26S proteasome non-ATPase regulatory subunit 4

Overview
Name26S proteasome non-ATPase regulatory subunit 4
Smed IDSMED30020327
Length (bp)1139
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 26S proteasome non-ATPase regulatory subunit 4 (SMED30020327) t-SNE clustered cells

Violin plots show distribution of expression levels for 26S proteasome non-ATPase regulatory subunit 4 (SMED30020327) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020327

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30020327SMESG000070294.1 Contig5465_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Human
Match: PSMD4 (proteasome 26S subunit, non-ATPase 4 [Source:HGNC Symbol;Acc:HGNC:9561])

HSP 1 Score: 236.884 bits (603), Expect = 2.878e-74
Identity = 132/308 (42.86%), Postives = 193/308 (62.66%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSN-CQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKP---GIERSTADFGLDMD-DPDLAYALRVSL--------EDQRIRINQPTASEPILSTHQEINELDEHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSLAAQE 983
            M  E+TM+ +DNS YM+NGDF+P R  AQ++A+  +C++  R NPEN  GLITL+N C+VL TLT DT ++ SK+  V P G  +FCT I +AHLAL++RQ +N K +I+ F+GSP+ED+E++L+++AK+LKKEKV+V I+ FGE   N  KL  F+NT+NGKD + S ++++PPG  + + L S+PI  G      G+  S  +FG+D   DP+LA ALRVS+        E+ R       A   I +T  E  + D+  L M++        ++        D+  MTEEEQI +A+ +SL   E
Sbjct:    1 MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATTGTE--DSDDALLKMTI-------SQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAE 299          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Human
Match: PSMD4 (proteasome 26S subunit, non-ATPase 4 [Source:HGNC Symbol;Acc:HGNC:9561])

HSP 1 Score: 236.113 bits (601), Expect = 4.767e-74
Identity = 133/308 (43.18%), Postives = 193/308 (62.66%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSN-CQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKP---GIERSTADFGLDMD-DPDLAYALRVSL--------EDQRIRINQPTASEPILSTHQEINELDEHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSLAAQE 983
            M  E+TM+ +DNS YM+NGDF+P R  AQ++A+  +C++  R NPEN  GLITL+N C+VL TLT DT ++ SK+  V P G  +FCT I +AHLAL++RQ +N K +I+ F+GSP+ED+E++L+++AK+LKKEKV+V I+ FGE   N  KL  F+NT+NGKD + S ++++PPG  + + L S+PI  G      G+  S  +FG+D   DP+LA ALRVS+        E+ R       A   I +T  E  E D  +   +++  T +  E         D+  MTEEEQI +A+ +SL   E
Sbjct:    1 MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATTGTE-GERDSDD---ALLKMTISQQE--FGRTGLPDLSSMTEEEQIAYAMQMSLQGAE 302          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Human
Match: PSMD4 (proteasome 26S subunit, non-ATPase 4 [Source:HGNC Symbol;Acc:HGNC:9561])

HSP 1 Score: 203.756 bits (517), Expect = 1.030e-63
Identity = 98/203 (48.28%), Postives = 143/203 (70.44%), Query Frame = 3
Query:  144 MKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSN-CQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKP---GIERSTADFGLDMD-DPDLAY 737
            M+NGDF+P R  AQ++A+  +C++  R NPEN  GLITL+N C+VL TLT DT ++ SK+  V P G  +FCT I +AHLAL++RQ +N K +I+ F+GSP+ED+E++L+++AK+LKKEKV+V I+ FGE   N  KL  F+NT+NGKD + S ++++PPG  + + L S+PI  G      G+  S  +FG+D   DP+LA 
Sbjct:    1 MRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAMLGLGASDFEFGVDPSADPELAL 203          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Human
Match: PSMD4 (proteasome 26S subunit, non-ATPase 4 [Source:HGNC Symbol;Acc:HGNC:9561])

HSP 1 Score: 48.9062 bits (115), Expect = 2.859e-6
Identity = 20/32 (62.50%), Postives = 30/32 (93.75%), Query Frame = 3
Query:  435 GSPIEDSEEELIRVAKKLKKEKVSVVIVTFGE 530
            GSP+ED+E++L+++AK+LKKEKV+V I+ FGE
Sbjct:    2 GSPVEDNEKDLVKLAKRLKKEKVNVDIINFGE 33          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Celegans
Match: rpn-10 (26S proteasome non-ATPase regulatory subunit 4 [Source:UniProtKB/Swiss-Prot;Acc:O61742])

HSP 1 Score: 164.851 bits (416), Expect = 2.148e-47
Identity = 97/236 (41.10%), Postives = 154/236 (65.25%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSN-CQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSE-EELIRVAKKLKKEKVSVVIVTFGELTSN-ENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPI---------FVGNKPGIERSTADFGLDMD-DPDLAYALRVSLEDQR 767
            M QE+TMI +DNS YM+NGDF P R  +Q++A+  +     R NPEN  G+++++N  QVL +L+ +  ++  K   + P G  +F   I IAHLAL++RQ RN K ++++F+GSP+E+ E  EL+++AKK+KKEKV   ++ FGE  S+   K + F++T+NGK+ S S +I +P G+ +T+ L  + +         F G   G++ +   FG+D++ DPDLA ALRVS+E++R
Sbjct:    1 MVQESTMICVDNSEYMRNGDFQPTRLQSQQDAVNLVTQCKLRANPENAVGILSMANSVQVLSSLSTEQGRLMMKNHSIEPFGKCNFIAGIKIAHLALKHRQNRNHKMRVVLFIGSPLEEIEMNELVKIAKKMKKEKVLCDVIMFGENESDGHEKFSTFVDTLNGKEGSGSSLIVVPQGSSLTDALLQSSVCKNEDGQAAFGGGGNGMDNA---FGMDVENDPDLALALRVSMEEER 233          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Celegans
Match: rpn-10 (26S proteasome non-ATPase regulatory subunit 4 [Source:UniProtKB/Swiss-Prot;Acc:O61742])

HSP 1 Score: 164.851 bits (416), Expect = 2.148e-47
Identity = 97/236 (41.10%), Postives = 154/236 (65.25%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSN-CQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSE-EELIRVAKKLKKEKVSVVIVTFGELTSN-ENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPI---------FVGNKPGIERSTADFGLDMD-DPDLAYALRVSLEDQR 767
            M QE+TMI +DNS YM+NGDF P R  +Q++A+  +     R NPEN  G+++++N  QVL +L+ +  ++  K   + P G  +F   I IAHLAL++RQ RN K ++++F+GSP+E+ E  EL+++AKK+KKEKV   ++ FGE  S+   K + F++T+NGK+ S S +I +P G+ +T+ L  + +         F G   G++ +   FG+D++ DPDLA ALRVS+E++R
Sbjct:    1 MVQESTMICVDNSEYMRNGDFQPTRLQSQQDAVNLVTQCKLRANPENAVGILSMANSVQVLSSLSTEQGRLMMKNHSIEPFGKCNFIAGIKIAHLALKHRQNRNHKMRVVLFIGSPLEEIEMNELVKIAKKMKKEKVLCDVIMFGENESDGHEKFSTFVDTLNGKEGSGSSLIVVPQGSSLTDALLQSSVCKNEDGQAAFGGGGNGMDNA---FGMDVENDPDLALALRVSMEEER 233          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Fly
Match: Rpn10 (gene:FBgn0015283 transcript:FBtr0078368)

HSP 1 Score: 210.305 bits (534), Expect = 4.085e-64
Identity = 124/316 (39.24%), Postives = 177/316 (56.01%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSN-CQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKPGIERSTA----DFGLDM-DDPDLAYALRVSLEDQRIRINQ------PTASEPILST-------------HQEINELDEHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSL 971
            M  E+TMI  DNS + +NGD+ P R I QR+ I  +C    R NPEN  GL+TLSN  +VL TLT D  ++FSK+  V P G  +  T I IAHL L++RQ +N K +I++F+GSPI   E +L++ AK+LKKEKV+V IV+FG+  +N   L  FIN +NGKD + S ++S+P G+ +++ L S+PI  G              +FG+D  +DP+LA ALRVS+E+QR R         P  + P                 ++E    +    T   +   A  +   +  D   D   MTEEEQI FA+ +S+
Sbjct:    1 MVLESTMICFDNSDFQRNGDYFPTRLIVQRDGINLVCLTKLRSNPENNVGLMTLSNTVEVLATLTSDAGRIFSKMHLVQPKGEINLLTGIRIAHLVLKHRQGKNHKMRIVVFVGSPINHEEGDLVKQAKRLKKEKVNVDIVSFGDHGNNNEILTAFINALNGKDGTGSHLVSVPRGSVLSDALLSSPIIQGEDGMGGAGLGGNVFEFGVDPNEDPELALALRVSMEEQRQRQESEQRRANPDGAPPTGGDAGGGGGVSGSGPGNEESAGAENEANTEEAMLQRALALSTETPEDNLPDFANMTEEEQIAFAMQMSM 316          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Fly
Match: Rpn10 (gene:FBgn0015283 transcript:FBtr0333453)

HSP 1 Score: 210.305 bits (534), Expect = 4.085e-64
Identity = 124/316 (39.24%), Postives = 177/316 (56.01%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSN-CQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKPGIERSTA----DFGLDM-DDPDLAYALRVSLEDQRIRINQ------PTASEPILST-------------HQEINELDEHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSL 971
            M  E+TMI  DNS + +NGD+ P R I QR+ I  +C    R NPEN  GL+TLSN  +VL TLT D  ++FSK+  V P G  +  T I IAHL L++RQ +N K +I++F+GSPI   E +L++ AK+LKKEKV+V IV+FG+  +N   L  FIN +NGKD + S ++S+P G+ +++ L S+PI  G              +FG+D  +DP+LA ALRVS+E+QR R         P  + P                 ++E    +    T   +   A  +   +  D   D   MTEEEQI FA+ +S+
Sbjct:    1 MVLESTMICFDNSDFQRNGDYFPTRLIVQRDGINLVCLTKLRSNPENNVGLMTLSNTVEVLATLTSDAGRIFSKMHLVQPKGEINLLTGIRIAHLVLKHRQGKNHKMRIVVFVGSPINHEEGDLVKQAKRLKKEKVNVDIVSFGDHGNNNEILTAFINALNGKDGTGSHLVSVPRGSVLSDALLSSPIIQGEDGMGGAGLGGNVFEFGVDPNEDPELALALRVSMEEQRQRQESEQRRANPDGAPPTGGDAGGGGGVSGSGPGNEESAGAENEANTEEAMLQRALALSTETPEDNLPDFANMTEEEQIAFAMQMSM 316          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Zebrafish
Match: psmd4a (proteasome 26S subunit, non-ATPase 4a [Source:ZFIN;Acc:ZDB-GENE-040625-104])

HSP 1 Score: 241.891 bits (616), Expect = 1.471e-76
Identity = 133/301 (44.19%), Postives = 195/301 (64.78%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSN-CQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKP---GIERSTADFGLDMD-DPDLAYALRVSLEDQRIRINQPTASEPILSTHQE-INELDEHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSLAAQE 983
            M  E+TM+ +DNS YM+NGDF+P R  AQ++A+  +C++  R NPEN  GLIT++N C+VL TLT DT ++ SK+  V P G  SFCT I +AHLAL++RQ +N K +I+ F+GSP+ED+E++L+++AK+LKKEKV+V I+ FGE   N  KL  F+NT+NGK+ + S ++++PPG  + + L S+PI  G      G+  S  +FG+D   DP+LA ALRVS+E+QR R  +      + S  +  I      E   +++  +A+  E  S      D   MTEEEQI +A+ +SLA  E
Sbjct:    1 MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITMANNCEVLTTLTPDTGRILSKLHAVQPLGKISFCTGIRVAHLALKHRQGKNHKMRIVAFVGSPVEDNEKDLVKMAKRLKKEKVNVDIINFGEEEMNTEKLTAFVNTLNGKEGTGSHLVTVPPGPSLADALLSSPILAGEGGTMIGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAVQSAAEAGIPTTASDESEEALLKMSASQPE--SGVAALPDFSSMTEEEQIAYAMQMSLAGGE 299          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Zebrafish
Match: psmd4b (proteasome 26S subunit, non-ATPase 4b [Source:ZFIN;Acc:ZDB-GENE-050417-96])

HSP 1 Score: 235.728 bits (600), Expect = 4.221e-74
Identity = 129/300 (43.00%), Postives = 191/300 (63.67%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSN-CQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKP---GIERSTADFGLDMD-DPDLAYALRVSLEDQRIRINQPTASEPILSTHQEINELDEHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSLAAQE 983
            M  E+TM+ +DNS YM+NGDF+P R  AQ++A+  IC++  R NPEN  GLIT++N C+VL TLT DT ++ SK+  V P G  SFCT I +AHLAL++RQ +N K +I+ F+GSP+ED E++L+++AK+LKKEKVSV I+ FGE   N  KL  F+NT+NGK+   S ++++PPG  + + L S+PI  G      G+  S  +FG+D   DP+LA ALRVS+E+QR R  +        +    +    +  ++    D +   + K+S +    D   MTE+EQI +A+ +S+   E
Sbjct:    1 MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIICHSKTRSNPENNVGLITMANNCEVLTTLTPDTGRILSKLHAVQPRGVISFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDQEKDLVKMAKRLKKEKVSVDIINFGEEEVNTEKLTVFVNTLNGKEGVGSHLVTVPPGPSLADALLSSPIMAGEGGTIMGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEE-------EARRAAVASAADAGVSSPTADESENALLKMSTAPALPDFSRMTEDEQIAYALQMSMQGGE 293          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Zebrafish
Match: psmd4a (proteasome 26S subunit, non-ATPase 4a [Source:ZFIN;Acc:ZDB-GENE-040625-104])

HSP 1 Score: 201.83 bits (512), Expect = 3.340e-63
Identity = 97/203 (47.78%), Postives = 143/203 (70.44%), Query Frame = 3
Query:  144 MKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSN-CQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKP---GIERSTADFGLDMD-DPDLAY 737
            M+NGDF+P R  AQ++A+  +C++  R NPEN  GLIT++N C+VL TLT DT ++ SK+  V P G  SFCT I +AHLAL++RQ +N K +I+ F+GSP+ED+E++L+++AK+LKKEKV+V I+ FGE   N  KL  F+NT+NGK+ + S ++++PPG  + + L S+PI  G      G+  S  +FG+D   DP+LA 
Sbjct:    1 MRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITMANNCEVLTTLTPDTGRILSKLHAVQPLGKISFCTGIRVAHLALKHRQGKNHKMRIVAFVGSPVEDNEKDLVKMAKRLKKEKVNVDIINFGEEEMNTEKLTAFVNTLNGKEGTGSHLVTVPPGPSLADALLSSPILAGEGGTMIGLGASDFEFGVDPSADPELAL 203          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Zebrafish
Match: PSMD4 (proteasome 26S subunit, non-ATPase 4 [Source:HGNC Symbol;Acc:HGNC:9561])

HSP 1 Score: 108.227 bits (269), Expect = 2.357e-28
Identity = 49/94 (52.13%), Postives = 67/94 (71.28%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLS-NCQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAH 377
            M  E+TM+ +DNS YM+NGDF+P R  AQ++A+  +C++  R NPEN  GLIT++ NC+VL TLT DT ++ SK+  V P G  SFCT I +AH
Sbjct:    1 MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITMANNCEVLTTLTPDTGRILSKLHAVQPLGKISFCTGIRVAH 94          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Mouse
Match: Psmd4 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 4 [Source:MGI Symbol;Acc:MGI:1201670])

HSP 1 Score: 234.958 bits (598), Expect = 8.348e-74
Identity = 132/307 (43.00%), Postives = 193/307 (62.87%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSN-CQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKP---GIERSTADFGLDMD-DPDLAYALRVSLEDQRIRINQPTASEPI-------LSTHQEINELDEHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSLAAQE 983
            M  E+TM+ +DNS YM+NGDF+P R  AQ++A+  +C++  R NPEN  GLITL+N C+VL TLT DT ++ SK+  V P G  +FCT I +AHLAL++RQ +N K +I+ F+GSP+ED+E++L+++AK+LKKEKV+V I+ FGE   N  KL  F+NT+NGKD + S ++++PPG  + + L S+PI  G      G+  S  +FG+D   DP+LA ALRVS+E+QR R  +              ++T     E D  +   +++  T    E         D+  MTEEEQI +A+ +SL   E
Sbjct:    1 MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATPGTEGERDSDD---ALLKMTINQQE--FGRPGLPDLSSMTEEEQIAYAMQMSLQGTE 302          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Mouse
Match: Psmd4 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 4 [Source:MGI Symbol;Acc:MGI:1201670])

HSP 1 Score: 234.572 bits (597), Expect = 1.683e-73
Identity = 132/307 (43.00%), Postives = 193/307 (62.87%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSN-CQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKP---GIERSTADFGLDMD-DPDLAYALRVSLEDQRIRINQPTASEPI-------LSTHQEINELDEHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSLAAQE 983
            M  E+TM+ +DNS YM+NGDF+P R  AQ++A+  +C++  R NPEN  GLITL+N C+VL TLT DT ++ SK+  V P G  +FCT I +AHLAL++RQ +N K +I+ F+GSP+ED+E++L+++AK+LKKEKV+V I+ FGE   N  KL  F+NT+NGKD + S ++++PPG  + + L S+PI  G      G+  S  +FG+D   DP+LA ALRVS+E+QR R  +              ++T     E D  +   +++  T    E         D+  MTEEEQI +A+ +SL   E
Sbjct:    1 MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATPGTEGERDSDD---ALLKMTINQQE--FGRPGLPDLSSMTEEEQIAYAMQMSLQGTE 302          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Mouse
Match: Psmd4 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 4 [Source:MGI Symbol;Acc:MGI:1201670])

HSP 1 Score: 234.187 bits (596), Expect = 1.896e-73
Identity = 131/306 (42.81%), Postives = 193/306 (63.07%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSN-CQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKP---GIERSTADFGLDMD-DPDLAYALRVSLEDQRIRINQPTASEPILSTHQE------INELDEHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSLAAQE 983
            M  E+TM+ +DNS YM+NGDF+P R  AQ++A+  +C++  R NPEN  GLITL+N C+VL TLT DT ++ SK+  V P G  +FCT I +AHLAL++RQ +N K +I+ F+GSP+ED+E++L+++AK+LKKEKV+V I+ FGE   N  KL  F+NT+NGKD + S ++++PPG  + + L S+PI  G      G+  S  +FG+D   DP+LA ALRVS+E+QR R  +        S  +         + D+  L M++        ++        D+  MTEEEQI +A+ +SL   E
Sbjct:    1 MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATPGTEDSDDALLKMTI-------NQQEFGRPGLPDLSSMTEEEQIAYAMQMSLQGTE 299          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Mouse
Match: Psmd4 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 4 [Source:MGI Symbol;Acc:MGI:1201670])

HSP 1 Score: 48.9062 bits (115), Expect = 1.914e-6
Identity = 20/32 (62.50%), Postives = 30/32 (93.75%), Query Frame = 3
Query:  435 GSPIEDSEEELIRVAKKLKKEKVSVVIVTFGE 530
            GSP+ED+E++L+++AK+LKKEKV+V I+ FGE
Sbjct:    1 GSPVEDNEKDLVKLAKRLKKEKVNVDIINFGE 32          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. UniProt/SwissProt
Match: sp|O17453|PSMD4_SCHMA (26S proteasome non-ATPase regulatory subunit 4 OS=Schistosoma mansoni OX=6183 PE=2 SV=2)

HSP 1 Score: 267.314 bits (682), Expect = 5.733e-85
Identity = 138/301 (45.85%), Postives = 204/301 (67.77%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSNCQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVG-NKPGIERS--TADFGLD-MDDPDLAYALRVSLEDQRIR----INQPTASEPILSTHQEINELDEHELTMSVIDATAAHMEKLSNSD--KTVDIQGMTEEEQIQFAINVSL 971
            MSQEAT+IA+DNS YM+NGDF P R  AQ +A+  IC + +++NPENT GL++L+N +VLCTLT D SK+++++  V P G   FC+SI IAHLALR+RQ R+QK +I+ F+GSPI + E+EL R+AK+LKKEKV+V I+ FGE  +NE KL++FI+T+NGKD + S +IS+ PG  + + L ++P+  G +  G+  +    +FGLD  +DPDL YALRVS+EDQR+R    +N   ++  +++T          E  +    A +  M    +S     +D+  M+EE+QI +A+ +SL
Sbjct:    1 MSQEATIIAVDNSDYMRNGDFFPTRLQAQNDAVGLICQSKRQRNPENTIGLLSLANTEVLCTLTNDVSKIYNRLHLVEPKGRIIFCSSIRIAHLALRHRQLRHQKMRIVCFIGSPILEDEKELTRLAKRLKKEKVNVDIINFGENETNEQKLSEFIDTLNGKDGTGSHLISVAPGTVLHDTLMTSPVVAGEDGSGMAGAGLGLEFGLDGAEDPDLLYALRVSMEDQRMRQEHEVNGDGSNTSVVATSLPAGSGTSEEAMLQQALAMSMQMNNTESSSLPMDIDLAAMSEEDQIAYALRMSL 301          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. UniProt/SwissProt
Match: sp|P55036|PSMD4_HUMAN (26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMD4 PE=1 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 1.382e-73
Identity = 132/308 (42.86%), Postives = 193/308 (62.66%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSN-CQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKP---GIERSTADFGLDMD-DPDLAYALRVSL--------EDQRIRINQPTASEPILSTHQEINELDEHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSLAAQE 983
            M  E+TM+ +DNS YM+NGDF+P R  AQ++A+  +C++  R NPEN  GLITL+N C+VL TLT DT ++ SK+  V P G  +FCT I +AHLAL++RQ +N K +I+ F+GSP+ED+E++L+++AK+LKKEKV+V I+ FGE   N  KL  F+NT+NGKD + S ++++PPG  + + L S+PI  G      G+  S  +FG+D   DP+LA ALRVS+        E+ R       A   I +T  E  + D+  L M++        ++        D+  MTEEEQI +A+ +SL   E
Sbjct:    1 MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATTGTE--DSDDALLKMTI-------SQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAE 299          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. UniProt/SwissProt
Match: sp|Q58DA0|PSMD4_BOVIN (26S proteasome non-ATPase regulatory subunit 4 OS=Bos taurus OX=9913 GN=PSMD4 PE=2 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 5.197e-73
Identity = 131/301 (43.52%), Postives = 192/301 (63.79%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSN-CQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKP---GIERSTADFGLDMD-DPDLAYALRVSLEDQRIRINQPTASEPILSTHQE-INELDEHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSLAAQE 983
            M  E+TM+ +DNS YM+NGDF+P R  AQ++A+  +C++  R NPEN  GLITL+N C+VL TLT DT ++ SK+  V P G  +FCT I +AHLAL++RQ +N K +I+ F+GSP+ED+E++L+++AK+LKKEKV+V I+ FGE   N  KL  F+NT+NGKD + S ++++PPG  + + L S+PI  G      G+  S  +FG+D   DP+LA ALRVS+E+QR R  +        S  +  I      +   +++  T +  E         D+  MTEEEQI +A+ +SL   E
Sbjct:    1 MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATAGTEDSDDALLKMTISQQE--FGRTGLPDLSSMTEEEQIAYAMQMSLQGAE 299          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. UniProt/SwissProt
Match: sp|O35226|PSMD4_MOUSE (26S proteasome non-ATPase regulatory subunit 4 OS=Mus musculus OX=10090 GN=Psmd4 PE=1 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 1.326e-72
Identity = 131/306 (42.81%), Postives = 193/306 (63.07%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSN-CQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKP---GIERSTADFGLDMD-DPDLAYALRVSLEDQRIRINQPTASEPILSTHQE------INELDEHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSLAAQE 983
            M  E+TM+ +DNS YM+NGDF+P R  AQ++A+  +C++  R NPEN  GLITL+N C+VL TLT DT ++ SK+  V P G  +FCT I +AHLAL++RQ +N K +I+ F+GSP+ED+E++L+++AK+LKKEKV+V I+ FGE   N  KL  F+NT+NGKD + S ++++PPG  + + L S+PI  G      G+  S  +FG+D   DP+LA ALRVS+E+QR R  +        S  +         + D+  L M++        ++        D+  MTEEEQI +A+ +SL   E
Sbjct:    1 MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATPGTEDSDDALLKMTI-------NQQEFGRPGLPDLSSMTEEEQIAYAMQMSLQGTE 299          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. UniProt/SwissProt
Match: sp|P55035|PSMD4_DROME (26S proteasome non-ATPase regulatory subunit 4 OS=Drosophila melanogaster OX=7227 GN=Rpn10 PE=1 SV=2)

HSP 1 Score: 210.305 bits (534), Expect = 4.095e-63
Identity = 124/316 (39.24%), Postives = 177/316 (56.01%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSN-CQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKPGIERSTA----DFGLDM-DDPDLAYALRVSLEDQRIRINQ------PTASEPILST-------------HQEINELDEHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSL 971
            M  E+TMI  DNS + +NGD+ P R I QR+ I  +C    R NPEN  GL+TLSN  +VL TLT D  ++FSK+  V P G  +  T I IAHL L++RQ +N K +I++F+GSPI   E +L++ AK+LKKEKV+V IV+FG+  +N   L  FIN +NGKD + S ++S+P G+ +++ L S+PI  G              +FG+D  +DP+LA ALRVS+E+QR R         P  + P                 ++E    +    T   +   A  +   +  D   D   MTEEEQI FA+ +S+
Sbjct:    1 MVLESTMICFDNSDFQRNGDYFPTRLIVQRDGINLVCLTKLRSNPENNVGLMTLSNTVEVLATLTSDAGRIFSKMHLVQPKGEINLLTGIRIAHLVLKHRQGKNHKMRIVVFVGSPINHEEGDLVKQAKRLKKEKVNVDIVSFGDHGNNNEILTAFINALNGKDGTGSHLVSVPRGSVLSDALLSSPIIQGEDGMGGAGLGGNVFEFGVDPNEDPELALALRVSMEEQRQRQESEQRRANPDGAPPTGGDAGGGGGVSGSGPGNEESAGAENEANTEEAMLQRALALSTETPEDNLPDFANMTEEEQIAFAMQMSM 316          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. TrEMBL
Match: W6USR5 (26S proteasome non-ATPase regulatory subunit 4 OS=Echinococcus granulosus OX=6210 GN=EGR_08704 PE=4 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 6.549e-89
Identity = 152/311 (48.87%), Postives = 204/311 (65.59%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSNCQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNK-----PGIERSTADFGLD-MDDPDLAYALRVSLEDQRIR---------INQPTASEPILSTHQEINELDEHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSLAAQEQ 986
            MSQEA MIA+DNS +M+NGDF P R  AQ +A+  +C   ++ NPENT GLI+L+N +VLCTLT D SK+++++  + P G  SFCTS+ IAHLALR+RQ R+QK +I+ F+GSPI+D E E++++AK+LKKEKV+V IV FGE   N+ KL +F+ TINGKD + S ++++PPG  + E L S+PI  G       PG      +FGLD +DDPDL YALRVS+EDQR+R           Q TA  P  +   E  EL    L MS+    A+     S +   VD+  MTEEEQI +AI +S+  QEQ
Sbjct:    1 MSQEAVMIAVDNSDFMRNGDFAPSRLQAQNDAVNLLCQVKRQANPENTVGLISLANTEVLCTLTSDMSKIYNRLHLIQPKGGISFCTSMRIAHLALRHRQLRHQKMRIVCFIGSPIKDDEAEMVKLAKRLKKEKVNVDIVNFGEDEVNQKKLLEFVETINGKDGTGSHLVTVPPGTVLHESLASSPIIAGEDGSGALPG-SGIGLEFGLDAVDDPDLIYALRVSMEDQRMRQEQEASANSGGQATAVLPGAAGTSE-EELLRQALAMSMQVGPASS----SGASGPVDLANMTEEEQIAYAIQMSMQTQEQ 305          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. TrEMBL
Match: A0A0R3W8T9 (VWFA domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS6809 PE=4 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 6.838e-89
Identity = 156/340 (45.88%), Postives = 216/340 (63.53%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSNCQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGN-------KPGIERSTADFGLD-MDDPDLAYALRVSLEDQRIR---------INQPTASEPILSTHQEINELDEHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSLAAQEQNLLS---KSDTKNEHSTNKRLSREDKD 1058
            MSQEA MIA+DNS +M+NGDF P R  AQ +A+  +C   ++ NPENT GLI+L+N +VLCTLT D SK+++++  + P G  SFCTS+ IAHLALR+RQ R+QK +I+ F+GSPI+D E E++++AK+LKKEKV+V IV FGE   N+ KL +FI ++NGKD + S ++++PPG  + E L S+PI  G         PGI     +FGLD +DDPDL YALRVS+EDQR+R           Q TA  P  +   E  EL    L MS+   +        ++  +VD+  MTEEEQI +AI +S+  QEQ   S   K D++N   +    ++ D D
Sbjct:    1 MSQEAVMIAVDNSDFMRNGDFTPSRLQAQNDAVNLLCQVKRQANPENTVGLISLANTEVLCTLTSDMSKIYNRLHLIQPKGGISFCTSVRIAHLALRHRQLRHQKMRIVCFIGSPIKDDEAEMVKLAKRLKKEKVNVDIVNFGEDEVNQKKLLEFIESVNGKDGTGSHLVTVPPGTVLHESLASSPIIAGEDGSGALPGPGI---GLEFGLDAVDDPDLIYALRVSMEDQRMRQEQEASANSAGQSTAVLPGSAGTSE-EELLRQALAMSMQVGSG----NPGSTSGSVDLANMTEEEQIAYAIQMSMQTQEQERASEEKKPDSENNDDSGNNNAKMDVD 332          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. TrEMBL
Match: A0A0R3WJZ9 (VWFA domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS1026 PE=4 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 1.464e-86
Identity = 155/337 (45.99%), Postives = 212/337 (62.91%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSNCQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNK-----PGIERSTADFGLD-MDDPDLAYALRVSLEDQRIRINQPTA------SEPIL--STHQEINELDEHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSLAAQEQNLLS---KSDTKNEHSTNKRLSREDKD 1058
            MSQEA MIA+DNS +M+NGDF P R  AQ +A+  +C   ++ NPENT GLI+L+N +VLCTLT D SK+++++  + P G  SFCTS+ IAHLALR+RQ R+QK +I+ F+GSPI D E E++++AK+LKKEKV+V IV FGE   N+ KL +F+ ++NGKD + S ++++PPG  + E L S+PI  G       PG      +FGLD +DDPDL YALRVS+EDQR+R  Q  +      S  IL  S      EL    L MS+   + +       S   VD+  MTEEEQI +AI +S+  +EQ   S   KSD+ N        ++ D D
Sbjct:    1 MSQEAVMIAVDNSDFMRNGDFTPSRLQAQNDAVNLLCQVKRQANPENTVGLISLANTEVLCTLTSDMSKIYNRLHLIQPKGGISFCTSVRIAHLALRHRQLRHQKMRIVCFVGSPINDDETEMVKLAKRLKKEKVNVDIVNFGENEVNQKKLLEFVESVNGKDGTGSHLVTVPPGTVLHESLASSPIIAGEDGSGALPG-SGIGLEFGLDAVDDPDLIYALRVSMEDQRMRQEQEASANAGGQSAAILPGSAGTSEEELLRQALAMSMQVGSGS-------SSGPVDLANMTEEEQIAYAIQMSMQTEEQERSSEEKKSDSGNNEDNGNNNAKMDVD 329          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. TrEMBL
Match: A0A158QD79 (VWFA domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS2550 PE=4 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 7.761e-86
Identity = 145/325 (44.62%), Postives = 210/325 (64.62%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSNCQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKP----GIERSTADFGLD-MDDPDLAYALRVSLED----QRIRINQPTASEP--ILSTHQEINELD--EHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSLAAQEQNLLSKSDTKNEHSTNK 1034
            MSQEA MIA+DNS +M+NGDF+P R  AQ +A+ F+C+  +  NPENT GLI+L+N ++LCTLT D +K+ S++  V   G+  FCTSI IAHLALR+RQ R QK +I+ F+GSPI+D E +++++A++LKKEKV+V IV FGE   N+ KL DF+  +NGKD + S ++++PPG G+ E L S+PI  G       G+    A+FG+D +DDPDL YALRVS+E+    Q  + N  +A++P  +L      +E D     L +S+ D        +++   TVDI  MTE+EQI +AI +S+  QE  +    D   +  + K
Sbjct:    1 MSQEALMIAVDNSDFMRNGDFVPTRLQAQHDAVNFLCHIKRNANPENTVGLISLANTEILCTLTSDVNKLMSRLHAVQLKGDIRFCTSIRIAHLALRHRQLRQQKMRIICFIGSPIKDDEADMVKLARRLKKEKVNVDIVNFGEDEVNQKKLLDFVEAVNGKDGTGSHLVTVPPGTGLRESLHSSPIIGGEDGAGSIGLSGFDAEFGMDAIDDPDLLYALRVSMEEHHQAQERQANAESAAQPSAVLPQAAGTSEDDFLRQALALSMQDVGGPSANAIASG--TVDIANMTEDEQIAYAIQMSIQTQEAEVAKPVDKSEKPESEK 323          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. TrEMBL
Match: A0A183SB98 (VWFA domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS1496 PE=4 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 6.199e-85
Identity = 143/311 (45.98%), Postives = 203/311 (65.27%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSNCQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGN----KPGIERSTADFGLD-MDDPDLAYALRVSLEDQRIRINQ---------PTASEPILSTHQEINELDEHELTMSV-IDATAAHMEKLSNSDKT-VDIQGMTEEEQIQFAINVSLAAQE 983
            MSQEA MIA+DNS +M+NGDF P R  AQ +A+  +C   ++ NPENT GLI+L+N +VLCTLT D S++++++  + P G  SFCTS+ IAHLALR+RQ R+QK +I+ F+GSPIED E+++I++AK+LKKEKV++ IV FGE   N+ KL +FI+ +NGKD + S ++++PPG  + E L ++PI  G              +FGLD  +DPDL YALRVS+EDQR+R  Q         P ASE +L             L MS+ +D         +N D + +D+  M+EE+QI +AI +S+ AQE
Sbjct:    1 MSQEAVMIAVDNSDFMRNGDFAPTRLQAQNDAVSLLCQVKRQANPENTVGLISLANTEVLCTLTSDMSRIYNRLHLIQPKGGISFCTSVRIAHLALRHRQLRHQKMRIVCFIGSPIEDDEKDMIKLAKRLKKEKVNIDIVNFGEDEVNQKKLLEFIDMVNGKDGTGSHLVTVPPGTVLHESLVTSPIIAGEDGGGALAGSGLGLEFGLDAAEDPDLLYALRVSMEDQRMRQEQEANVTSGSAPVASEALL----------RQALAMSMQVDP--------ANIDPSPIDLANMSEEDQIAYAIQMSIQAQE 293          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Cavefish
Match: psmd4a (proteasome 26S subunit, non-ATPase 4 [Source:NCBI gene;Acc:103039450])

HSP 1 Score: 239.965 bits (611), Expect = 7.104e-76
Identity = 136/317 (42.90%), Postives = 195/317 (61.51%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSN-CQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKP---GIERSTADFGLDMD-DPDLAYALRVSLEDQRIR-----------------INQPTASEPILSTHQEINELDEHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSLAAQE 983
            M  E+TM+ +DNS YM+NGDF+P R  AQ++A+  +C++  R NPEN  GLIT++N C+VL TLT DT ++ SK+  V P G  SFCT I +AHLAL++RQ +N K +I+ F+GSP+ED+E++L+++AK+LKKEKV+V ++ FGE   N  KL  F+NT+NGK+ + S ++++PPG  + + L S+PI  G      G+  S  +FG+D   DP+LA ALRVS+E+QR R                 I  PTA           +E +E  L MSV        +  +      D   MTEEEQI +A+ +SLA  E
Sbjct:    1 MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITMANNCEVLTTLTPDTGRILSKLHAVQPRGRISFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDVINFGEEEVNTEKLTAFVNTLNGKEGTGSHLVTVPPGPSLADALLSSPILAGEGGTMMGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAQSAAEAGITTPTA-----------DESEEALLKMSV-------SQPETGVPSLPDFSSMTEEEQIAYAMQMSLAGGE 299          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Sea Lamprey
Match: psmd4a (proteasome 26S subunit, non-ATPase 4a [Source:ZFIN;Acc:ZDB-GENE-040625-104])

HSP 1 Score: 197.978 bits (502), Expect = 4.870e-60
Identity = 130/316 (41.14%), Postives = 190/316 (60.13%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLI-TLSNCQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKP---GIERSTADFGLDMD-DPDLAYALRVSLEDQRIRIN----------------QPTASEPILSTHQEINELDEHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSLAAQE 983
            M  E+TM+ +DNS YM+NGDF+P R  AQ++A+  +C++  R         + T  NC+VL TLT DT K+ SK+  V P G+ +FCT I +AHLAL++RQ +N K +I++F+GSPI + E+EL+++AK+LKKEKV+V I+ FGE  SN  KL  F+NT+NGK+ + S ++++PPG+ + + L S+PI  G      G+E S  +FG+D + DP+LA ALRVS+E+QR R                  +P A E           L E  L MS+        +  + S    D   M+EEEQI +A+ +SL A E
Sbjct:   12 MGLESTMVCVDNSEYMRNGDFVPTRLQAQQDAVNIVCHSKTRSEYMRNGDFVPTRLNCEVLTTLTSDTGKILSKLHSVQPKGDINFCTGIRVAHLALKHRQGKNHKMRIVVFIGSPILNDEKELLKLAKRLKKEKVNVDIINFGEEGSNTEKLTAFVNTLNGKEGTGSHLVTVPPGSSLADALLSSPILAGEGGVGFGLEASDFEFGVDPNADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGVKPAAGE------DSDQALLEQALAMSM-------QQPETVSPGIPDFSSMSEEEQIAYAMQMSLQASE 314          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Yeast
Match: RPN10 (Non-ATPase base subunit of the 19S RP of the 26S proteasome; N-terminus plays a role in maintaining the structural integrity of the regulatory particle (RP); binds selectively to polyubiquitin chains; homolog of the mammalian S5a protein [Source:SGD;Acc:S000001243])

HSP 1 Score: 145.591 bits (366), Expect = 1.139e-41
Identity = 88/236 (37.29%), Postives = 133/236 (56.36%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLS--NCQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPG-NGITEYLRSNPIFVGNKPGIERSTA-------------DFGLDMD-DPDLAYALRVSL 755
            M  EAT++ +DNS Y +NGDF   RF AQ +++ FI    +  NPENT GLI+ +  N +VL T T +  K+ + +     +G     T++ IA L L++RQ + Q  +I+ F+ SPI DS +ELIR+AK LKK  V+V I+ FGE+  N   L++FI  +N     TS ++++ PG   + E + S+PI +        +               DFG+D   DP+LA ALR+S+
Sbjct:    1 MVLEATVLVIDNSEYSRNGDFPRTRFEAQIDSVEFIFQAKRNSNPENTVGLISGAGANPRVLSTFTAEFGKILAGLHDTQIEGKLHMATALQIAQLTLKHRQNKVQHQRIVAFVCSPISDSRDELIRLAKTLKKNNVAVDIINFGEIEQNTELLDEFIAAVNNPQEETSHLLTVTPGPRLLYENIASSPIILEEGSSGMGAFGGSGGDSDANGTFMDFGVDPSMDPELAMALRLSM 236          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Nematostella
Match: EDO31082 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYY2])

HSP 1 Score: 202.986 bits (515), Expect = 1.000e-61
Identity = 129/327 (39.45%), Postives = 205/327 (62.69%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSNCQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKPGIE---RSTADFGLDMD-DPDLAYALRVSLEDQRIRINQ-----PTASEPILSTHQEINELDEHELTMSV-IDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSLAAQEQNLLSKSDTKNEHSTNKRLSRE 1049
            M  E+T++ +DNS +M+NGDF+P R  AQ++A+  IC++  RQNPEN  GL+T ++ +VL TLT D  K+ + + KV P G+ +F T++  AHL L++RQ +N K +I++F+GSPIE  E+E++++AKKLKKEKV+V +V FGE  SN  KL  FIN +NGKD + S ++++PPG  ++  L S+ I VG          S  +FG+D + DP+LA ALRVS+E+QR R  +      T +E  L+T  + ++ +E  L  ++ +  +A  + +       VD   M+EEEQI +A+ +SL    ++ +S  +  ++    K  + E
Sbjct:    1 MVLESTILCVDNSEFMRNGDFLPTRIQAQQDAVSLICHSKTRQNPENNVGLMTTASLEVLVTLTTDVGKLLTTLHKVQPQGDVNFLTAVKKAHLVLKHRQGKNHKMRIVVFVGSPIESDEKEIVKLAKKLKKEKVNVDVVNFGEEESNTEKLTAFINILNGKDGNLSHLVTVPPGPILSNALVSSAIVVGEDGAGAMDMGSGFEFGVDPNADPELALALRVSMEEQRQRQEEESRATGTPAEGGLTTPVQASDQEEAMLQQALAMSDSAQDIGRSVPPTPMVDFGSMSEEEQIAYAMQLSLQGAGESGMSGVEEDDDDPEGKESAME 327          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Medaka
Match: psmd4b (26S proteasome non-ATPase regulatory subunit 4 [Source:NCBI gene;Acc:101173089])

HSP 1 Score: 248.825 bits (634), Expect = 3.379e-79
Identity = 133/302 (44.04%), Postives = 195/302 (64.57%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSN-CQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKP---GIERSTADFGLDMD-DPDLAYALRVSLEDQRIRINQPTASEPILSTHQEINELDEHELTMSVIDATAAHMEKLS--NSDKTV----DIQGMTEEEQIQFAINVSL 971
            M  E+TM+ +DNS YM+NGDF+P R  AQ++A+  +C++  R NPEN  GLITL+N C+VL TLT DT ++ SK+  V P GN SFCT I +AHLAL++RQ +N K +I+ F+GSP+ED+++EL+++AK+LKKEKV+V I+ FGE   N  KL  FINT+NGK+ + S ++++PPG  + + L S+PI  G      G+  S  +FG+D + DP+LA ALRVS+E+QR R         + S         E  ++    D +   + K+S   +D T     D   MTE+EQI +A+ +S+
Sbjct:    1 MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANNCEVLTTLTPDTGRILSKLHAVQPRGNISFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDTDKELVKMAKRLKKEKVNVDIINFGEEEMNTEKLTGFINTLNGKEGTGSHLVTVPPGPSLADALLSSPILAGEGGAVLGLGASDFEFGIDPNADPELALALRVSMEEQRQRQEDEARRAAVASVA-------EANVSSPAADDSEDALLKMSVQQTDSTTPALPDFNRMTEDEQIAYALQMSM 295          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Medaka
Match: psmd4a (26S proteasome non-ATPase regulatory subunit 4 [Source:NCBI gene;Acc:101157953])

HSP 1 Score: 239.195 bits (609), Expect = 1.676e-75
Identity = 134/306 (43.79%), Postives = 195/306 (63.73%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSN-CQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKP---GIERSTADFGLDMD-DPDLAYALRVSLEDQRIRINQPTASEPILSTHQ------EINELDEHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSLAAQE 983
            M  E+TM+ +DNS YM+NGDF+P R  AQ++A+  +C++  R NPEN  GL+T++N C+VL TLT D+ ++ SK+  V P GN  FCT I +AHLAL++RQ +N K +I+ F+GSP+ED+E++L+++AK+LKKEKV+V I+ FGE   N  KL  FINT+NGK+ + S ++++PPG  + + L S+PI  G      G+  S  +FG+D   DP+LA ALRVS+E+QR R  +        S  +        +E ++  L MSV        +  S S    D   MTEEEQI +A+ +SLA  E
Sbjct:    1 MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLMTMANNCEVLTTLTPDSGRILSKLHAVQPKGNICFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFINTLNGKEGTGSHLVTVPPGPSLADALLSSPILAGEGGSMIGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGVPTPSADESEDALLKMSV-------SQPESGSAALPDFSSMTEEEQIAYAMQMSLAGGE 299          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Planmine SMEST
Match: SMESG000070294.1 (SMESG000070294.1)

HSP 1 Score: 681.019 bits (1756), Expect = 0.000e+0
Identity = 332/332 (100.00%), Postives = 332/332 (100.00%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSNCQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKPGIERSTADFGLDMDDPDLAYALRVSLEDQRIRINQPTASEPILSTHQEINELDEHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSLAAQEQNLLSKSDTKNEHSTNKRLSREDKDGSTSEKKLKKLN 1094
            MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSNCQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKPGIERSTADFGLDMDDPDLAYALRVSLEDQRIRINQPTASEPILSTHQEINELDEHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSLAAQEQNLLSKSDTKNEHSTNKRLSREDKDGSTSEKKLKKLN
Sbjct:    1 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSNCQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKPGIERSTADFGLDMDDPDLAYALRVSLEDQRIRINQPTASEPILSTHQEINELDEHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSLAAQEQNLLSKSDTKNEHSTNKRLSREDKDGSTSEKKLKKLN 332          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Planmine SMEST
Match: SMESG000070294.1 (SMESG000070294.1)

HSP 1 Score: 666.381 bits (1718), Expect = 0.000e+0
Identity = 327/332 (98.49%), Postives = 327/332 (98.49%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSNCQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKPGIERSTADFGLDMDDPDLAYALRVSLEDQRIRINQPTASEPILSTHQEINELDEHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSLAAQEQNLLSKSDTKNEHSTNKRLSREDKDGSTSEKKLKKLN 1094
            MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSNCQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKPGIERSTADFGLDMDDPDLAYALRVSLEDQRIRINQPTASEPILSTHQEINELDEHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSLAAQEQ     SDTKNEHSTNKRLSREDKDGSTSEKKLKKLN
Sbjct:    1 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSNCQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKPGIERSTADFGLDMDDPDLAYALRVSLEDQRIRINQPTASEPILSTHQEINELDEHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSLAAQEQ-----SDTKNEHSTNKRLSREDKDGSTSEKKLKKLN 327          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Planmine SMEST
Match: SMESG000004870.1 (SMESG000004870.1)

HSP 1 Score: 248.054 bits (632), Expect = 2.088e-79
Identity = 144/293 (49.15%), Postives = 203/293 (69.28%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSNCQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKPGIERSTADFGL-DMDDPDLAYALRVSLEDQRIRINQPTASEPILSTHQE-INELDEHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSL 971
            MSQEA MIA+DNS +M+NGD+ P+R  AQ +A  +  N  KR N ENTCGL+TL+N QV+CTLT D SK+ SKIT V   GN +FCT++ ++ LALR+RQ RNQKP+I++F+GSPI + E ELI++AKKLKKEKV++ +++FGE   N++KL  FI+TINGKDVS S +++IP G+ + E LR++PI +  + G       FG+ ++DDPDL YALRVS+EDQR++  +   S+  ++  Q  +    E ++   + +A AA +    N    VD   MTEEEQI +A  +SL
Sbjct:    1 MSQEAIMIAVDNSDFMRNGDYNPNRLQAQVDAFNYFTNAKKRMNVENTCGLVTLANYQVVCTLTTDMSKLHSKITLVDLSGNINFCTTVRVSLLALRHRQSRNQKPRIVVFVGSPIFEDEVELIKLAKKLKKEKVNIDVISFGESEENQHKLAAFIDTINGKDVSGSHLVTIPAGSSLQESLRTSPILMNEESG-NLGAVGFGMEEIDDPDLLYALRVSMEDQRMQQERAGVSDESVTVGQAGVGGTSEEDM---LREAMAASLSD--NISGEVDFASMTEEEQIAYATRMSL 287          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Planmine SMEST
Match: SMESG000004870.1 (SMESG000004870.1)

HSP 1 Score: 238.81 bits (608), Expect = 5.448e-76
Identity = 139/287 (48.43%), Postives = 198/287 (68.99%), Query Frame = 3
Query:  117 MIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSNCQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKPGIERSTADFGL-DMDDPDLAYALRVSLEDQRIRINQPTASEPILSTHQE-INELDEHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSL 971
            MIA+DNS +M+NGD+ P+R  AQ +A  +  N  KR N ENTCGL+TL+N QV+CTLT D SK+ SKIT V   GN +FCT++ ++ LALR+RQ RNQKP+I++F+GSPI + E ELI++AKKLKKEKV++ +++FGE   N++KL  FI+TINGKDVS S +++IP G+ + E LR++PI +  + G       FG+ ++DDPDL YALRVS+EDQR++  +   S+  ++  Q  +    E ++   + +A AA +    N    VD   MTEEEQI +A  +SL
Sbjct:    1 MIAVDNSDFMRNGDYNPNRLQAQVDAFNYFTNAKKRMNVENTCGLVTLANYQVVCTLTTDMSKLHSKITLVDLSGNINFCTTVRVSLLALRHRQSRNQKPRIVVFVGSPIFEDEVELIKLAKKLKKEKVNIDVISFGESEENQHKLAAFIDTINGKDVSGSHLVTIPAGSSLQESLRTSPILMNEESG-NLGAVGFGMEEIDDPDLLYALRVSMEDQRMQQERAGVSDESVTVGQAGVGGTSEEDM---LREAMAASLSD--NISGEVDFASMTEEEQIAYATRMSL 281          
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Planmine SMEST
Match: SMESG000004761.1 (SMESG000004761.1)

HSP 1 Score: 227.639 bits (579), Expect = 5.381e-72
Identity = 147/322 (45.65%), Postives = 206/322 (63.98%), Query Frame = 3
Query:   99 MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCGLITLSNCQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQFRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNENKLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKPGIERSTADFGLD-MDDPDLAYALRVSLEDQRIRINQPTASEPILSTHQEINELDEHELTMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSLAAQEQNLLSKSDTKNEHST-NKRLSREDKD 1058
            MSQEA MIA+DNS +M+NGD+ P RF AQ EA     N  KR N ENTCGL+TLS+ Q++ TLT D SK+ SKIT V   GN +F T++ ++ LALR+RQ RNQKP+I+IFLGSPI + E +L+++AKKLKKEKV+V +++FGE+ +N+ KL+ FI+TING+  S+  +++IP G+ I E LR +PI +  + G       FG+D +DDPDL YALR+S+E           S  +  T+  +  + E E+    I A+  +     N    V+ + MTEEEQI +A  +SL   E N+ +     NE ST N  L + D+D
Sbjct:    1 MSQEAIMIAVDNSDFMRNGDYSPSRFQAQVEAFNSFTNAKKRMNVENTCGLVTLSDHQIVSTLTTDMSKLHSKITSVNLSGNINFSTTVRVSLLALRHRQNRNQKPRIIIFLGSPIFEDESDLVKLAKKLKKEKVNVDVISFGEIEANQQKLSVFIDTINGQKDSSCHLVTIPAGSSIQESLRKSPILMNEEIG-NVGAVGFGMDEIDDPDLMYALRLSMEQ-----TASGVSNAVRETN--LGGISEEEMLREAIAASLNN-----NISGVVNFESMTEEEQIAYATRMSL---EDNVETDEMDTNEGSTSNVDLDKMDQD 306          
The following BLAST results are available for this feature:
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
PSMD42.878e-7442.86proteasome 26S subunit, non-ATPase 4 [Source:HGNC ... [more]
PSMD44.767e-7443.18proteasome 26S subunit, non-ATPase 4 [Source:HGNC ... [more]
PSMD41.030e-6348.28proteasome 26S subunit, non-ATPase 4 [Source:HGNC ... [more]
PSMD42.859e-662.50proteasome 26S subunit, non-ATPase 4 [Source:HGNC ... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpn-102.148e-4741.1026S proteasome non-ATPase regulatory subunit 4 [S... [more]
rpn-102.148e-4741.1026S proteasome non-ATPase regulatory subunit 4 [S... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Rpn104.085e-6439.24gene:FBgn0015283 transcript:FBtr0078368[more]
Rpn104.085e-6439.24gene:FBgn0015283 transcript:FBtr0333453[more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
psmd4a1.471e-7644.19proteasome 26S subunit, non-ATPase 4a [Source:ZFIN... [more]
psmd4b4.221e-7443.00proteasome 26S subunit, non-ATPase 4b [Source:ZFIN... [more]
psmd4a3.340e-6347.78proteasome 26S subunit, non-ATPase 4a [Source:ZFIN... [more]
PSMD42.357e-2852.13proteasome 26S subunit, non-ATPase 4 [Source:HGNC ... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Psmd48.348e-7443.00proteasome (prosome, macropain) 26S subunit, non-A... [more]
Psmd41.683e-7343.00proteasome (prosome, macropain) 26S subunit, non-A... [more]
Psmd41.896e-7342.81proteasome (prosome, macropain) 26S subunit, non-A... [more]
Psmd41.914e-662.50proteasome (prosome, macropain) 26S subunit, non-A... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O17453|PSMD4_SCHMA5.733e-8545.8526S proteasome non-ATPase regulatory subunit 4 OS=... [more]
sp|P55036|PSMD4_HUMAN1.382e-7342.8626S proteasome non-ATPase regulatory subunit 4 OS=... [more]
sp|Q58DA0|PSMD4_BOVIN5.197e-7343.5226S proteasome non-ATPase regulatory subunit 4 OS=... [more]
sp|O35226|PSMD4_MOUSE1.326e-7242.8126S proteasome non-ATPase regulatory subunit 4 OS=... [more]
sp|P55035|PSMD4_DROME4.095e-6339.2426S proteasome non-ATPase regulatory subunit 4 OS=... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W6USR56.549e-8948.8726S proteasome non-ATPase regulatory subunit 4 OS=... [more]
A0A0R3W8T96.838e-8945.88VWFA domain-containing protein OS=Taenia asiatica ... [more]
A0A0R3WJZ91.464e-8645.99VWFA domain-containing protein OS=Hydatigena taeni... [more]
A0A158QD797.761e-8644.62VWFA domain-containing protein OS=Hymenolepis dimi... [more]
A0A183SB986.199e-8545.98VWFA domain-containing protein OS=Schistocephalus ... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
psmd4a7.104e-7642.90proteasome 26S subunit, non-ATPase 4 [Source:NCBI ... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
psmd4a4.870e-6041.14proteasome 26S subunit, non-ATPase 4a [Source:ZFIN... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RPN101.139e-4137.29Non-ATPase base subunit of the 19S RP of the 26S p... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO310821.000e-6139.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
psmd4b3.379e-7944.0426S proteasome non-ATPase regulatory subunit 4 [So... [more]
psmd4a1.676e-7543.7926S proteasome non-ATPase regulatory subunit 4 [So... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070294.10.000e+0100.00SMESG000070294.1[more]
SMESG000070294.10.000e+098.49SMESG000070294.1[more]
SMESG000004870.12.088e-7949.15SMESG000004870.1[more]
SMESG000004870.15.448e-7648.43SMESG000004870.1[more]
SMESG000004761.15.381e-7245.65SMESG000004761.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020327 ID=SMED30020327|Name=26S proteasome non-ATPase regulatory subunit 4|organism=Schmidtea mediterranea sexual|type=transcript|length=1139bp
TTTTAGTTAGAAATATATTTTAGTAAAATAAATTCTATAAAAAATATGGA
TTATATATAATTAAAAATACAAAGTTTTCAATCGCTAATTCACCTAAAAT
GTCCCAAGAAGCCACAATGATTGCACTTGACAACAGCAGCTACATGAAGA
ACGGAGATTTCATTCCAGACAGATTTATTGCTCAAAGGGAAGCCATATAT
TTTATCTGTAACAATCTCAAGCGTCAAAACCCCGAAAATACTTGCGGTCT
TATTACCCTATCAAATTGTCAGGTTCTCTGTACACTCACAATGGACACGT
CAAAAGTTTTTAGTAAAATTACCAAAGTCTTACCAGATGGAAATACATCC
TTTTGCACTTCAATTGCGATTGCTCACTTAGCTCTTCGAAATAGACAGTT
TAGAAATCAAAAACCGAAGATTTTAATCTTTTTAGGAAGTCCTATTGAAG
ACTCAGAAGAGGAATTGATTCGGGTGGCAAAGAAATTAAAAAAGGAGAAG
GTTTCGGTAGTCATTGTAACCTTTGGAGAATTGACAAGCAATGAAAATAA
ATTAAATGACTTCATAAATACAATAAATGGAAAGGATGTCTCGACCTCAC
AGATAATTAGTATTCCACCAGGAAATGGAATTACTGAATACTTGAGATCA
AATCCAATTTTTGTCGGAAACAAACCCGGAATAGAAAGATCCACAGCTGA
TTTTGGACTTGATATGGATGATCCTGATCTAGCATACGCTTTGAGAGTTT
CTTTGGAGGATCAAAGAATAAGAATCAATCAGCCAACAGCTTCAGAACCA
ATATTGTCAACTCATCAAGAAATAAATGAGCTTGACGAGCATGAACTGAC
CATGTCGGTAATTGATGCTACCGCTGCTCACATGGAAAAGCTCTCCAATA
GTGACAAGACAGTCGACATTCAAGGAATGACAGAAGAAGAGCAAATACAA
TTCGCCATAAATGTTTCACTAGCTGCTCAAGAGCAAAATCTTTTATCCAA
GTCGGACACGAAGAATGAACACTCCACCAACAAAAGATTATCCAGAGAAG
ACAAAGATGGAAGCACATCTGAAAAGAAACTGAAAAAGTTAAATTAAAGG
CATTTCATTCAATACAATTTTTTTTCGACGAAAAAAAAA
back to top

protein sequence of SMED30020327-orf-1

>SMED30020327-orf-1 ID=SMED30020327-orf-1|Name=SMED30020327-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=333bp
MSQEATMIALDNSSYMKNGDFIPDRFIAQREAIYFICNNLKRQNPENTCG
LITLSNCQVLCTLTMDTSKVFSKITKVLPDGNTSFCTSIAIAHLALRNRQ
FRNQKPKILIFLGSPIEDSEEELIRVAKKLKKEKVSVVIVTFGELTSNEN
KLNDFINTINGKDVSTSQIISIPPGNGITEYLRSNPIFVGNKPGIERSTA
DFGLDMDDPDLAYALRVSLEDQRIRINQPTASEPILSTHQEINELDEHEL
TMSVIDATAAHMEKLSNSDKTVDIQGMTEEEQIQFAINVSLAAQEQNLLS
KSDTKNEHSTNKRLSREDKDGSTSEKKLKKLN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR036465vWFA_dom_sf
IPR003903UIM_dom
IPR002035VWF_A
Vocabulary: cellular component
TermDefinition
GO:0000502proteasome complex
GO:0008540proteasome regulatory particle, base subcomplex
Vocabulary: biological process
TermDefinition
GO:0006511ubiquitin-dependent protein catabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003903Ubiquitin interacting motifSMARTSM00726uimcoord: 278..297
e-value: 14.0
score: 14.6
coord: 206..225
e-value: 40.0
score: 12.2
IPR003903Ubiquitin interacting motifPFAMPF02809UIMcoord: 278..291
e-value: 0.46
score: 10.5
coord: 207..222
e-value: 0.037
score: 14.0
IPR002035von Willebrand factor, type APFAMPF13519VWA_2coord: 6..112
e-value: 2.3E-13
score: 50.7
IPR002035von Willebrand factor, type APROSITEPS50234VWFAcoord: 5..187
score: 10.182
IPR036465von Willebrand factor A-like domain superfamilyGENE3DG3DSA:3.40.50.410coord: 3..182
e-value: 9.1E-58
score: 196.7
IPR036465von Willebrand factor A-like domain superfamilySUPERFAMILYSSF53300vWA-likecoord: 4..171
NoneNo IPR availableGENE3DG3DSA:1.10.10.890coord: 246..292
e-value: 7.3E-6
score: 27.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 301..332
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 298..332
NoneNo IPR availablePANTHERPTHR1022326S PROTEASOME NON-ATPASE REGULATORY SUBUNIT 4coord: 6..297
NoneNo IPR availablePANTHERPTHR10223:SF726S PROTEASOME NON-ATPASE REGULATORY SUBUNIT 4coord: 6..297