATCCCTTTGGAAAATCTTTTCAATGACGACATTGTTGATATCGTTT
CCTAACTTTCTAATTTTTGATCTATATCTAGTGAGATTTACAAGATGCAA
AATTACTGTGATGAATTCATTATTTTATATAAATTGTCTTATTAATTTTC
ATATCAATGTCGATTCCAATGTAAACTATACATTTGATAATAAATTATGT
TAGTCTCTTGAAAAAAAA
back to top

protein sequence of SMED30020355-orf-1

>SMED30020355-orf-1 ID=SMED30020355-orf-1|Name=SMED30020355-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=514bp
MDYLIEFDYDADEADELTIHKGDIINSVRPHEDGWMYGILRGKEGVFPSN
FGKPVKEDRRKSQEDNLIIPQAEERNNNTKENDVVIEQTPPPKKVTGVGF
GNIFSGGEIKLKTTNKDNKPKVISEEVKPEILQEKKPKETTRTKDVVRVI
HSYTAENSDELTLEIGDIITVTNKEDEDEGWWRGRKSNGQSGVFPDNFVE
PIKEENNKPSRPNNAAIIKAGPPPPVTAAKPKINVGKSIPPRPPQLLEKQ
ASKPANTVKDDGISFDAPVNHKPLVGPNAGRAKRPGKKLPSNINIVTGNT
EKPNDDEDSTPVSRSNSNENILIIDTTPAIKLKPKESSISNFDRNVDHVT
KLKSKDTILTEKPIESPIGKDKPKDTIIPTSTVAPVEKEPEVSPLKPTQN
FKANTLPKNVDVVKVDNANIASLKNENDHKNDIMKLKSKISDLEEKNTDL
HKELLELRKYSNEQTNMLKIKINKLTNELDEEKTKRAANEVNFSRLKEKV
EDLEMSMQSLLHK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR028445CD2AP
IPR036028SH3-like_dom_sf
IPR001452SH3_domain
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 465..513
NoneNo IPR availableCOILSCoilCoilcoord: 426..463
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 1..58
e-value: 2.9E-17
score: 64.0
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 138..216
e-value: 3.8E-23
score: 82.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 53..79
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 204..319
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 53..68
NoneNo IPR availablePANTHERPTHR14167SH3 DOMAIN-CONTAININGcoord: 84..500
NoneNo IPR availablePANTHERPTHR14167SH3 DOMAIN-CONTAININGcoord: 2..76
IPR001452SH3 domainPRINTSPR00452SH3DOMAINcoord: 178..187
score: 37.9
coord: 190..202
score: 41.87
coord: 159..174
score: 35.43
IPR001452SH3 domainSMARTSM00326SH3_2coord: 145..203
e-value: 2.4E-21
score: 86.9
coord: 1..56
e-value: 2.4E-12
score: 57.0
IPR001452SH3 domainPFAMPF14604SH3_9coord: 149..200
e-value: 9.8E-15
score: 54.2
coord: 7..51
e-value: 2.0E-12
score: 46.8
IPR001452SH3 domainPROSITEPS50002SH3coord: 142..204
score: 27.923
IPR001452SH3 domainPROSITEPS50002SH3coord: 1..57
score: 17.903
IPR028445CD2-associated proteinPANTHERPTHR14167:SF23CD2-ASSOCIATED PROTEINcoord: 2..76
IPR028445CD2-associated proteinPANTHERPTHR14167:SF23CD2-ASSOCIATED PROTEINcoord: 84..500
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 146..224
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 5..59