General transcription factor 3C polypeptide 5

Overview
NameGeneral transcription factor 3C polypeptide 5
Smed IDSMED30020341
Length (bp)2436
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of General transcription factor 3C polypeptide 5 (SMED30020341) t-SNE clustered cells

Violin plots show distribution of expression levels for General transcription factor 3C polypeptide 5 (SMED30020341) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of General transcription factor 3C polypeptide 5 (SMED30020341) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for General transcription factor 3C polypeptide 5 (SMED30020341) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020341

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30020341SMESG000017479.1 dd_Smed_v4_2071_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020341SMESG000017479.1 dd_Smed_v4_2071_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Human
Match: GTF3C5 (general transcription factor IIIC subunit 5 [Source:HGNC Symbol;Acc:HGNC:4668])

HSP 1 Score: 87.8113 bits (216), Expect = 2.225e-17
Identity = 97/452 (21.46%), Postives = 180/452 (39.82%), Query Frame = 1
Query:  139 VINYPLIINNEENALNSLGGVNTISKILTSNLFDNQKKRIPLYLRPNMIYSKPLLSEHSETKGILMKLRQLRNKKTG--------EIKLVPEILGYSKIMYEYNALCDYQY-NPHTSPNDALLDCPSVFYDKLLPSKTMMDISEFDDYMNCNKEIFLPPLIFTKYEKPAE-----------------------LRIKVLEYPKSVI--------VKKKDLKFETQM-----TN------SDLLIELFSMQPIWTSSNLDEAIRETNHSNIYKVRKLRSEIANHVTKGPWRRTWIRKDYDHETLPESRMFQIIEFRANA------SHINVITKFLRSSRTKTEPNAQIQMSS---------TKIGP-------------------------NYLPSTVNCFYQLCHVDIGEVSELVAK-EPLPPAIHAEHGWFSPNFGTRVRAAINKFITEKV 1218
             + YP ++ +    L +LGG   +S+I     + +  KR+ LY RP   Y  P+ +    T  +L+++R+   ++ G        E+    EILG    +Y++  + D+QY   HT          +  YDK+L     M   E + + +    +++PP IF++ + P +                       + +     P + I        V K+ L+   Q      TN       + L +LF ++PIW+ + +   I  + H +  KV  L   IA ++  GPWR  WIR  YD    P+++++Q+++FR         +  ++  K  RS+   + P    + SS           +GP                           LP     FYQLC +++ E+ +++ + +    +     GW  P     +R  ++  I + +
Sbjct:   26 CVEYPGVVRDVAKMLPTLGGEEGVSRI-----YADPTKRLELYFRPKDPYCHPVCANRFSTSSLLLRIRKRTRRQKGVLGTEAHSEVTFDMEILGIISTIYKFQGMSDFQYLAVHTEAGGKH----TSMYDKVL-----MLRPEKEAFFHQELPLYIPPPIFSRLDAPVDYFYRPETQHREGYNNPPISGENLIGLSRARRPHNAIFVNFEDEEVPKQPLEAAAQTWRRVCTNPVDRKVEEELRKLFDIRPIWSRNAVKANI--SVHPDKLKV--LLPFIAYYMITGPWRSLWIRFGYDPRKNPDAKIYQVLDFRIRCGMKHGYAPSDLPVKAKRSTYNYSLPITVKKTSSQLVTMHDLKQGLGPSGTSGARKPASSKYKLKDSVYIFREGALPPYRQMFYQLCDLNVEELQKIIHRNDGAENSCTERDGWCLPKTSDELRDTMSLMIRQTI 459          
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Human
Match: GTF3C5 (general transcription factor IIIC subunit 5 [Source:HGNC Symbol;Acc:HGNC:4668])

HSP 1 Score: 87.4261 bits (215), Expect = 3.199e-17
Identity = 76/314 (24.20%), Postives = 137/314 (43.63%), Query Frame = 1
Query:  142 INYPLIINNEENALNSLGGVNTISKILTSNLFDNQKKRIPLYLRPNMIYSKPLLSEHSETKGILMKLRQLRNKKTG--------EIKLVPEILGYSKIMYEYNALCDYQY-NPHTSPNDALLDCPSVFYDKLLPSKTMMDISEFDDYMNCNKEIFLPPLIFTKYEKPAE-----------------------LRIKVLEYPKSVI--------VKKKDLKFETQM-----TN------SDLLIELFSMQPIWTSSNLDEAIRETNHSNIYKVRKLRSEIANHVTKGPWRRTWIRKDYDHETLPESRMFQIIEFR 930
            + YP ++ +    L +LGG   +S+I     + +  KR+ LY RP   Y  P+ +    T  +L+++R+   ++ G        E+    EILG    +Y++  + D+QY   HT          +  YDK+L     M   E + + +    +++PP IF++ + P +                       + +     P + I        V K+ L+   Q      TN       + L +LF ++PIW+ + +   I  + H +  KV  L   IA ++  GPWR  WIR  YD    P+++++Q+++FR
Sbjct:   27 VEYPGVVRDVAKMLPTLGGEEGVSRI-----YADPTKRLELYFRPKDPYCHPVCANRFSTSSLLLRIRKRTRRQKGVLGTEAHSEVTFDMEILGIISTIYKFQGMSDFQYLAVHTEAGGKH----TSMYDKVL-----MLRPEKEAFFHQELPLYIPPPIFSRLDAPVDYFYRPETQHREGYNNPPISGENLIGLSRARRPHNAIFVNFEDEEVPKQPLEAAAQTWRRVCTNPVDRKVEEELRKLFDIRPIWSRNAVKANI--SVHPDKLKV--LLPFIAYYMITGPWRSLWIRFGYDPRKNPDAKIYQVLDFR 322          
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Human
Match: GTF3C5 (general transcription factor IIIC subunit 5 [Source:HGNC Symbol;Acc:HGNC:4668])

HSP 1 Score: 70.0922 bits (170), Expect = 8.382e-12
Identity = 64/273 (23.44%), Postives = 115/273 (42.12%), Query Frame = 1
Query:  139 VINYPLIINNEENALNSLGGVNTISKILTSNLFDNQKKRIPLYLRPNMIYSKPLLSEHSETKGILMKLRQLRNKKTG--------EIKLVPEILGYSKIMYEYNALCDYQY-NPHTSPNDALLDCPSVFYDKLLPSKTMMDISEFDDYMNCNKEIFLPPLIFTKYEKPAELRIKVLEYPKSVIVKKKDLKFETQMTNSDLLIELFSMQPIWTSSNLDEAIRETNHSNIYKVRKLRSEIANHVTKGPWRRTWIRKDYDHETLPESRMFQIIEFR 930
             + YP ++ +    L +LGG   +S+I     + +  KR+ LY RP   Y  P+ +    T  +L+++R+   ++ G        E+    EILG    +Y++  + D+QY   HT          +  YDK+L     M   E + + +    +++PP IF++ + P +   +                 ETQ        E ++  PI +  NL    R     N   V     E+  H+        WIR  YD    P+++++Q+++FR
Sbjct:   26 CVEYPGVVRDVAKMLPTLGGEEGVSRI-----YADPTKRLELYFRPKDPYCHPVCANRFSTSSLLLRIRKRTRRQKGVLGTEAHSEVTFDMEILGIISTIYKFQGMSDFQYLAVHTEAGGKH----TSMYDKVL-----MLRPEKEAFFHQELPLYIPPPIFSRLDAPVDYFYRP----------------ETQHR------EGYNNPPI-SGENLIGLSRARRPHNAIFVNFEDEEVPKHL--------WIRFGYDPRKNPDAKIYQVLDFR 253          
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Human
Match: GTF3C5 (general transcription factor IIIC subunit 5 [Source:HGNC Symbol;Acc:HGNC:4668])

HSP 1 Score: 52.7582 bits (125), Expect = 8.470e-7
Identity = 35/143 (24.48%), Postives = 67/143 (46.85%), Query Frame = 1
Query:  220 LTSNLFDNQKKRIPLYLRPNMIYSKPLLSEHSETKGILMKLRQLRNKKTG--------EIKLVPEILGYSKIMYEYNALCDYQY-NPHTSPNDALLDCPSVFYDKLLPSKTMMDISEFDDYMNCNKEIFLPPLIFTKYEKPAE 621
            +T  ++ +  KR+ LY RP   Y  P+ +    T  +L+++R+   ++ G        E+    EILG    +Y++  + D+QY   HT          +  YDK+L     M   E + + +    +++PP IF++ + P +
Sbjct:    1 MTRAIYADPTKRLELYFRPKDPYCHPVCANRFSTSSLLLRIRKRTRRQKGVLGTEAHSEVTFDMEILGIISTIYKFQGMSDFQYLAVHTEAGGKH----TSMYDKVL-----MLRPEKEAFFHQELPLYIPPPIFSRLDAPVD 134          
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Human
Match: GTF3C5 (general transcription factor IIIC subunit 5 [Source:HGNC Symbol;Acc:HGNC:4668])

HSP 1 Score: 50.447 bits (119), Expect = 3.631e-6
Identity = 25/73 (34.25%), Postives = 45/73 (61.64%), Query Frame = 1
Query:  712 LIELFSMQPIWTSSNLDEAIRETNHSNIYKVRKLRSEIANHVTKGPWRRTWIRKDYDHETLPESRMFQIIEFR 930
            L +LF ++PIW+ + +   I  + H +  K++ L   IA ++  GPWR  WIR  YD    P+++++Q+++FR
Sbjct:  129 LRKLFDIRPIWSRNAVKANI--SVHPD--KLKVLLPFIAYYMITGPWRSLWIRFGYDPRKNPDAKIYQVLDFR 197          
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Celegans
Match: tftc-5 (Transcription Factor ThreeC subunit (GTF3C homolog) [Source:UniProtKB/TrEMBL;Acc:Q22093])

HSP 1 Score: 81.2629 bits (199), Expect = 5.976e-16
Identity = 100/422 (23.70%), Postives = 172/422 (40.76%), Query Frame = 1
Query:  130 EFYVINYPLIINNEENALNSLGGVNTISKILTSNLFDNQKKRIPLYLRPNMIYSKPLLSEHSE----TKGILMKLRQLRNKKTGEIKLVPEILGYSKIMYEYNALCDYQYNPHTSPNDALLDCPSVFYD---KLLPSKTMMDISEFDDYMNCNKEIFLPPLIFTKYEKPAE----------------------LRIKVLEYPKSVIV-KKKDLKFETQMTNSD-------------LLIELFSMQPIWTSSNLDEAIRETNHSNIYKVRKLRSEIANHVTKGPWRRTWIRKDYDHETLPESRMFQ--IIEFRANASHINVITKFLRSSRTKT-EPNAQIQMSSTKI-GPNYLPSTVNCFYQLCHVDIGE-VSELVA----KEPLPPAIHAEHGWFSPNFGTRVRAAINKFI---TEKVEFLM 1230
            +  +I YP I+ N + AL ++GG+  IS+    + F+N    + L   P+  Y+  +++E       + G L  + ++R KK    K+    LG    +Y ++ +CD+QY P        + C   F D   KL+P+     +S +D   +    +FLPP  F++Y  P+                         ++V     SV V  K++   E      D             LL ELF  +P+WT   L    R  +      +R +  + A ++  GPW R W +  YD  T     ++Q  ++ FR + S        + S R +T    A +    T +  P  LP     +Y +  V + + ++ELVA      P  P    + GW       ++R  I + +   + ++E LM
Sbjct:   17 QLVLIKYPGIVKNVDKALQTMGGLQLISQ----SHFNNHS--LELSHTPDNPYTSRIMAERKPQDNVSSGTLHLVMKVRRKKIDPTKIKTSFLGLVNTVYTFDVMCDFQYLPLKK----RVGC-DTFEDLIPKLIPTDIASALSWWDASESVATPLFLPPYQFSRYLTPSTKILGRETDHTEKTKNAQKKGYGQNLRVERKALSVTVNAKEEFPLEPSQEAVDEAMFRCKHDEPHRLLRELFDERPMWTRMGLLYRTRIDDSL----LRSILQKYAFYILSGPWGRLWCKFGYDPRTDRNGGLYQTIMVSFRQHGSIPERQRLKVSSDRAQTINHTADVSEPVTYMYEPGKLPRIRQMWYCVMDVRLPQAMNELVAVVENNTPPTPEEVRDKGWLPNTLLEKIRDLIKEDVARTSAELEGLM 423          
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Fly
Match: l(2)37Cd (gene:FBgn0086445 transcript:FBtr0081156)

HSP 1 Score: 103.219 bits (256), Expect = 9.869e-23
Identity = 98/418 (23.44%), Postives = 171/418 (40.91%), Query Frame = 1
Query:  121 PNIEFYVINYPLIINNEENALNSLGGVNTISKILTSNLFDNQKKRIPLYLRPNMIYSKPLLSEHSETKGILMKLRQLRNKKTGEI--KLVPEILGYSKIMYEYNALCDYQYNP--HTSPNDALLDCPSVFY--DKLLPSKTMMDISEFDDYMNCNKEIFLPPLIFTKYE---------KPAE--------LRIKVLEYPKSVIVKKKDLKFETQMTNSD---------------LLIELFSMQPIWTSSNLDEAIRETNHSNIYKVRKLRSEIANHVTKGPWRRTWIRKDYDHETLPESRMFQIIEFR----ANASHINVITKFLRSSRTKTEPNAQIQMSSTKI---------GPNYLPSTVNCFYQLCHVDIGEVSELVAKEPLP---PAIHAEHGWFSPNFGTRVRAAINKFITE 1212
            P  E+ +I YP  + N +  + +LGG+  +SK+L   +     KR+ L+  P   Y+KP   + ++  G+L+ +   R+KK  +   +    +LG+    + +  LCD+QY P   T  +D       + Y  D+L P  T    ++ D +   + ++   P +FT  +          P+E        ++ K     + V+       F TQ  + +               L+ +LF   PIWT   L      TN     K++ +   +A + + GPWR  ++R  YD      SR +Q  +FR       S      KF++  R    P A I+   + +           + LP +  C  + C V +  + E++ K P P      +   GW  P F  +VR  +   I+E
Sbjct:    9 PQKEYELIEYPGRVVNPDRMIATLGGIINVSKVLGDEV-----KRLALHFHPENPYNKPTFGDCTDKTGVLLSITVRRHKKDKQRPPEYFVRVLGHCSRSFTFETLCDFQYLPLWSTPKSDNANAAQELTYALDQLKPKNT----TDLDYFKRRHSQLLALPELFTHVDTVYAGTYRIDPSEDGQHEVLGVQSKSSYDNQGVVSFNMVDSFPTQADSQNLKRLKVKYVSDEQLALVKKLFDDCPIWTRIALQYESGLTND----KLKCITPSLAFYFSNGPWRTLYVRFGYDPRKDFNSRYYQTFDFRLRFSTGLSEFVYAKKFVKQRRAANAPFAPIEDRVSDLVQDIDYPYFDEHKLPRSRQCMLRYCDVRMTRIQEMLEKIPTPLTGAVCNERTGWLPPGFDAQVRQIVCASISE 413          
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Zebrafish
Match: gtf3c5 (general transcription factor IIIC, polypeptide 5 [Source:ZFIN;Acc:ZDB-GENE-060810-66])

HSP 1 Score: 98.5969 bits (244), Expect = 5.540e-21
Identity = 97/464 (20.91%), Postives = 179/464 (38.58%), Query Frame = 1
Query:   91 LMNNYSTLTIPNIEFYVINYPLIINNEENALNSLGGVNTISKILTSNLFDNQKKRIPLYLRPNMIYSKPLLS-EHSETKGILMKLRQLRNKKTGEIKLVPEILGYSKIMYEYNALCDYQY-NPHTSPNDALLDCPSVFYDKLLPSKTMMDISEFDDYMNCNKEIFLPPLIFTKYEKPAELRIKVLEYPKSVIVKKKDLKFETQMTNSDLLI-------------------------------------------------ELFSMQPIWTSSNLDEAIRETNHSNIYKVRKLRSEIANHVTKGPWRRTWIRKDYDHETLPESRMFQIIEFR-------------------ANASHINVITKFLRSSRTKTEPNAQIQMSSTKIGP----------------NYLPSTVNCFYQLCHVDIGEVSELVAKEPLPPAIHAEH-GWFSPNFGTRVRAAINKFITEKVE 1221
            ++ N +TL + +     + YP ++NN    L+S+GG   +SK      + +  KRI L  RP   +  P     +S T  +L   R+ R     E ++  EI+G     Y++  + D+QY   H +P    +      YDK++  K      E  ++ +    +F+PP IF++ + P +       + +  ++  KD  F++ +    ++                                                  +LF  +PIW+ +    A++     +  K++ L   +A +   GPWR  W+R  YD   +P ++++Q+++FR                    +A H +  T F R+           Q S++  GP                  LP     FYQLC +D+ ++  L+ K      +  E  GW  P+    +R  I+  I + V+
Sbjct:   35 VLGNTATLALSDTNLVCVEYPAVVNNVNRMLDSIGGEQGVSKT-----YADSTKRIELRFRPGDPFCHPAYGNRYSSTNLLLRVRRRTRKGNNAETQISMEIVGLIGTTYKFQGMADFQYLASHNNPEGNQVS----LYDKIILRK-----PEKKEFYDNPVPLFIPPPIFSRLDMPVDY------FYRPDVMHNKDTAFQSALMKDHIIAPNRARRPNNAIFVNFDDKTIPSEPLEAAVTTWRKLCVHPNDLKAEKKIKQLFEKRPIWSRN----AVKANIDIHPEKMKHLLPFVAYYALTGPWRSLWVRFGYDPRKIPGAKIYQVLDFRIRYGMKHGFGVNDMPVKSKRSAYHYSRPTTFNRAVPLPASVTDIPQESTSSSGPVTAKYMLKESIYIFREGMLPPYRQMFYQLCDLDVEKIQNLIHKNDGKEEVCDERDGWCVPHTADELRNIISGMIQQYVK 474          
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Xenopus
Match: GTF3C5 (general transcription factor IIIC subunit 5 [Source:NCBI gene;Acc:100492614])

HSP 1 Score: 78.1814 bits (191), Expect = 2.388e-14
Identity = 99/469 (21.11%), Postives = 184/469 (39.23%), Query Frame = 1
Query:   94 MNNYSTLTIPNIEFYV-INYPLIINNEENALNSLGGVNTISKILTSNLFDNQKKRIPLYLRPNMIYSKPLLSEHSETKGILMKLRQLRN----------KKTGEIKLVPEILGYSKIMYEYNALCDYQYNPHTSPNDALLDCPSVFYDKLLPSKTMMDISEFDDYMNCNKEIFLPPLIFTKYEKPAE-----------------------LRIKVLEYPKSVIVK------------KKDLKFETQMTNSDL-------LIELFSMQPIWTSSNLDEAIRETNHSNIYKVRKLRSEIANHVTKGPWRRTWIRKDYDHETLPESRMFQIIEFRANA------SHINVITKFLRSSR------TKTEPNAQI----------------QMSSTKIGPNY--------------LPSTVNCFYQLCHVDIGEVSELVAKEPLPPAIHAEH-GWFSPNFGTRVRAAINKFITE 1212
            M   +T+ +P  +  V + YP ++ +    L +LGG   +SK      + +  KR+ LY RPN  Y  PL      T  +++++++             + T E K+  EI+G    +Y++  + D+QY       D      +  YDK+L  K      E +D+ N    + +PP IF++ +   +                       + +     P + I              +  +K  T+M  + +       + +LF+ +PIW+ +    AI+     +  K++ L   +A ++  GPWR  W+R  YD    PE++++Q+++FR         +  ++  K  RS+       T  +P  Q+                    TK G N               LP     FYQLC +++  + +++       A   E  GW  P    ++R A++  I +
Sbjct:    8 MEGSATVILPRTKPMVCVEYPGLVRDVGKMLRTLGGEEGVSKT-----YADPSKRLELYFRPNDPYCHPLCGNRFPTTTMILRVKKKVRRKKAPDPGAPEPTEEGKISLEIIGVVGTVYKFQGMSDFQYLAFKQDPDGNR---TSLYDKVLLCK-----PEKEDFFNQEIALHIPPPIFSRLDNCVDYFYRPDVNHREGYRLPQVSNDNLIGLSRARRPHNAIFVSFEEAEIPNEPLQPAVKNWTKMCTNPMDKQAEEEMRQLFTNRPIWSRN----AIKANISVHPDKLKLLLPIVAYYMLTGPWRSLWVRFGYDPRKNPEAKIYQVLDFRIRCGVKYGYAPNDMPVKAKRSTYNYSLPITLKKPAPQVVSVQDLKQGLAAPSSNTPGGTKPGFNKYKLKESIYIFQEGNLPPYRQMFYQLCDLNVDSLRDIIQMNEGAEAECTERDGWCLPKTSEKLRDAMSLMIKQ 459          
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Xenopus
Match: GTF3C5 (general transcription factor IIIC subunit 5 [Source:NCBI gene;Acc:100492614])

HSP 1 Score: 78.1814 bits (191), Expect = 2.549e-14
Identity = 99/469 (21.11%), Postives = 184/469 (39.23%), Query Frame = 1
Query:   94 MNNYSTLTIPNIEFYV-INYPLIINNEENALNSLGGVNTISKILTSNLFDNQKKRIPLYLRPNMIYSKPLLSEHSETKGILMKLRQLRN----------KKTGEIKLVPEILGYSKIMYEYNALCDYQYNPHTSPNDALLDCPSVFYDKLLPSKTMMDISEFDDYMNCNKEIFLPPLIFTKYEKPAE-----------------------LRIKVLEYPKSVIVK------------KKDLKFETQMTNSDL-------LIELFSMQPIWTSSNLDEAIRETNHSNIYKVRKLRSEIANHVTKGPWRRTWIRKDYDHETLPESRMFQIIEFRANA------SHINVITKFLRSSR------TKTEPNAQI----------------QMSSTKIGPNY--------------LPSTVNCFYQLCHVDIGEVSELVAKEPLPPAIHAEH-GWFSPNFGTRVRAAINKFITE 1212
            M   +T+ +P  +  V + YP ++ +    L +LGG   +SK      + +  KR+ LY RPN  Y  PL      T  +++++++             + T E K+  EI+G    +Y++  + D+QY       D      +  YDK+L  K      E +D+ N    + +PP IF++ +   +                       + +     P + I              +  +K  T+M  + +       + +LF+ +PIW+ +    AI+     +  K++ L   +A ++  GPWR  W+R  YD    PE++++Q+++FR         +  ++  K  RS+       T  +P  Q+                    TK G N               LP     FYQLC +++  + +++       A   E  GW  P    ++R A++  I +
Sbjct:    8 MEGSATVILPRTKPMVCVEYPGLVRDVGKMLRTLGGEEGVSKT-----YADPSKRLELYFRPNDPYCHPLCGNRFPTTTMILRVKKKVRRKKAPDPGAPEPTEEGKISLEIIGVVGTVYKFQGMSDFQYLAFKQDPDGNR---TSLYDKVLLCK-----PEKEDFFNQEIALHIPPPIFSRLDNCVDYFYRPDVNHREGYRLPQVSNDNLIGLSRARRPHNAIFVSFEEAEIPNEPLQPAVKNWTKMCTNPMDKQAEEEMRQLFTNRPIWSRN----AIKANISVHPDKLKLLLPIVAYYMLTGPWRSLWVRFGYDPRKNPEAKIYQVLDFRIRCGVKYGYAPNDMPVKAKRSTYNYSLPITLKKPAPQVVSVQDLKQGLAAPSSNTPGGTKPGFNKYKLKESIYIFQEGNLPPYRQMFYQLCDLNVDSLRDIIQMNEGAEAECTERDGWCLPKTSEKLRDAMSLMIKQ 459          
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Xenopus
Match: GTF3C5 (general transcription factor IIIC subunit 5 [Source:NCBI gene;Acc:100492614])

HSP 1 Score: 77.7962 bits (190), Expect = 2.567e-14
Identity = 74/332 (22.29%), Postives = 141/332 (42.47%), Query Frame = 1
Query:   94 MNNYSTLTIPNIEFYV-INYPLIINNEENALNSLGGVNTISKILTSNLFDNQKKRIPLYLRPNMIYSKPLLSEHSETKGILMKLRQLRN----------KKTGEIKLVPEILGYSKIMYEYNALCDYQYNPHTSPNDALLDCPSVFYDKLLPSKTMMDISEFDDYMNCNKEIFLPPLIFTKYEKPAE-----------------------LRIKVLEYPKSVIVK------------KKDLKFETQMTNSDL-------LIELFSMQPIWTSSNLDEAIRETNHSNIYKVRKLRSEIANHVTKGPWRRTWIRKDYDHETLPESRMFQIIEFR 930
            M   +T+ +P  +  V + YP ++ +    L +LGG   +SK      + +  KR+ LY RPN  Y  PL      T  +++++++             + T E K+  EI+G    +Y++  + D+QY       D      +  YDK+L  K      E +D+ N    + +PP IF++ +   +                       + +     P + I              +  +K  T+M  + +       + +LF+ +PIW+ +    AI+     +  K++ L   +A ++  GPWR  W+R  YD    PE++++Q+++FR
Sbjct:    1 MEGSATVILPRTKPMVCVEYPGLVRDVGKMLRTLGGEEGVSKT-----YADPSKRLELYFRPNDPYCHPLCGNRFPTTTMILRVKKKVRRKKAPDPGAPEPTEEGKISLEIIGVVGTVYKFQGMSDFQYLAFKQDPDGNR---TSLYDKVLLCK-----PEKEDFFNQEIALHIPPPIFSRLDNCVDYFYRPDVNHREGYRLPQVSNDNLIGLSRARRPHNAIFVSFEEAEIPNEPLQPAVKNWTKMCTNPMDKQAEEEMRQLFTNRPIWSRN----AIKANISVHPDKLKLLLPIVAYYMLTGPWRSLWVRFGYDPRKNPEAKIYQVLDFR 315          
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Xenopus
Match: GTF3C5 (general transcription factor IIIC subunit 5 [Source:NCBI gene;Acc:100492614])

HSP 1 Score: 76.2554 bits (186), Expect = 8.089e-14
Identity = 98/465 (21.08%), Postives = 183/465 (39.35%), Query Frame = 1
Query:  106 STLTIPNIEFYV-INYPLIINNEENALNSLGGVNTISKILTSNLFDNQKKRIPLYLRPNMIYSKPLLSEHSETKGILMKLRQLRN----------KKTGEIKLVPEILGYSKIMYEYNALCDYQYNPHTSPNDALLDCPSVFYDKLLPSKTMMDISEFDDYMNCNKEIFLPPLIFTKYEKPAE-----------------------LRIKVLEYPKSVIVK------------KKDLKFETQMTNSDL-------LIELFSMQPIWTSSNLDEAIRETNHSNIYKVRKLRSEIANHVTKGPWRRTWIRKDYDHETLPESRMFQIIEFRANA------SHINVITKFLRSSR------TKTEPNAQI----------------QMSSTKIGPNY--------------LPSTVNCFYQLCHVDIGEVSELVAKEPLPPAIHAEH-GWFSPNFGTRVRAAINKFITE 1212
            +T+ +P  +  V + YP ++ +    L +LGG   +SK      + +  KR+ LY RPN  Y  PL      T  +++++++             + T E K+  EI+G    +Y++  + D+QY       D      +  YDK+L  K      E +D+ N    + +PP IF++ +   +                       + +     P + I              +  +K  T+M  + +       + +LF+ +PIW+ +    AI+     +  K++ L   +A ++  GPWR  W+R  YD    PE++++Q+++FR         +  ++  K  RS+       T  +P  Q+                    TK G N               LP     FYQLC +++  + +++       A   E  GW  P    ++R A++  I +
Sbjct:   11 ATVILPRTKPMVCVEYPGLVRDVGKMLRTLGGEEGVSKT-----YADPSKRLELYFRPNDPYCHPLCGNRFPTTTMILRVKKKVRRKKAPDPGAPEPTEEGKISLEIIGVVGTVYKFQGMSDFQYLAFKQDPDGNR---TSLYDKVLLCK-----PEKEDFFNQEIALHIPPPIFSRLDNCVDYFYRPDVNHREGYRLPQVSNDNLIGLSRARRPHNAIFVSFEEAEIPNEPLQPAVKNWTKMCTNPMDKQAEEEMRQLFTNRPIWSRN----AIKANISVHPDKLKLLLPIVAYYMLTGPWRSLWVRFGYDPRKNPEAKIYQVLDFRIRCGVKYGYAPNDMPVKAKRSTYNYSLPITLKKPAPQVVSVQDLKQGLAAPSSNTPGGTKPGFNKYKLKESIYIFQEGNLPPYRQMFYQLCDLNVDSLRDIIQMNEGAEAECTERDGWCLPKTSEKLRDAMSLMIKQ 458          
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Xenopus
Match: GTF3C5 (general transcription factor IIIC subunit 5 [Source:NCBI gene;Acc:100492614])

HSP 1 Score: 69.3218 bits (168), Expect = 1.244e-11
Identity = 78/337 (23.15%), Postives = 141/337 (41.84%), Query Frame = 1
Query:   88 YLMNNYSTLTIPNIEFYV-INYPLIINNEENALNSLGGVNTISKILTSNLFDNQKKRIPLYLRPNMIYSKPLLSEHSETKGILMKLRQLRN----------KKTGEIKLVPEILGYSKIMYEYNALCDYQYNPHTSPNDALLDCPSVFYDKLLPSKTMMDISEFDDYMNCNKEIFLPPLIFTKYEKPAELRIKVLEYPKSVIVKKKDLKFETQMTNSDLL--------------------IELFSMQPI---WT-------SSNLDEAIRE--TNH---------SNIY----KVRKLRSEIANHVTKGPWRRTWIRKDYDHETLPESRMFQIIEFR 930
            Y     +T+ +P  +  V + YP ++ +    L +LGG   +SK      + +  KR+ LY RPN  Y  PL      T  +++++++             + T E K+  EI+G    +Y++  + D+QY       D      +  YDK+L  K      E +D+ N    + +PP IF++ +         ++Y     V  ++     Q++N +L+                    I    +QP    WT           +E +R+  TN          +NI     K++ L   +A ++  GPWR  W+R  YD    PE++++Q+++FR
Sbjct:    9 YSNTGSATVILPRTKPMVCVEYPGLVRDVGKMLRTLGGEEGVSKT-----YADPSKRLELYFRPNDPYCHPLCGNRFPTTTMILRVKKKVRRKKAPDPGAPEPTEEGKISLEIIGVVGTVYKFQGMSDFQYLAFKQDPDGNR---TSLYDKVLLCK-----PEKEDFFNQEIALHIPPPIFSRLD-------NCVDYFYRPDVNHREGYRLPQVSNDNLIGLSRARRPHNAIFVSFEEAEIPNEPLQPAVKNWTKMCTNPMDKQAEEEMRQLFTNRPIWSRNAIKANISVHPDKLKLLLPIVAYYMLTGPWRSLWVRFGYDPRKNPEAKIYQVLDFR 325          
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Mouse
Match: Gtf3c5 (general transcription factor IIIC, polypeptide 5 [Source:MGI Symbol;Acc:MGI:1917489])

HSP 1 Score: 82.8037 bits (203), Expect = 5.731e-16
Identity = 93/452 (20.58%), Postives = 177/452 (39.16%), Query Frame = 1
Query:  139 VINYPLIINNEENALNSLGGVNTISKILTSNLFDNQKKRIPLYLRPNMIYSKPLLSEHSETKGILMKLRQLRNKKTG--------EIKLVPEILGYSKIMYEYNALCDYQY-NPHTSPNDALLDCPSVFYDKLLPSKTMMDISEFDDYMNCNKEIFLPPLIFTKYEKPAEL----------------------------------------RIKVLEYPKSVIVK--KKDLKFETQMTNSDLLIELFSMQPIWTSSNLDEAIRETNHSNIYKVRKLRSEIANHVTKGPWRRTWIRKDYDHETLPESRMFQIIEFRANA------SHINVITKFLRSS----------RTKTEPNAQIQMS-----STKIGP-------------------NYLPSTVNCFYQLCHVDIGEVSELVAKEPLPPAIHAEH-GWFSPNFGTRVRAAINKFITEKV 1218
             + YP ++ NE   L +LGG  ++S+I T     +  KR+ LY RP   Y  P+ +    T  +L+++R+   ++ G        ++    EI+G    +Y++  + D+QY   HT      +      YD++L     M   E +++ +    +++PP IF++ + P +                                           +V E P    V+  KK           + L +LF ++P+W+ +    A++     +  K++ L   +A ++  GPWR  WIR  YD    P+++++Q+++FR            ++  K  RS+          +T  +P     +      S   GP                     LP     FYQLC +++ E+ ++V +      +  E  GW  P     +R  ++  I + +
Sbjct:   26 CVEYPGVVRNEAKMLQTLGGEESVSRIYT-----DPTKRLELYFRPKDPYCHPVCANRFSTSSLLLRIRKRTRRRRGVLGDEAHPQVTFNLEIIGIISTIYKFQGMSDFQYLAVHTEAGGKHVS----MYDRVL-----MRKPEKEEFFHQELPLYIPPPIFSRLDTPVDYFYRPETQHREGYHNPTISGENLIGLSRARRPHNAIFVNFEDTEVPEQPLEAAVQTWKKACTNPIDQKVEEELRKLFDIRPVWSRN----AVKSNVSVHPDKLKILLPYMAYYMITGPWRSLWIRFGYDPRKHPDAKIYQVLDFRIRCGMKYGYGSRDMPVKAKRSTYNYSLPITVKKTSNQPGTMHDLKQGLGPSGTDGPRKLTYNKYKLKDSVYIFREGALPPYRQMFYQLCDLNVEELQKIVHRNDGTETVCTERDGWCLPKTTDHLRDTMSLMILQTI 459          
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Mouse
Match: Gtf3c5 (general transcription factor IIIC, polypeptide 5 [Source:MGI Symbol;Acc:MGI:1917489])

HSP 1 Score: 82.8037 bits (203), Expect = 5.911e-16
Identity = 94/452 (20.80%), Postives = 177/452 (39.16%), Query Frame = 1
Query:  139 VINYPLIINNEENALNSLGGVNTISKILTSNLFDNQKKRIPLYLRPNMIYSKPLLSEHSETKGILMKLRQLRNKKTG--------EIKLVPEILGYSKIMYEYNALCDYQY-NPHTSPNDALLDCPSVFYDKLLPSKTMMDISEFDDYMNCNKEIFLPPLIFTKYEKPAEL----------------------------------------RIKVLEYPKSVIVK--KKDLKFETQMTNSDLLIELFSMQPIWTSSNLDEAIRETNHSNIYKVRKLRSEIANHVTKGPWRRTWIRKDYDHETLPESRMFQIIEFRANA------SHINVITKFLRSS----------RTKTEPNA-----QIQMSSTKIGP-------------------NYLPSTVNCFYQLCHVDIGEVSELVAKEPLPPAIHAEH-GWFSPNFGTRVRAAINKFITEKV 1218
             + YP ++ NE   L +LGG  ++S+I T     +  KR+ LY RP   Y  P+ +    T  +L+++R+   ++ G        ++    EI+G    +Y++  + D+QY   HT      +      YD++L     M   E +++ +    +++PP IF++ + P +                                           +V E P    V+  KK           + L +LF ++P+W+ +    A++     +  K++ L   +A ++  GPWR  WIR  YD    P+++++Q+++FR            ++  K  RS+          +T  +P       Q    S   GP                     LP     FYQLC +++ E+ ++V +      +  E  GW  P     +R  ++  I + +
Sbjct:   26 CVEYPGVVRNEAKMLQTLGGEESVSRIYT-----DPTKRLELYFRPKDPYCHPVCANRFSTSSLLLRIRKRTRRRRGVLGDEAHPQVTFNLEIIGIISTIYKFQGMSDFQYLAVHTEAGGKHVS----MYDRVL-----MRKPEKEEFFHQELPLYIPPPIFSRLDTPVDYFYRPETQHREGYHNPTISGENLIGLSRARRPHNAIFVNFEDTEVPEQPLEAAVQTWKKACTNPIDQKVEEELRKLFDIRPVWSRN----AVKSNVSVHPDKLKILLPYMAYYMITGPWRSLWIRFGYDPRKHPDAKIYQVLDFRIRCGMKYGYGSRDMPVKAKRSTYNYSLPITVKKTSNQPGTMHDLKQGLGPSGTDGPRKLTYNKYKLKDSVYIFREGALPPYRQMFYQLCDLNVEELQKIVHRNDGTETVCTERDGWCLPKTTDHLRDTMSLMILQTI 459          
BLAST of General transcription factor 3C polypeptide 5 vs. UniProt/SwissProt
Match: sp|Q9Y5Q8|TF3C5_HUMAN (General transcription factor 3C polypeptide 5 OS=Homo sapiens OX=9606 GN=GTF3C5 PE=1 SV=2)

HSP 1 Score: 87.8113 bits (216), Expect = 9.364e-17
Identity = 97/452 (21.46%), Postives = 180/452 (39.82%), Query Frame = 1
Query:  139 VINYPLIINNEENALNSLGGVNTISKILTSNLFDNQKKRIPLYLRPNMIYSKPLLSEHSETKGILMKLRQLRNKKTG--------EIKLVPEILGYSKIMYEYNALCDYQY-NPHTSPNDALLDCPSVFYDKLLPSKTMMDISEFDDYMNCNKEIFLPPLIFTKYEKPAE-----------------------LRIKVLEYPKSVI--------VKKKDLKFETQM-----TN------SDLLIELFSMQPIWTSSNLDEAIRETNHSNIYKVRKLRSEIANHVTKGPWRRTWIRKDYDHETLPESRMFQIIEFRANA------SHINVITKFLRSSRTKTEPNAQIQMSS---------TKIGP-------------------------NYLPSTVNCFYQLCHVDIGEVSELVAK-EPLPPAIHAEHGWFSPNFGTRVRAAINKFITEKV 1218
             + YP ++ +    L +LGG   +S+I     + +  KR+ LY RP   Y  P+ +    T  +L+++R+   ++ G        E+    EILG    +Y++  + D+QY   HT          +  YDK+L     M   E + + +    +++PP IF++ + P +                       + +     P + I        V K+ L+   Q      TN       + L +LF ++PIW+ + +   I  + H +  KV  L   IA ++  GPWR  WIR  YD    P+++++Q+++FR         +  ++  K  RS+   + P    + SS           +GP                           LP     FYQLC +++ E+ +++ + +    +     GW  P     +R  ++  I + +
Sbjct:   26 CVEYPGVVRDVAKMLPTLGGEEGVSRI-----YADPTKRLELYFRPKDPYCHPVCANRFSTSSLLLRIRKRTRRQKGVLGTEAHSEVTFDMEILGIISTIYKFQGMSDFQYLAVHTEAGGKH----TSMYDKVL-----MLRPEKEAFFHQELPLYIPPPIFSRLDAPVDYFYRPETQHREGYNNPPISGENLIGLSRARRPHNAIFVNFEDEEVPKQPLEAAAQTWRRVCTNPVDRKVEEELRKLFDIRPIWSRNAVKANI--SVHPDKLKV--LLPFIAYYMITGPWRSLWIRFGYDPRKNPDAKIYQVLDFRIRCGMKHGYAPSDLPVKAKRSTYNYSLPITVKKTSSQLVTMHDLKQGLGPSGTSGARKPASSKYKLKDSVYIFREGALPPYRQMFYQLCDLNVEELQKIIHRNDGAENSCTERDGWCLPKTSDELRDTMSLMIRQTI 459          
BLAST of General transcription factor 3C polypeptide 5 vs. UniProt/SwissProt
Match: sp|Q8R2T8|TF3C5_MOUSE (General transcription factor 3C polypeptide 5 OS=Mus musculus OX=10090 GN=Gtf3c5 PE=2 SV=2)

HSP 1 Score: 83.1889 bits (204), Expect = 3.577e-15
Identity = 94/452 (20.80%), Postives = 177/452 (39.16%), Query Frame = 1
Query:  139 VINYPLIINNEENALNSLGGVNTISKILTSNLFDNQKKRIPLYLRPNMIYSKPLLSEHSETKGILMKLRQLRNKKTG--------EIKLVPEILGYSKIMYEYNALCDYQY-NPHTSPNDALLDCPSVFYDKLLPSKTMMDISEFDDYMNCNKEIFLPPLIFTKYEKPAEL----------------------------------------RIKVLEYPKSVIVK--KKDLKFETQMTNSDLLIELFSMQPIWTSSNLDEAIRETNHSNIYKVRKLRSEIANHVTKGPWRRTWIRKDYDHETLPESRMFQIIEFRANA------SHINVITKFLRSS----------RTKTEPNA-----QIQMSSTKIGP-------------------NYLPSTVNCFYQLCHVDIGEVSELVAKEPLPPAIHAEH-GWFSPNFGTRVRAAINKFITEKV 1218
             + YP ++ NE   L +LGG  ++S+I T     +  KR+ LY RP   Y  P+ +    T  +L+++R+   ++ G        ++    EI+G    +Y++  + D+QY   HT      +      YD++L     M   E +++ +    +++PP IF++ + P +                                           +V E P    V+  KK           + L +LF ++P+W+ +    A++     +  K++ L   +A ++  GPWR  WIR  YD    P+++++Q+++FR            ++  K  RS+          +T  +P       Q    S   GP                     LP     FYQLC +++ E+ ++V +      +  E  GW  P     +R  ++  I + +
Sbjct:   26 CVEYPGVVRNEAKMLQTLGGEESVSRIYT-----DPTKRLELYFRPKDPYCHPVCANRFSTSSLLLRIRKRTRRRRGVLGDEAHPQVTFNLEIIGIISTIYKFQGMSDFQYLAVHTEAGGKHVS----MYDRVL-----MRKPEKEEFFHQELPLYIPPPIFSRLDTPVDYFYRPETQHREGYHNPTISGENLIGLSRARRPHNAIFVNFEDTEVPEQPLEAAVQTWKKACTNPIDQKVEEELRKLFDIRPVWSRN----AVKSNVSVHPDKLKILLPYMAYYMITGPWRSLWIRFGYDPRKHPDAKIYQVLDFRIRCGMKYGYGSRDMPVKAKRSTYNYSLPITVKKTSNQPGTMHDLKQGLGPSGTDGPRKLTYNKYKLKDSVYIFREGALPPYRQMFYQLCDLNVEELQKIVHRNDGTETVCTERDGWCLPKTTDHLRDTMSLMILQTI 459          
BLAST of General transcription factor 3C polypeptide 5 vs. TrEMBL
Match: A0A564YIC7 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS6298 PE=4 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 5.520e-39
Identity = 120/452 (26.55%), Postives = 204/452 (45.13%), Query Frame = 1
Query:  115 TIPNIEFYVINYPLIINNEENALNSLGGVNTISKILTSNLFDNQKKRIPLYLRPNMIYSKPLLSEHSETKGILMKLRQLRNKKTGEIKLVPEILGYSKIMYEYNALCDYQYNPH-----------TSPNDALLDCPSVFYDKLL---PSKTMMDISEFDDYMNC-NKEIFLPPLIFTKYEKPA--------------ELRIKVLEYPK--------SVIVKKKD----------LKFETQMTNSDLLI-----ELFSMQPIWTSSNLDEAIRETNHSNIYKVRKLRSEIANHVTKGPWRRTWIRKDYDHETLPESRMFQIIEFRANASHINVITKFL-RSSRTKTEPNAQIQMS-----------------------------STKIGPNYL------PSTVNCFYQLCHVDIGEVSELVAKEPLPPAIHAEHGWFSPNFGTRVRAAINKFI 1206
            T+P+ EF+V+ YP I+NN E A+ +LGG+ T++K      F++  +R+ L  RP M+++KP+  +H  T  ++++ +QLRNK+TGEIKLV E++G +  +Y +N + D+QY P            TS ++   D   +FYD+LL   PS+ +      D Y+   N  +FLPPL+FT+ ++P               EL     ++P         ++ V   D          L+  T   N    +     +LF  +PIW+ S L  +++       + ++ +    A +V  GPW R W+R  YD      SR++Q +++R     +  +     R SRT    +A +  S                             S K    +L      P      YQL  +DI EV E++A         + +GW   ++   +RA + +++
Sbjct:    4 TLPSREFFVLRYPGIVNNHERAVETLGGLQTLNKT-----FNSITRRLRLTFRPEMLFAKPVYGDHRSTTSLIIRAKQLRNKRTGEIKLVAEVVGTATRIYYFNGMFDFQYGPFEKVSANAFGETTSESNPAQDTFRIFYDQLLIKEPSRVL------DSYLKTPNMPLFLPPLLFTRLDQPTMYCFSSRFRMNQYVELENNSQQHPYHRKERKSFAIFVNFGDPVPEAAHPGALQAVTSQGNQTRKLAHDVEKLFHHRPIWSKSALVHSLKWKRIRE-FAIKTILPAYAYYVPNGPWSRVWVRFGYDPCKHSSSRVYQTVDYRVRLPRLQTMLCLSGRRSRTDDREDADLSGSDLEELGESTTLDVSLATAHDGDSPEPTHASQKSTSAFLFSKDSWPDAKQILYQLIDIDIPEVVEMLAAPVSRKNCDSIYGWMPNDYQKTIRALMTRYL 443          
BLAST of General transcription factor 3C polypeptide 5 vs. TrEMBL
Match: A0A564YI77 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS6298 PE=4 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 4.663e-38
Identity = 120/458 (26.20%), Postives = 204/458 (44.54%), Query Frame = 1
Query:  115 TIPNIEFYVINYPLIINNEENALNSLGGVNTISKILTSNLFDNQKKRIPLYLRPNMIYSKPLLSEHSETKGILMKLRQLRNKKTGEIKLVPEILGYSKIMYEYNALCDYQYNPH-----------TSPNDALLDCPSVFYDKLL---PSKTMMDISEFDDYMNC-NKEIFLPPLIFTKYEKPA--------------ELRIKVLEYPK--------------SVIVKKKD----------LKFETQMTNSDLLI-----ELFSMQPIWTSSNLDEAIRETNHSNIYKVRKLRSEIANHVTKGPWRRTWIRKDYDHETLPESRMFQIIEFRANASHINVITKFL-RSSRTKTEPNAQIQMS-----------------------------STKIGPNYL------PSTVNCFYQLCHVDIGEVSELVAKEPLPPAIHAEHGWFSPNFGTRVRAAINKFI 1206
            T+P+ EF+V+ YP I+NN E A+ +LGG+ T++K      F++  +R+ L  RP M+++KP+  +H  T  ++++ +QLRNK+TGEIKLV E++G +  +Y +N + D+QY P            TS ++   D   +FYD+LL   PS+ +      D Y+   N  +FLPPL+FT+ ++P               EL     ++P               ++ V   D          L+  T   N    +     +LF  +PIW+ S L  +++       + ++ +    A +V  GPW R W+R  YD      SR++Q +++R     +  +     R SRT    +A +  S                             S K    +L      P      YQL  +DI EV E++A         + +GW   ++   +RA + +++
Sbjct:    4 TLPSREFFVLRYPGIVNNHERAVETLGGLQTLNKT-----FNSITRRLRLTFRPEMLFAKPVYGDHRSTTSLIIRAKQLRNKRTGEIKLVAEVVGTATRIYYFNGMFDFQYGPFEKVSANAFGETTSESNPAQDTFRIFYDQLLIKEPSRVL------DSYLKTPNMPLFLPPLLFTRLDQPTMYCFSSRFRMNQYVELENNSQQHPYLSFDYEHRKERKSFAIFVNFGDPVPEAAHPGALQAVTSQGNQTRKLAHDVEKLFHHRPIWSKSALVHSLKWKRIRE-FAIKTILPAYAYYVPNGPWSRVWVRFGYDPCKHSSSRVYQTVDYRVRLPRLQTMLCLSGRRSRTDDREDADLSGSDLEELGESTTLDVSLATAHDGDSPEPTHASQKSTSAFLFSKDSWPDAKQILYQLIDIDIPEVVEMLAAPVSRKNCDSIYGWMPNDYQKTIRALMTRYL 449          
BLAST of General transcription factor 3C polypeptide 5 vs. TrEMBL
Match: A0A0R3SW86 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS9913 PE=4 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 3.575e-37
Identity = 104/362 (28.73%), Postives = 176/362 (48.62%), Query Frame = 1
Query:  115 TIPNIEFYVINYPLIINNEENALNSLGGVNTISKILTSNLFDNQKKRIPLYLRPNMIYSKPLLSEHSETKGILMKLRQLRNKKTGEIKLVPEILGYSKIMYEYNALCDYQYNPH-----------TSPNDALLDCPSVFYDKLL---PSKTMMDISEFDDYMNC-NKEIFLPPLIFTKYEKPA--------------ELRIKVLEYPK--------SVIVKKKD----------LKFETQMTNSDLLI-----ELFSMQPIWTSSNLDEA-----IRETNHSNIYKVRKLRSEIANHVTKGPWRRTWIRKDYDHETLPESRMFQIIEFRANASHINVITKFLRSSRTKTEPNAQIQMSSTKI 1029
            T+P+ EF+V+ YP I+NN E A+ +LGG+ T++K      F++  +R+ L  RP M+++KP+  +H  T  ++++ +QLRNK+TGEIKLV E++G +  +Y +N + D+QY P            TS  +   D   +FYD+LL   PS+ +      D Y+   N  +FLPPL+FT+ ++P               EL     ++P         ++ V   D          L+  T   N    +     +LF  +PIW+ S L  +     IRE      + ++ +    A +V  GPW R W+R  YD      SR++Q +++R     +  +   L   R++T+      +S + +
Sbjct:    4 TLPSREFFVLRYPGIVNNHERAVETLGGLQTLNKT-----FNSITRRLRLTFRPEMLFAKPVYGDHRSTTSLIIRAKQLRNKRTGEIKLVAEVVGTATRIYYFNGMFDFQYGPFEKVSANAFGETTSETNPAQDTFRIFYDQLLIKEPSRVL------DSYLKTPNMPLFLPPLLFTRLDQPTMYCFSSRFRMNQYVELENNSQQHPYHRKERKSFAIFVNFGDPVPEAAHPGALQAVTSQGNQTRKLAHDVEKLFHHRPIWSKSALVHSLKWKRIRE------FAIKTILPAYAYYVPNGPWSRVWVRFGYDPCKHSSSRVYQTVDYRVRLPRLQTML-CLSGRRSRTDDREDADLSGSDL 347          
BLAST of General transcription factor 3C polypeptide 5 vs. TrEMBL
Match: A0A3P6TA83 (Uncharacterized protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS2885 PE=4 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 1.063e-35
Identity = 119/436 (27.29%), Postives = 191/436 (43.81%), Query Frame = 1
Query:  118 IPNIEFYVINYPLIINNEENALNSLGGVNTISKILTSNLFDNQKKRIPLYLRPNMIYSKPLLSEHSETKGILMKLRQLRNKKTGEIKLVPEILGYSKIMYEYNA----------------------LCDYQYNPHTSP------NDALLDCPSVFYDKLL---PSKTMMDISEFDDYMNCNKEIFLPPLIFTKYEKP--------------AELRIKVLEYPKSVIVKKKDLKF-----ETQMTNSDLLIE------------------LFSMQPIWTSSNLDEAIRETNHSNIYKVRKLRSEIANHVTKGPWRRTWIRKDYDHETLPESRMFQIIEFRANASHINVITKFL-RSSRTKTEPNAQIQMSST---KIGPNYLPSTVNCFYQLCHVDIGEVSELVAKEPLPPA-IHAEHGWFSPNFGTRVRAAINKFI 1206
            IP+ +FYV+NYP I+ N++ A+ SLGG+  ISK      F++  +R+ L  RP+M   KP+  + S +  ++++ R+LRNK+TGE K+  EILG     Y + A                      L D+QY P+  P      +   LD  SVFY+KLL   P++++      D ++N +  + +PP++FT+ ++P               EL  +   +P     +K    F      T M      +E                  LF  +P WT S L   +R     +   ++ +    A ++  GPW R WIR  YD    P SR++Q ++FR  A  +    K   R  R     N+    S T   +   N  P      YQ+  +D+ EV E++A  P+P +      GW        +R +I + +
Sbjct:    5 IPSRDFYVVNYPAIVQNDDRAILSLGGITGISKT-----FNSSSRRLRLTFRPDMFLCKPVFGDPSPSTALVIRARRLRNKRTGEEKVQAEILGIIPRTYSFTAMISSPRFGDLTACSFFPTALVGLMDFQYGPYEKPPSEQCSSSGNLDRFSVFYEKLLVREPTRSL------DVHLNSDAPLCVPPILFTRLDQPLAYCFSSRFRTNDYVELDSQSHNHPYHRKERKSYAMFVSFNEPTPMAAHPAALETISSLPPASRKLAHEIEKLFRKRPAWTRSALLHGLRHLRIRD-SSIKLILPAFAYYMPNGPWGRVWIRFGYDPRADPASRIYQTVDFRVRAPRLQSKLKLAGRRPRVADRENSDGSGSETSCFRFNRNSWPDARQILYQITDIDVPEVIEMLAA-PVPRSKCDPVEGWMPDKHQRTIRESITRCL 427          
BLAST of General transcription factor 3C polypeptide 5 vs. TrEMBL
Match: A0A068WWI7 (General transcription factor 3C polypeptide 5 OS=Echinococcus granulosus OX=6210 GN=EgrG_001198800 PE=4 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 3.786e-34
Identity = 109/453 (24.06%), Postives = 200/453 (44.15%), Query Frame = 1
Query:  115 TIPNIEFYVINYPLIINNEENALNSLGGVNTISKILTSNLFDNQKKRIPLYLRPNMIYSKPLLSEHSETKGILMKLRQLRNKKTGEIKLVPEILGYSKIMYEYNALCDYQYNPH----TSPNDALLDC--PS----VFYDKLL---PSKTMMDISEFDDYMNCNK-EIFLPPLIFTKYEKPA----ELRIKVLEY------PKSVIVKKKDLKFETQMTN---------------------------SDLLIELFSMQPIWTSSNLDEAIRETNHSNIYK--VRKLRSEIANHVTKGPWRRTWIRKDYDHETLPESRMFQIIEFRAN--------------------------------ASHINVITKFLRSSRTKTEPN----AQIQMSSTKIGPNYLPSTVNCFYQLCHVDIGEVSELVAKEPLPPAIHAEHGWFSPNFGTRVRAAINKFI 1206
            TI   EF+V+ YP I+ N+E A+ +LGG+ +++K      F++  +R+ L  RP M++SKP+  +      +++  +QLRN++TGE+K V E++G +  +Y +NA+ D+QY P      + N  + DC  PS    VFYD+LL   P++ +      D ++  +   +FLPPL+FT+ ++P       R ++ EY       +     +K+ K      N                           ++ + +LF  +PIW  ++L   +   N   + +  ++ +    A ++  GPW R W+R  YD    P SRM+Q +++R                                  A   ++I   L + R+   P+    +    S+ +      P      YQL  +D+ EV E++A           +GW   ++   +R  + +++
Sbjct:    4 TISPREFFVVQYPGIVKNDERAIETLGGLQSLNKS-----FNSLTRRLRLSFRPEMLFSKPVYGDPHSKTALIICAKQLRNRRTGEVKFVSEVVGVASRVYTFNAMFDFQYGPFEKIPANSNKVVSDCAPPSDCFRVFYDQLLVKEPTRVL------DSHLRASDIPLFLPPLLFTRLDQPTMYCFSSRFRINEYVELENNSQQHPYHRKERKSYAMFVNFGDPIPSAAHPGALQAITSLGPHTRKLANDVEKLFRRRPIWGKASL---VHSLNWKRVRECAIKTILPAYAYYMPNGPWGRVWVRFGYDPCKDPSSRMYQTVDYRVRSPRLQAKLCISGRRPRADDREDTDPSGSDVDEARDTSIIDATLAAMRSGESPSPVHASSKSTSAFRFSKTSWPDARQILYQLVDIDVPEVVEMLAAPMCRTVCDPNYGWMPADYQKTIREIMTRYL 442          
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Cavefish
Match: gtf3c5 (general transcription factor IIIC, polypeptide 5 [Source:ZFIN;Acc:ZDB-GENE-060810-66])

HSP 1 Score: 76.6406 bits (187), Expect = 4.071e-14
Identity = 88/436 (20.18%), Postives = 168/436 (38.53%), Query Frame = 1
Query:  157 IINNEENALNSLGGVNTISKILTSNLFDNQKKRIPLYLRPNMIYSKPLLSEHSETKGILMKL-RQLRNKKTGEIKLVPEILGYSKIMYEYNALCDYQY-NPHTSPNDALLDCPSVFYDKLLPSKTMMDISEFDDYMNCNKEIFLPPLIFTKYEKPAE--LRIKVL---------------------EYPKSVIVKKKDLKF--------------ETQMTNSDLLIE-----LFSMQPIWTSSNLDEAIRETNHSNIYKVRKLRSEIANHVTKGPWRRTWIRKDYDHETLPESRMFQIIEFR-------------------ANASHINVITKF---------LRSSRTKTEPNAQIQMSSTK---------IGPNYLPSTVNCFYQLCHVDIGEVSELVAK-EPLPPAIHAEHGWFSPNFGTRVRAAINKFITEKV 1218
             + N +  L+S+GG   +SK      + +  KR+ L  RP   Y  P+      +  +L+++ R+ R     E  +  E+LG  +  Y++  + D+QY      P  + +          L +K ++   E  ++ +    +FLPP IF++ + P +   R  V+                       P + I    D K               +  + +SD+  E     LF  +P+W+ +    A++     +  K++ L   +A ++  GPWR  W+R  YD    P+++++Q+++FR                    +A H ++ T           L+        +   + SS+K              LP     FYQLC +++ ++  ++ K +          GW  P     +R  I+  IT+ V
Sbjct:   21 FVKNVDKMLDSIGGEQGLSKT-----YADSSKRLELRYRPKDPYCHPVCGNRFSSTNLLIRVCRRRRKGSNEEGHMSIEVLGLIETTYKFQGMADFQYLATQNEPGGSQVS---------LYNKVVLRKPEKKEFFDQPVPLFLPPPIFSRLDNPVDYFYRPDVIHREGNITSLLSRENLIGPNRARRPHNAIFVGFDDKSVPSEPLEAAKLNWNKNSIHHSDVKAEQEVRKLFERRPVWSRN----AVKANVDIHPEKLKLLLPYLAYYMVTGPWRSMWVRFGYDPRKNPDAKIYQVLDFRIRCGMKHGFGVNDMPVKAKRSAYHYSLPTTVNKAVPQPASLKEITQDGTSSPGFKASSSKYMLKESAYVFREGMLPPYRQMFYQLCDLEVDKIKSIIHKNDGQEEQCDERDGWCMPRTADELRDIISSMITQVV 438          
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Nematostella
Match: EDO47172 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMW5])

HSP 1 Score: 79.7221 bits (195), Expect = 1.819e-15
Identity = 90/424 (21.23%), Postives = 164/424 (38.68%), Query Frame = 1
Query:  103 YSTLTIPNIEFYVINYPLIINNEENALNSLGGVNTISKILTSNLFDNQKKRIPLYLRPNMIYSKPLLSEHSETKGILMKLRQLRNKKTGEIKLVPEILGYSKIMYEYNALCDYQYNPHTSPNDALLDCPSVFYDKLLPSKTMMDISEFDDYMNCNKEIFLPPLIFTKYEKPAELRIK-------------------------------------VLEYPKSVIVKKKDLKFETQMTNSDLLIE----LFSMQPIWTSSNLDEAIRETNHSNIYKV-----RKLRSEIANHVTKGPWRRTWIRKDYDHETLPESRMFQIIEFRANAS----------------HINVITKFLRSSRTKTEPNAQIQMSSTKIGPNYLPSTVNCFYQLCHVDIGEVSELV-AKEPLPPAIHAEHGWFSPNFGTRVR 1185
            Y+T  I  +EF     P ++ N +  L +LGG   +++ +      +  +RI +  RP  I SK L  +   T  +L+ +++ ++K     +   E+LG     ++++ L D+QY  H                     K  +D     + +N  + + + P +F++ EKP     K                                       E+P SV V       E+     D  +E    LF+ +PIW+ + L       +H + +KV     ++L + +A +   GPWR  W++  Y+    P ++++Q++++R  A                  +    K LR  + K  P+    + S     N LP+    FYQLC + + E+  LV A +          GW  P    ++R
Sbjct:   25 YNTSRIIGVEF-----PGVVRNTDKMLQALGGEAEVARAVL-----DPHQRIKVNFRPADINSKCLYGDRHATPNLLLSVKRRQSKDNKGYEYKQEVLGVVDTTFKFDNLVDFQYVSHEM-------------------KDPLDQVRGIEILNEEQPLLVLPPVFSRIEKPVPYNFKPNILAGWQPASSQATTDEQEGSKMAQGRNRNTYAMAVTFEHP-SVPVSPHPKALESLSAIPDNKLEEIKRLFNNRPIWSRTAL------AHHLSSFKVTQHWTKQLLACVAYYYINGPWRTLWVKFGYNPAKDPSAKIYQVLDYRIGARKEGRDLPIPWKRNPFLKLQSKRKPLRQPQHKDLPSDVPYVFSA----NKLPTQKQMFYQLCDLHVSEIQALVSANDGQETECLEREGWCLPGTLDKIR 408          
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Medaka
Match: gtf3c5 (general transcription factor IIIC subunit 5 [Source:NCBI gene;Acc:101172425])

HSP 1 Score: 86.6557 bits (213), Expect = 2.898e-17
Identity = 96/446 (21.52%), Postives = 178/446 (39.91%), Query Frame = 1
Query:  106 STLTIPNIEFYVINYPLIINNEENALNSLGGVNTISKILTSNLFDNQKKRIPLYLRPNMIYSKPLLSEHSETKGILM---KLRQLRNKKTGEIKLVPEILGYSKIMYEYNALCDYQYNPHTSPNDALLDCPSVFYDKLLPSKTMMDISEFDDYMNCNKEIFLPPLIFTKYEKPAE--LRIKVLEYPK------------------SVIVKKKDLKFETQ-------------MTNSDLLIE-----LFSMQPIWTSSNLDEAIRETNHSNIYKVRKLRSEIANHVTKGPWRRTWIRKDYDHETLPESRMFQIIEFRANAS--HINVITKFL----RSS--------RTKTEPNA-----------------------QIQMSSTKIGPNYLPSTVNCFYQLCHVDIGEVSELVAKEPLPPAIHAEH-GWFSPNFGTRVRAAINKFI 1206
            STL + + +   + YP +++N +  L++LGG   +SK      F +  +R+ L  RP   +          +  IL+   +  + ++ K  EI++  +++G     Y++  L D+QY       D+     +  YD+++  +T     E  ++       FLPP+IF++ + P +   R +  + P+                  ++ V   D    T+             + ++D L E     +F  +PIW+ +    A++   + +  K++ L    A ++  GPWR  W+R  YD    PES+ +Q+++FR   S  H    +K L    RSS          K  P A                       Q++ S+       LP     FYQLC +D+  + + + +         E  GW +     ++R  I   I
Sbjct:   32 STLELRDRKLVCVEYPAVVHNTDKMLDTLGGEQAVSKT-----FADPNRRLELRFRPQDPFCHSACGNRLSSSNILLRVRRRVRRKDPKDAEIQM--DVVGIIGTTYKFQGLADFQY----LAVDSQGGMHTSLYDRIILRQT-----ETQEFFEQPVPYFLPPVIFSRLDNPMDYFYRAEAHQAPQTYANKNSIGLNRARRPHNAIFVSFNDAVVPTECLEGARQNWARCCLKDNDRLAEEQIKKMFESRPIWSKN----AVKANFNIHPEKLKLLLPLFAYYMVTGPWRSLWVRLGYDPRKDPESKKYQMLDFRMRCSTKHGYSFSKLLVKAKRSSLNYSLPITLNKAVPQATSVMHIPSRENPSTSRDSAPLSYQLKESAYIFREGMLPPYRQMFYQLCDLDVDSIRQAIEQSSGTEQQCLERDGWCAAGTTDKLRDLIFSMI 457          
BLAST of General transcription factor 3C polypeptide 5 vs. Planmine SMEST
Match: SMESG000017479.1 (SMESG000017479.1)

HSP 1 Score: 791.186 bits (2042), Expect = 0.000e+0
Identity = 382/383 (99.74%), Postives = 383/383 (100.00%), Query Frame = 1
Query:   94 MNNYSTLTIPNIEFYVINYPLIINNEENALNSLGGVNTISKILTSNLFDNQKKRIPLYLRPNMIYSKPLLSEHSETKGILMKLRQLRNKKTGEIKLVPEILGYSKIMYEYNALCDYQYNPHTSPNDALLDCPSVFYDKLLPSKTMMDISEFDDYMNCNKEIFLPPLIFTKYEKPAELRIKVLEYPKSVIVKKKDLKFETQMTNSDLLIELFSMQPIWTSSNLDEAIRETNHSNIYKVRKLRSEIANHVTKGPWRRTWIRKDYDHETLPESRMFQIIEFRANASHINVITKFLRSSRTKTEPNAQIQMSSTKIGPNYLPSTVNCFYQLCHVDIGEVSELVAKEPLPPAIHAEHGWFSPNFGTRVRAAINKFITEKVEFLMKLNQ 1242
            MNNYSTLTIPN+EFYVINYPLIINNEENALNSLGGVNTISKILTSNLFDNQKKRIPLYLRPNMIYSKPLLSEHSETKGILMKLRQLRNKKTGEIKLVPEILGYSKIMYEYNALCDYQYNPHTSPNDALLDCPSVFYDKLLPSKTMMDISEFDDYMNCNKEIFLPPLIFTKYEKPAELRIKVLEYPKSVIVKKKDLKFETQMTNSDLLIELFSMQPIWTSSNLDEAIRETNHSNIYKVRKLRSEIANHVTKGPWRRTWIRKDYDHETLPESRMFQIIEFRANASHINVITKFLRSSRTKTEPNAQIQMSSTKIGPNYLPSTVNCFYQLCHVDIGEVSELVAKEPLPPAIHAEHGWFSPNFGTRVRAAINKFITEKVEFLMKLNQ
Sbjct:    1 MNNYSTLTIPNVEFYVINYPLIINNEENALNSLGGVNTISKILTSNLFDNQKKRIPLYLRPNMIYSKPLLSEHSETKGILMKLRQLRNKKTGEIKLVPEILGYSKIMYEYNALCDYQYNPHTSPNDALLDCPSVFYDKLLPSKTMMDISEFDDYMNCNKEIFLPPLIFTKYEKPAELRIKVLEYPKSVIVKKKDLKFETQMTNSDLLIELFSMQPIWTSSNLDEAIRETNHSNIYKVRKLRSEIANHVTKGPWRRTWIRKDYDHETLPESRMFQIIEFRANASHINVITKFLRSSRTKTEPNAQIQMSSTKIGPNYLPSTVNCFYQLCHVDIGEVSELVAKEPLPPAIHAEHGWFSPNFGTRVRAAINKFITEKVEFLMKLNQ 383          

HSP 2 Score: 51.9878 bits (123), Expect = 3.740e-13
Identity = 27/37 (72.97%), Postives = 31/37 (83.78%), Query Frame = -2
Query: 2325 TKFLRSSPT*TDPNVQIQMSTTKIGPNFLPRLSTVSA 2435
            TKFLRSS T T+PN QIQMS+TKIGPN+LP  STV+ 
Sbjct:  289 TKFLRSSRTKTEPNAQIQMSSTKIGPNYLP--STVNC 323          

HSP 3 Score: 42.3578 bits (98), Expect = 3.740e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -1
Query: 2275 AATVNCFCQLCRVDVGEVIELVTKE 2349
             +TVNCF QLC VD+GEV ELV KE
Sbjct:  318 PSTVNCFYQLCHVDIGEVSELVAKE 342          
BLAST of General transcription factor 3C polypeptide 5 vs. Planmine SMEST
Match: SMESG000016003.1 (SMESG000016003.1)

HSP 1 Score: 295.049 bits (754), Expect = 1.286e-94
Identity = 153/214 (71.50%), Postives = 169/214 (78.97%), Query Frame = 1
Query:  106 STLTIPNIEFYVINYPLIINNEENALNSLGGVNTISKILTSNLFDNQKKRIPLYLRPNMIYSKPLLSEHSETKGILMKLRQLRNKKTGEIKLVPEILGYSKIMYEYNALCDYQYNPHTSPNDALLDCPSVFYDKLLPSKTMMDISEFDDYMNCNKEIFLPPLIFTKYEKPAELRIKVLEYPKSVIVKKKDLKFETQMTNSDLLIELFSMQPIWT 747
            +T+ +   ++Y+INY LIINNEENAL+SLGGVN IS +L SNLFDN KKRIPLYLR N+IYSKPLLS+HSETKGI M L QLRNKKTGE KLVPEILGYSK M+EYNALCDYQYNPHTSPNDAL DCPSVF DKLLP KTMMD SEF                     KPAELRIKVL+YPKSVIVKKKDLKFETQMTNSDL IE+ ++  +W 
Sbjct:   13 ATVGVTFNKYYLINYQLIINNEENALDSLGGVNAISNMLMSNLFDNHKKRIPLYLRSNLIYSKPLLSDHSETKGIFMNLLQLRNKKTGEFKLVPEILGYSKNMHEYNALCDYQYNPHTSPNDALPDCPSVFCDKLLPGKTMMDKSEFG--------------------KPAELRIKVLDYPKSVIVKKKDLKFETQMTNSDLFIEV-AILVLWV 205          
BLAST of General transcription factor 3C polypeptide 5 vs. Planmine SMEST
Match: SMESG000015991.1 (SMESG000015991.1)

HSP 1 Score: 246.128 bits (627), Expect = 1.447e-76
Identity = 128/181 (70.72%), Postives = 135/181 (74.59%), Query Frame = 1
Query:  412 MYEYNALCDYQYNPHTSPNDALLDCPSVFYDKLLPSKTMMDISEFDDYMNCNKEIFLPPLIFTKYEKPAELRIKVLEYPKSVIVKKKDLKFETQMTNSDLLIE-----------------LFSMQPIWTSSNLDEAIRETNHSNIYKVRKLRSEIANHVTKGPWRRTWIRKDYDHETLPES 903
            M+EYNALCDYQYNP TSPNDAL DCPSVFYDKLL  KTMMDISEF                    EKPAELRIKVL+YPKSVIVKKKDLKFETQMTNSDL IE                 LFSM+PIWTSSNLDEAIRET+HSNIYKVRKLRSEIANHVTKGPWRRTWI KDYD +  P++
Sbjct:    1 MHEYNALCDYQYNPRTSPNDALPDCPSVFYDKLLAGKTMMDISEF--------------------EKPAELRIKVLDYPKSVIVKKKDLKFETQMTNSDLFIEVEIIFLWIFVVLKRILKLFSMKPIWTSSNLDEAIRETSHSNIYKVRKLRSEIANHVTKGPWRRTWILKDYDLKVRPQN 161          
BLAST of General transcription factor 3C polypeptide 5 vs. Planmine SMEST
Match: SMESG000034928.1 (SMESG000034928.1)

HSP 1 Score: 213.772 bits (543), Expect = 5.150e-62
Identity = 104/154 (67.53%), Postives = 116/154 (75.32%), Query Frame = 2
Query: 1544 KAKGLGSI*QPLFICIWKCSE*KYR*ISLYFMYLR*NNMPIDFKFQATISQYMDILDYKVIMQERLQSAWAQVGLKIKHYQQAYRECYDKR-HAHDIYIEDLVYFNKPELVKGLSPKSQRPFKRPYVVCDATETNLKLRPQNNKKAGKIVVHVN 2002
            KAK LG + Q + IC+ KCSE +Y     Y MYLR NNMP   KFQA ISQYMDI DYKV MQERLQS W Q GLKI+H Q+AY+ECYDKR H  +I + DLVY +KPE  KGLSPK QRPFK PY+VCD TETNLKLRPQNNKKAG I+ H N
Sbjct:  919 KAKRLGFVYQAMLICVSKCSEREYGETPFYLMYLRRNNMPAVLKFQAPISQYMDISDYKVTMQERLQSIWTQAGLKIRHRQEAYKECYDKRAHTQNIEVGDLVYVHKPEPAKGLSPKLQRPFKGPYIVCDTTETNLKLRPQNNKKAGTIIFHAN 1072          

HSP 2 Score: 45.0542 bits (105), Expect = 5.150e-62
Identity = 24/48 (50.00%), Postives = 30/48 (62.50%), Query Frame = 1
Query: 2065 IKNGKAVKQKGTKNPASLEYIKKVLFITGIMKINVLGTNAIQYFTILA 2208
            ++   A+KQK  KNPA L YI KVLF+  +M INV G+NA   F   A
Sbjct: 1094 VERHTALKQKIAKNPALLGYINKVLFVATLMIINVFGSNATPLFPKYA 1141          
BLAST of General transcription factor 3C polypeptide 5 vs. Planmine SMEST
Match: SMESG000073500.1 (SMESG000073500.1)

HSP 1 Score: 164.466 bits (415), Expect = 1.071e-61
Identity = 78/124 (62.90%), Postives = 94/124 (75.81%), Query Frame = 2
Query: 1634 FMYLR*NNMPIDFKFQATISQYMDILDYKVIMQERLQSAWAQVGLKIKHYQQAYRECYDKR-HAHDIYIEDLVYFNKPELVKGLSPKSQRPFKRPYVVCDATETNLKLRPQNNKKAGKIVVHVN 2002
              YLR NN+PID K+Q +++QYM++ DYK +MQERLQS W Q GLKIK+ Q++Y++ YDKR H H I + DLVY NKPE  KGLS K Q+PFK PY VCD TETNLKLRP  NKKA  IV+H N
Sbjct: 1083 LFYLRRNNIPIDLKYQPSVTQYMEVSDYKSVMQERLQSVWKQAGLKIKYNQESYKDQYDKRAHEHLIKLGDLVYLNKPEPTKGLSTKLQKPFKGPYTVCDTTETNLKLRPIRNKKAETIVLHAN 1206          

HSP 2 Score: 83.5741 bits (205), Expect = 1.071e-61
Identity = 39/53 (73.58%), Postives = 43/53 (81.13%), Query Frame = 3
Query: 1473 SKTGSLVERFNGNLINMISSYVNRKQKDWDLFSNRCLFAYGNAVNESIDEYLY 1631
             +TG LVERFNGNLI+MISSYVNR QKDWDLF   CLFAY N+VNES  E L+
Sbjct: 1032 PQTGGLVERFNGNLISMISSYVNRNQKDWDLFIKPCLFAYRNSVNESTGETLF 1084          

HSP 3 Score: 30.8018 bits (68), Expect = 1.071e-61
Identity = 13/29 (44.83%), Postives = 19/29 (65.52%), Query Frame = 1
Query: 2059 EMIKNGKAVKQKGTKNPASLEYIKKVLFI 2145
            + I +G  + Q+ TKNP  L Y+ KVLF+
Sbjct: 1226 DKINDGPNIIQQITKNPTRLNYMNKVLFV 1254          
The following BLAST results are available for this feature:
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GTF3C52.225e-1721.46general transcription factor IIIC subunit 5 [Sourc... [more]
GTF3C53.199e-1724.20general transcription factor IIIC subunit 5 [Sourc... [more]
GTF3C58.382e-1223.44general transcription factor IIIC subunit 5 [Sourc... [more]
GTF3C58.470e-724.48general transcription factor IIIC subunit 5 [Sourc... [more]
GTF3C53.631e-634.25general transcription factor IIIC subunit 5 [Sourc... [more]
back to top
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tftc-55.976e-1623.70Transcription Factor ThreeC subunit (GTF3C homolog... [more]
back to top
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
l(2)37Cd9.869e-2323.44gene:FBgn0086445 transcript:FBtr0081156[more]
back to top
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gtf3c55.540e-2120.91general transcription factor IIIC, polypeptide 5 [... [more]
back to top
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GTF3C52.388e-1421.11general transcription factor IIIC subunit 5 [Sourc... [more]
GTF3C52.549e-1421.11general transcription factor IIIC subunit 5 [Sourc... [more]
GTF3C52.567e-1422.29general transcription factor IIIC subunit 5 [Sourc... [more]
GTF3C58.089e-1421.08general transcription factor IIIC subunit 5 [Sourc... [more]
GTF3C51.244e-1123.15general transcription factor IIIC subunit 5 [Sourc... [more]
back to top
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Gtf3c55.731e-1620.58general transcription factor IIIC, polypeptide 5 [... [more]
Gtf3c55.911e-1620.80general transcription factor IIIC, polypeptide 5 [... [more]
back to top
BLAST of General transcription factor 3C polypeptide 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q9Y5Q8|TF3C5_HUMAN9.364e-1721.46General transcription factor 3C polypeptide 5 OS=H... [more]
sp|Q8R2T8|TF3C5_MOUSE3.577e-1520.80General transcription factor 3C polypeptide 5 OS=M... [more]
back to top
BLAST of General transcription factor 3C polypeptide 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564YIC75.520e-3926.55Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A564YI774.663e-3826.20Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A0R3SW863.575e-3728.73Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A3P6TA831.063e-3527.29Uncharacterized protein OS=Dibothriocephalus latus... [more]
A0A068WWI73.786e-3424.06General transcription factor 3C polypeptide 5 OS=E... [more]
back to top
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gtf3c54.071e-1420.18general transcription factor IIIC, polypeptide 5 [... [more]
back to top
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO471721.819e-1521.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of General transcription factor 3C polypeptide 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gtf3c52.898e-1721.52general transcription factor IIIC subunit 5 [Sourc... [more]
back to top
BLAST of General transcription factor 3C polypeptide 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017479.13.740e-1399.74SMESG000017479.1[more]
SMESG000016003.11.286e-9471.50SMESG000016003.1[more]
SMESG000015991.11.447e-7670.72SMESG000015991.1[more]
SMESG000034928.15.150e-6267.53SMESG000034928.1[more]
SMESG000073500.11.071e-6162.90SMESG000073500.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020341 ID=SMED30020341|Name=General transcription factor 3C polypeptide 5|organism=Schmidtea mediterranea sexual|type=transcript|length=2436bp
TAAACTACAAACTTGAATTTGTAATGTAAATATTTCAAAATTTAGACTTA
CAAATTCAAGTTTGTAGTTTAATTTTTTATTCTTTAATATTTAATGAATA
ACTATTCAACTTTAACTATCCCGAATATCGAATTTTATGTAATCAATTAT
CCACTGATTATTAATAACGAAGAAAATGCTCTTAACTCACTTGGAGGTGT
CAATACTATTTCAAAAATTTTAACGTCAAATCTATTTGACAATCAAAAAA
AACGTATTCCTTTATATTTAAGACCGAATATGATTTATTCCAAACCACTT
TTGAGTGAACATTCTGAAACTAAAGGCATTTTGATGAAATTACGCCAATT
AAGAAATAAAAAAACGGGTGAAATTAAACTAGTGCCTGAAATTCTTGGAT
ATTCAAAAATCATGTATGAATATAATGCATTATGTGATTATCAATATAAT
CCTCATACTTCTCCAAATGATGCTTTACTGGATTGTCCCAGTGTATTTTA
TGATAAATTATTACCGAGTAAAACAATGATGGATATATCTGAATTTGATG
ACTATATGAATTGTAACAAAGAGATTTTTCTTCCTCCGTTAATCTTTACT
AAATATGAAAAACCTGCCGAACTGAGAATTAAAGTTCTCGAGTATCCAAA
GTCAGTTATAGTTAAAAAGAAAGATCTGAAATTCGAAACCCAAATGACAA
ATTCCGATTTATTGATTGAACTGTTTTCTATGCAACCGATTTGGACATCC
TCAAATCTAGACGAGGCAATCAGGGAGACAAACCACTCTAACATTTACAA
GGTGCGCAAGCTGCGCAGTGAAATAGCAAACCACGTGACAAAGGGCCCTT
GGAGACGGACCTGGATACGCAAGGATTACGATCACGAAACCCTTCCGGAA
AGCCGGATGTTCCAGATAATTGAATTCCGCGCCAACGCCAGTCACATAAA
TGTCATCACAAAGTTCCTGAGGAGTTCCCGCACTAAAACCGAGCCAAATG
CGCAAATTCAAATGAGCTCCACTAAAATCGGGCCGAATTACCTCCCGTCG
ACTGTCAACTGTTTCTACCAGCTGTGCCATGTCGATATCGGTGAGGTGAG
CGAGCTGGTGGCCAAGGAGCCGCTGCCACCCGCAATCCATGCCGAGCACG
GCTGGTTCAGCCCCAATTTCGGCACCAGAGTCAGAGCGGCAATCAACAAG
TTCATCACGGAAAAAGTCGAATTTCTTATGAAATTGAATCAGTGAAATCC
AGATTGAAATGTTTTCATTTTATTAATAAATGTTTTCTTTATTTTGCTGA
TTATTTTTAATATGAATTGATAGCATTGACTTGCTATGCTACCGCCCGCA
TAAATGCAATATATTACCCTAGCAACTGATGCTATGCTGTCAACCCGCAT
AAATGCAACACATTACCCCACCAACTGTTATGCAGCCGCCCGAATAAATT
TAATTTTTTTCTCACCATATCGTCTAAAACAGGTAGCCTAGTTGAAAGGT
TTAATGGAAATTTAATCAATATGATATCCTCGTACGTTAATAGAAAGCAA
AAGGATTGGGATCTATTTAGCAACCGTTGTTTATTTGCATATGGAAATGC
AGTGAATGAAAGTATAGATGAATATCTTTATATTTCATGTATTTACGGTG
AAATAATATGCCAATCGATTTTAAATTCCAAGCAACTATTTCGCAATATA
TGGATATTTTGGATTATAAAGTTATTATGCAGGAACGATTACAGTCAGCA
TGGGCTCAAGTCGGACTTAAAATTAAACATTATCAACAAGCTTACAGAGA
GTGCTATGACAAGCGACATGCTCATGATATTTATATCGAAGATTTAGTAT
ATTTTAATAAGCCAGAGCTGGTAAAGGGCTTATCACCAAAGTCACAACGA
CCATTTAAAAGACCATATGTGGTATGTGATGCAACAGAAACTAATCTAAA
GCTACGTCCGCAAAATAATAAGAAAGCTGGAAAAATTGTTGTCCACGTTA
ATCTTTTGTAAGAAGGTAGCAGTGGCAGAAGATAGTAGATATCAGTTGAG
TTCACAAAGAAATGATAAAAAATGGGAAAGCAGTAAAACAAAAGGGTACG
AAAAATCCCGCCTCATTGGAATATATCAAAAAAGTGCTGTTCATCACAGG
AATAATGAAAATTAATGTTTTGGGAACGAATGCAATTCAATACTTTACTA
TCCTTGCGCCTGTCTGTCTTTTGAAATTTATTATTAATTTGATGTCATTA
GTAAATGATTTCCTTGTTTTTTTGCTCTTTGGTTACCAGCTCGATCACCT
CACCGACATCGACACGGCACAGCTGGCAGAAACAGTTGACAGTCGCGGCA
GGAAATTCGGCCCGATTTTAGTGGTGCTCATTTGTATTTGCACATTTGGA
TCGGTTTAAGTGGGGGAACTCCTCAGGAACTTTGTG
back to top

protein sequence of SMED30020341-orf-1

>SMED30020341-orf-1 ID=SMED30020341-orf-1|Name=SMED30020341-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=384bp
MNNYSTLTIPNIEFYVINYPLIINNEENALNSLGGVNTISKILTSNLFDN
QKKRIPLYLRPNMIYSKPLLSEHSETKGILMKLRQLRNKKTGEIKLVPEI
LGYSKIMYEYNALCDYQYNPHTSPNDALLDCPSVFYDKLLPSKTMMDISE
FDDYMNCNKEIFLPPLIFTKYEKPAELRIKVLEYPKSVIVKKKDLKFETQ
MTNSDLLIELFSMQPIWTSSNLDEAIRETNHSNIYKVRKLRSEIANHVTK
GPWRRTWIRKDYDHETLPESRMFQIIEFRANASHINVITKFLRSSRTKTE
PNAQIQMSSTKIGPNYLPSTVNCFYQLCHVDIGEVSELVAKEPLPPAIHA
EHGWFSPNFGTRVRAAINKFITEKVEFLMKLNQ*
back to top

protein sequence of SMED30020341-orf-2

>SMED30020341-orf-2 ID=SMED30020341-orf-2|Name=SMED30020341-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=109bp
MISSYVNRKQKDWDLFSNRCLFAYGNAVNESIDEYLYISCIYGEIICQSI
LNSKQLFRNIWIFWIIKLLCRNDYSQHGLKSDLKLNIINKLTESAMTSDM
LMIFISKI*
back to top

protein sequence of SMED30020341-orf-3

>SMED30020341-orf-3 ID=SMED30020341-orf-3|Name=SMED30020341-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=116bp
MIKNGKAVKQKGTKNPASLEYIKKVLFITGIMKINVLGTNAIQYFTILAP
VCLLKFIINLMSLVNDFLVFLLFGYQLDHLTDIDTAQLAETVDSRGRKFG
PILVVLICICTFGSV*
back to top

protein sequence of SMED30020341-orf-4

>SMED30020341-orf-4 ID=SMED30020341-orf-4|Name=SMED30020341-orf-4|organism=Schmidtea mediterranea sexual|type=polypeptide|length=118bp
MPIDFKFQATISQYMDILDYKVIMQERLQSAWAQVGLKIKHYQQAYRECY
DKRHAHDIYIEDLVYFNKPELVKGLSPKSQRPFKRPYVVCDATETNLKLR
PQNNKKAGKIVVHVNLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006384transcription initiation from RNA polymerase III promoter
GO:0000999RNA polymerase III type 1 promoter transcriptional preinitiation complex assembly
GO:0001009transcription from RNA polymerase III type 2 promoter
GO:0006351transcription, DNA-templated
GO:0035914skeletal muscle cell differentiation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR042536TFIIIC_tauA_Sfc1
IPR041499Tfc1/Sfc1_N
IPR040454TF_IIIC_Tfc1/Sfc1
IPR019136TF_IIIC_su-5
Vocabulary: cellular component
TermDefinition
GO:0000127transcription factor TFIIIC complex
GO:0005634nucleus
GO:0005654nucleoplasm
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR042536TFIIIC, subcomplex tauA subunit Sfc1, triple barrel domain superfamilyGENE3DG3DSA:3.30.200.160coord: 2..121
e-value: 4.7E-22
score: 79.8
IPR041499Transcription factor IIIC subunit Tfc1/Sfc1, triple barrel domainPFAMPF17682Tau95_Ncoord: 16..119
e-value: 4.1E-18
score: 65.8
NoneNo IPR availablePANTHERPTHR13230:SF5GENERAL TRANSCRIPTION FACTOR 3C POLYPEPTIDE 5coord: 6..171
IPR040454Transcription factor IIIC subunit Tfc1/Sfc1PANTHERPTHR13230GENERAL TRANSCRIPTION FACTOR IIIC, POLYPEPTIDE 5coord: 6..171