Protein lin-54 homolog

Overview
NameProtein lin-54 homolog
Smed IDSMED30020325
Length (bp)1478
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein lin-54 homolog (SMED30020325) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein lin-54 homolog (SMED30020325) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein lin-54 homolog (SMED30020325) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein lin-54 homolog (SMED30020325) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020325

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30020325SMESG000004147.1 SmedASXL_011456SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30020325SMESG000004147.1 SmedASXL_011456SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30020325SMESG000004147.1 dd_Smed_v4_4263_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020325SMESG000004147.1 dd_Smed_v4_4263_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30020325SMESG000004147.1 dd_Smed_v4_4263_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020325SMESG000004147.1 dd_Smed_v4_4263_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020325SMESG000004147.1 dd_Smed_v4_4263_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein lin-54 homolog vs. Ensembl Human
Match: LIN54 (lin-54 DREAM MuvB core complex component [Source:HGNC Symbol;Acc:HGNC:25397])

HSP 1 Score: 192.971 bits (489), Expect = 1.127e-54
Identity = 110/219 (50.23%), Postives = 146/219 (66.67%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGE--RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNA--------ITKNLIKPPHE------RLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTA 1015
            RKPCNCTKS CLKLYC+CFANG+ C+ CNCTNC NNL  E+ER +AIK  LDRNP AF PKIG+G EGE  R+H+KGCNCKRSGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L  L   + ++  Q  A        I+  L +P         +LP +F+T EV EA   C+L++AE+ ++   +    E  +++ +G CL  ++ ++  A
Sbjct:  301 RKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRPTPALNSGGGKLPFTFVTKEVAEATCNCLLAQAEQADKKGKSKAAAERMILEEFGRCLMSVINSAGKA 519          
BLAST of Protein lin-54 homolog vs. Ensembl Human
Match: LIN54 (lin-54 DREAM MuvB core complex component [Source:HGNC Symbol;Acc:HGNC:25397])

HSP 1 Score: 192.971 bits (489), Expect = 1.127e-54
Identity = 110/219 (50.23%), Postives = 146/219 (66.67%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGE--RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNA--------ITKNLIKPPHE------RLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTA 1015
            RKPCNCTKS CLKLYC+CFANG+ C+ CNCTNC NNL  E+ER +AIK  LDRNP AF PKIG+G EGE  R+H+KGCNCKRSGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L  L   + ++  Q  A        I+  L +P         +LP +F+T EV EA   C+L++AE+ ++   +    E  +++ +G CL  ++ ++  A
Sbjct:  301 RKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRPTPALNSGGGKLPFTFVTKEVAEATCNCLLAQAEQADKKGKSKAAAERMILEEFGRCLMSVINSAGKA 519          
BLAST of Protein lin-54 homolog vs. Ensembl Human
Match: LIN54 (lin-54 DREAM MuvB core complex component [Source:HGNC Symbol;Acc:HGNC:25397])

HSP 1 Score: 192.971 bits (489), Expect = 1.127e-54
Identity = 110/219 (50.23%), Postives = 146/219 (66.67%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGE--RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNA--------ITKNLIKPPHE------RLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTA 1015
            RKPCNCTKS CLKLYC+CFANG+ C+ CNCTNC NNL  E+ER +AIK  LDRNP AF PKIG+G EGE  R+H+KGCNCKRSGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L  L   + ++  Q  A        I+  L +P         +LP +F+T EV EA   C+L++AE+ ++   +    E  +++ +G CL  ++ ++  A
Sbjct:  301 RKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRPTPALNSGGGKLPFTFVTKEVAEATCNCLLAQAEQADKKGKSKAAAERMILEEFGRCLMSVINSAGKA 519          
BLAST of Protein lin-54 homolog vs. Ensembl Human
Match: LIN54 (lin-54 DREAM MuvB core complex component [Source:HGNC Symbol;Acc:HGNC:25397])

HSP 1 Score: 194.126 bits (492), Expect = 4.476e-54
Identity = 110/219 (50.23%), Postives = 146/219 (66.67%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGE--RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNA--------ITKNLIKPPHE------RLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTA 1015
            RKPCNCTKS CLKLYC+CFANG+ C+ CNCTNC NNL  E+ER +AIK  LDRNP AF PKIG+G EGE  R+H+KGCNCKRSGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L  L   + ++  Q  A        I+  L +P         +LP +F+T EV EA   C+L++AE+ ++   +    E  +++ +G CL  ++ ++  A
Sbjct:  433 RKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRPTPALNSGGGKLPFTFVTKEVAEATCNCLLAQAEQADKKGKSKAAAERMILEEFGRCLMSVINSAGKA 651          
BLAST of Protein lin-54 homolog vs. Ensembl Human
Match: LIN54 (lin-54 DREAM MuvB core complex component [Source:HGNC Symbol;Acc:HGNC:25397])

HSP 1 Score: 194.512 bits (493), Expect = 7.867e-54
Identity = 110/219 (50.23%), Postives = 146/219 (66.67%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGE--RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNA--------ITKNLIKPPHE------RLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTA 1015
            RKPCNCTKS CLKLYC+CFANG+ C+ CNCTNC NNL  E+ER +AIK  LDRNP AF PKIG+G EGE  R+H+KGCNCKRSGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L  L   + ++  Q  A        I+  L +P         +LP +F+T EV EA   C+L++AE+ ++   +    E  +++ +G CL  ++ ++  A
Sbjct:  522 RKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRPTPALNSGGGKLPFTFVTKEVAEATCNCLLAQAEQADKKGKSKAAAERMILEEFGRCLMSVINSAGKA 740          
BLAST of Protein lin-54 homolog vs. Ensembl Celegans
Match: lin-54 (pep chromosome:WBcel235:IV:13241062:13243369:1 gene:WBGene00003037.1 transcript:JC8.6b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-54)

HSP 1 Score: 164.081 bits (414), Expect = 2.827e-45
Identity = 99/237 (41.77%), Postives = 143/237 (60.34%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRGEG-----ERKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERR---------SLKRLIAMSSLKSNQ-PNAITKNLIKPPH-------------------ERLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDI-------YGTCLNKIV 997
            RKPCNCTKS CLKLYC+CFANG+ C  CNC +C NN+ ++ +R++AI+ +L+RNP AF PKIG   G     ER H KGC+CK+SGCLKNYCECYEAK+ CTD C+C+GC+NTE     R         +   L+++++  S   P++   +++   H                    R P  ++T EV+EA T CM+++AEE    E  V+ ++ KLI++       +G CL +++
Sbjct:  168 RKPCNCTKSQCLKLYCDCFANGEFCRDCNCKDCHNNIEYDSQRSKAIRQSLERNPNAFKPKIGIARGGITDIERLHQKGCHCKKSGCLKNYCECYEAKVPCTDRCKCKGCQNTETYRMTRYKNSGGAVSNTNALMSLTNASSTATPDSGPGSVVTDEHGDDYEDMLLSHKPKVEMDPRRFPWYYMTDEVVEAATMCMVAQAEEALNYE-KVQTEDEKLINMEKLVLREFGRCLEQMI 403          
BLAST of Protein lin-54 homolog vs. Ensembl Celegans
Match: lin-54 (pep chromosome:WBcel235:IV:13241051:13243401:1 gene:WBGene00003037.1 transcript:JC8.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-54)

HSP 1 Score: 164.081 bits (414), Expect = 3.354e-45
Identity = 99/237 (41.77%), Postives = 143/237 (60.34%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRGEG-----ERKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERR---------SLKRLIAMSSLKSNQ-PNAITKNLIKPPH-------------------ERLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDI-------YGTCLNKIV 997
            RKPCNCTKS CLKLYC+CFANG+ C  CNC +C NN+ ++ +R++AI+ +L+RNP AF PKIG   G     ER H KGC+CK+SGCLKNYCECYEAK+ CTD C+C+GC+NTE     R         +   L+++++  S   P++   +++   H                    R P  ++T EV+EA T CM+++AEE    E  V+ ++ KLI++       +G CL +++
Sbjct:  174 RKPCNCTKSQCLKLYCDCFANGEFCRDCNCKDCHNNIEYDSQRSKAIRQSLERNPNAFKPKIGIARGGITDIERLHQKGCHCKKSGCLKNYCECYEAKVPCTDRCKCKGCQNTETYRMTRYKNSGGAVSNTNALMSLTNASSTATPDSGPGSVVTDEHGDDYEDMLLSHKPKVEMDPRRFPWYYMTDEVVEAATMCMVAQAEEALNYE-KVQTEDEKLINMEKLVLREFGRCLEQMI 409          
BLAST of Protein lin-54 homolog vs. Ensembl Fly
Match: mip120 (gene:FBgn0033846 transcript:FBtr0301388)

HSP 1 Score: 162.54 bits (410), Expect = 1.742e-42
Identity = 97/204 (47.55%), Postives = 131/204 (64.22%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKI-GRGEGE-RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTED--SIERRSLKRLIAMSSLKSNQPNAITKNLIKPPHERLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSR 1009
            RK CNC+KS CLKLYC+CFANG+ C  C C +C NNL++E ER RAI+  LDRNP+AF PKI     G+ R H KGCNCKRSGCLKNYCECYEAKI C+  C+C GC+N ED   ++  SL  L+ +   K ++  A  K L    +E   + + T +VIEA   CM+S+    E+  + VE  E ++++  G  L +I+  ++
Sbjct:  740 RKHCNCSKSQCLKLYCDCFANGEFCQDCTCKDCFNNLDYEVERERAIRSCLDRNPSAFKPKITAPNSGDMRLHNKGCNCKRSGCLKNYCECYEAKIPCSSICKCVGCRNMEDRPDVDMDSLDGLMGVEGQKKDK--AKNKQL----NENRANIYFTDDVIEATIMCMISRIVMHEKQNVAVEDMEREVMEEMGESLTQIIAFAK 937          
BLAST of Protein lin-54 homolog vs. Ensembl Fly
Match: mip120 (gene:FBgn0033846 transcript:FBtr0087669)

HSP 1 Score: 162.155 bits (409), Expect = 1.891e-42
Identity = 97/204 (47.55%), Postives = 131/204 (64.22%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKI-GRGEGE-RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTED--SIERRSLKRLIAMSSLKSNQPNAITKNLIKPPHERLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSR 1009
            RK CNC+KS CLKLYC+CFANG+ C  C C +C NNL++E ER RAI+  LDRNP+AF PKI     G+ R H KGCNCKRSGCLKNYCECYEAKI C+  C+C GC+N ED   ++  SL  L+ +   K ++  A  K L    +E   + + T +VIEA   CM+S+    E+  + VE  E ++++  G  L +I+  ++
Sbjct:  738 RKHCNCSKSQCLKLYCDCFANGEFCQDCTCKDCFNNLDYEVERERAIRSCLDRNPSAFKPKITAPNSGDMRLHNKGCNCKRSGCLKNYCECYEAKIPCSSICKCVGCRNMEDRPDVDMDSLDGLMGVEGQKKDK--AKNKQL----NENRANIYFTDDVIEATIMCMISRIVMHEKQNVAVEDMEREVMEEMGESLTQIIAFAK 935          
BLAST of Protein lin-54 homolog vs. Ensembl Fly
Match: tomb (gene:FBgn0031715 transcript:FBtr0079127)

HSP 1 Score: 56.225 bits (134), Expect = 1.198e-8
Identity = 22/35 (62.86%), Postives = 27/35 (77.14%), Query Frame = 2
Query:  632 CNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTE 736
            C CKRS C+KNYC+CY++   CT  CRC GC+NTE
Sbjct:   28 CCCKRSQCIKNYCDCYQSMAICTKFCRCVGCRNTE 62          
BLAST of Protein lin-54 homolog vs. Ensembl Zebrafish
Match: lin54 (lin-54 DREAM MuvB core complex component [Source:NCBI gene;Acc:560688])

HSP 1 Score: 194.897 bits (494), Expect = 4.330e-54
Identity = 107/213 (50.23%), Postives = 140/213 (65.73%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGE--RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNAITKNL--------------IKPPHERLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIV 997
            RKPCNCT+S CLKLYC+CFANG+ C+ CNC NC NNL+ E ER +AIK  LDRNP AF PKIG+G EGE  R+H+KGCNCK+SGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L  L   + ++  Q  A    L              I     +LP++F+T EV EA   C+L +AE+ E +       E  +++ +G CL++I+
Sbjct:  545 RKPCNCTRSQCLKLYCDCFANGEFCNNCNCVNCFNNLDHESERLKAIKACLDRNPVAFKPKIGKGKEGESDRRHSKGCNCKKSGCLKNYCECYEAKIMCSSICKCMGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRTTPAITSGGGKLPYTFVTKEVAEATCDCLLEQAEQAELTNQPQAMAERLILEEFGRCLHRII 757          
BLAST of Protein lin-54 homolog vs. Ensembl Zebrafish
Match: tesmin (testis expressed metallothionein like protein [Source:ZFIN;Acc:ZDB-GENE-131121-605])

HSP 1 Score: 166.007 bits (419), Expect = 4.115e-45
Identity = 101/214 (47.20%), Postives = 137/214 (64.02%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIG-RGEGERK--HTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNAITKNLIKPPHERLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTALFNNNMNQF 1042
            ++PCNCTKS CLKLYCECFANG+ C  C CTNC NN     ER++A+K  LDRNP AF PKIG R +G  K  HTKGCNCKRSGCLKNYCECYEAKI CT +C+C GC+N ++  + +           KS++ +   ++ I  P  R P S +T +V+EA   C+L++AEE ++        E  +++ +G CL +IV +    +F ++  QF
Sbjct:  303 KRPCNCTKSQCLKLYCECFANGEFCSSCKCTNCFNNTEHVFERSQAVKACLDRNPGAFRPKIGSRKQGNVKGCHTKGCNCKRSGCLKNYCECYEAKIMCTSTCKCVGCRNYDEGCDMK-----------KSSEQD---RHDIYFP-TRCPVSVITRDVVEATCGCLLAQAEEAQKDGHIAAHAERMILEEFGQCLTQIVRS----IFKSSRVQF 497          
BLAST of Protein lin-54 homolog vs. Ensembl Zebrafish
Match: lin54 (lin-54 DREAM MuvB core complex component [Source:NCBI gene;Acc:560688])

HSP 1 Score: 167.162 bits (422), Expect = 2.931e-44
Identity = 95/199 (47.74%), Postives = 127/199 (63.82%), Query Frame = 2
Query:  452 YCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGE--RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNAITKNL--------------IKPPHERLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIV 997
            YC+CFANG+ C+ CNC NC NNL+ E ER +AIK  LDRNP AF PKIG+G EGE  R+H+KGCNCK+SGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L  L   + ++  Q  A    L              I     +LP++F+T EV EA   C+L +AE+ E +       E  +++ +G CL++I+
Sbjct:  535 YCDCFANGEFCNNCNCVNCFNNLDHESERLKAIKACLDRNPVAFKPKIGKGKEGESDRRHSKGCNCKKSGCLKNYCECYEAKIMCSSICKCMGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRTTPAITSGGGKLPYTFVTKEVAEATCDCLLEQAEQAELTNQPQAMAERLILEEFGRCLHRII 733          
BLAST of Protein lin-54 homolog vs. Ensembl Xenopus
Match: lin54 (lin-54 DREAM MuvB core complex component [Source:NCBI gene;Acc:780045])

HSP 1 Score: 194.897 bits (494), Expect = 1.915e-55
Identity = 111/219 (50.68%), Postives = 145/219 (66.21%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGE--RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNAITKNL----------IKPPHE----RLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTA 1015
            RKPCNCTKS CLKLYC+CFANG+ C+ CNCTNC NNL  E+ER +AIK  LDRNP AF PKIG+G EGE  R+H+KGCNCKRSGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L  L   + ++  Q  A    L            PP      +LP +F+T EV EA   C+L++AE+ E+   +    E  +++ +G CL +++ ++  A
Sbjct:  294 RKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRPAPPMNSGGGKLPFTFVTKEVAEATCECLLAQAEQAEKQLKSKAATERMILEEFGRCLMRVINSAGKA 512          
BLAST of Protein lin-54 homolog vs. Ensembl Xenopus
Match: lin54 (lin-54 DREAM MuvB core complex component [Source:NCBI gene;Acc:780045])

HSP 1 Score: 196.438 bits (498), Expect = 4.572e-55
Identity = 111/219 (50.68%), Postives = 147/219 (67.12%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGE--RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNA--------ITKNLIKPPHE------RLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTA 1015
            RKPCNCTKS CLKLYC+CFANG+ C+ CNCTNC NNL  E+ER +AIK  LDRNP AF PKIG+G EGE  R+H+KGCNCKRSGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L  L   + ++  Q  A        I+  L +P         +LP +F+T EV EA   C+L++AE+ E+   +    E  +++ +G CL +++ ++  A
Sbjct:  429 RKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRPAPPMNSGGGKLPFTFVTKEVAEATCECLLAQAEQAEKQLKSKAATERMILEEFGRCLMRVINSAGKA 647          
BLAST of Protein lin-54 homolog vs. Ensembl Xenopus
Match: lin54 (lin-54 DREAM MuvB core complex component [Source:NCBI gene;Acc:780045])

HSP 1 Score: 196.823 bits (499), Expect = 1.095e-54
Identity = 111/219 (50.68%), Postives = 147/219 (67.12%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGE--RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNA--------ITKNLIKPPHE------RLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTA 1015
            RKPCNCTKS CLKLYC+CFANG+ C+ CNCTNC NNL  E+ER +AIK  LDRNP AF PKIG+G EGE  R+H+KGCNCKRSGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L  L   + ++  Q  A        I+  L +P         +LP +F+T EV EA   C+L++AE+ E+   +    E  +++ +G CL +++ ++  A
Sbjct:  514 RKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRPAPPMNSGGGKLPFTFVTKEVAEATCECLLAQAEQAEKQLKSKAATERMILEEFGRCLMRVINSAGKA 732          
BLAST of Protein lin-54 homolog vs. Ensembl Xenopus
Match: lin54 (lin-54 DREAM MuvB core complex component [Source:NCBI gene;Acc:780045])

HSP 1 Score: 196.823 bits (499), Expect = 1.108e-54
Identity = 111/219 (50.68%), Postives = 145/219 (66.21%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGE--RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNAITKNL----------IKPPHE----RLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTA 1015
            RKPCNCTKS CLKLYC+CFANG+ C+ CNCTNC NNL  E+ER +AIK  LDRNP AF PKIG+G EGE  R+H+KGCNCKRSGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L  L   + ++  Q  A    L            PP      +LP +F+T EV EA   C+L++AE+ E+   +    E  +++ +G CL +++ ++  A
Sbjct:  516 RKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRPAPPMNSGGGKLPFTFVTKEVAEATCECLLAQAEQAEKQLKSKAATERMILEEFGRCLMRVINSAGKA 734          
BLAST of Protein lin-54 homolog vs. Ensembl Xenopus
Match: lin54 (lin-54 DREAM MuvB core complex component [Source:NCBI gene;Acc:780045])

HSP 1 Score: 196.823 bits (499), Expect = 1.612e-54
Identity = 111/219 (50.68%), Postives = 147/219 (67.12%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGE--RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNA--------ITKNLIKPPHE------RLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTA 1015
            RKPCNCTKS CLKLYC+CFANG+ C+ CNCTNC NNL  E+ER +AIK  LDRNP AF PKIG+G EGE  R+H+KGCNCKRSGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L  L   + ++  Q  A        I+  L +P         +LP +F+T EV EA   C+L++AE+ E+   +    E  +++ +G CL +++ ++  A
Sbjct:  546 RKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRPAPPMNSGGGKLPFTFVTKEVAEATCECLLAQAEQAEKQLKSKAATERMILEEFGRCLMRVINSAGKA 764          
BLAST of Protein lin-54 homolog vs. Ensembl Mouse
Match: Lin54 (lin-54 homolog (C. elegans) [Source:MGI Symbol;Acc:MGI:2140902])

HSP 1 Score: 192.971 bits (489), Expect = 8.845e-55
Identity = 110/219 (50.23%), Postives = 146/219 (66.67%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGE--RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNA--------ITKNLIKPPHE------RLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTA 1015
            RKPCNCTKS CLKLYC+CFANG+ C+ CNCTNC NNL  E+ER +AIK  LDRNP AF PKIG+G EGE  R+H+KGCNCKRSGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L  L   + ++  Q  A        I+  L +P         +LP +F+T EV EA   C+L++AE+ ++   +    E  +++ +G CL  ++ ++  A
Sbjct:  301 RKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRPTPALNSAGGKLPFTFVTKEVAEATCNCLLAQAEQADKKGKSKAAAERMILEEFGRCLMSVINSAGKA 519          
BLAST of Protein lin-54 homolog vs. Ensembl Mouse
Match: Lin54 (lin-54 homolog (C. elegans) [Source:MGI Symbol;Acc:MGI:2140902])

HSP 1 Score: 192.971 bits (489), Expect = 8.845e-55
Identity = 110/219 (50.23%), Postives = 146/219 (66.67%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGE--RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNA--------ITKNLIKPPHE------RLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTA 1015
            RKPCNCTKS CLKLYC+CFANG+ C+ CNCTNC NNL  E+ER +AIK  LDRNP AF PKIG+G EGE  R+H+KGCNCKRSGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L  L   + ++  Q  A        I+  L +P         +LP +F+T EV EA   C+L++AE+ ++   +    E  +++ +G CL  ++ ++  A
Sbjct:  301 RKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRPTPALNSAGGKLPFTFVTKEVAEATCNCLLAQAEQADKKGKSKAAAERMILEEFGRCLMSVINSAGKA 519          
BLAST of Protein lin-54 homolog vs. Ensembl Mouse
Match: Lin54 (lin-54 homolog (C. elegans) [Source:MGI Symbol;Acc:MGI:2140902])

HSP 1 Score: 192.971 bits (489), Expect = 8.845e-55
Identity = 110/219 (50.23%), Postives = 146/219 (66.67%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGE--RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNA--------ITKNLIKPPHE------RLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTA 1015
            RKPCNCTKS CLKLYC+CFANG+ C+ CNCTNC NNL  E+ER +AIK  LDRNP AF PKIG+G EGE  R+H+KGCNCKRSGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L  L   + ++  Q  A        I+  L +P         +LP +F+T EV EA   C+L++AE+ ++   +    E  +++ +G CL  ++ ++  A
Sbjct:  301 RKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRPTPALNSAGGKLPFTFVTKEVAEATCNCLLAQAEQADKKGKSKAAAERMILEEFGRCLMSVINSAGKA 519          
BLAST of Protein lin-54 homolog vs. Ensembl Mouse
Match: Lin54 (lin-54 homolog (C. elegans) [Source:MGI Symbol;Acc:MGI:2140902])

HSP 1 Score: 194.512 bits (493), Expect = 2.246e-54
Identity = 110/219 (50.23%), Postives = 146/219 (66.67%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGE--RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNA--------ITKNLIKPPHE------RLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTA 1015
            RKPCNCTKS CLKLYC+CFANG+ C+ CNCTNC NNL  E+ER +AIK  LDRNP AF PKIG+G EGE  R+H+KGCNCKRSGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L  L   + ++  Q  A        I+  L +P         +LP +F+T EV EA   C+L++AE+ ++   +    E  +++ +G CL  ++ ++  A
Sbjct:  433 RKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRPTPALNSAGGKLPFTFVTKEVAEATCNCLLAQAEQADKKGKSKAAAERMILEEFGRCLMSVINSAGKA 651          
BLAST of Protein lin-54 homolog vs. Ensembl Mouse
Match: Lin54 (lin-54 homolog (C. elegans) [Source:MGI Symbol;Acc:MGI:2140902])

HSP 1 Score: 194.512 bits (493), Expect = 5.967e-54
Identity = 110/219 (50.23%), Postives = 146/219 (66.67%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGE--RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNA--------ITKNLIKPPHE------RLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTA 1015
            RKPCNCTKS CLKLYC+CFANG+ C+ CNCTNC NNL  E+ER +AIK  LDRNP AF PKIG+G EGE  R+H+KGCNCKRSGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L  L   + ++  Q  A        I+  L +P         +LP +F+T EV EA   C+L++AE+ ++   +    E  +++ +G CL  ++ ++  A
Sbjct:  522 RKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRPTPALNSAGGKLPFTFVTKEVAEATCNCLLAQAEQADKKGKSKAAAERMILEEFGRCLMSVINSAGKA 740          
BLAST of Protein lin-54 homolog vs. UniProt/SwissProt
Match: sp|Q5RBN8|LIN54_PONAB (Protein lin-54 homolog OS=Pongo abelii OX=9601 GN=LIN54 PE=2 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 5.411e-54
Identity = 110/219 (50.23%), Postives = 146/219 (66.67%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGE--RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNA--------ITKNLIKPPHE------RLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTA 1015
            RKPCNCTKS CLKLYC+CFANG+ C+ CNCTNC NNL  E+ER +AIK  LDRNP AF PKIG+G EGE  R+H+KGCNCKRSGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L  L   + ++  Q  A        I+  L +P         +LP +F+T EV EA   C+L++AE+ ++   +    E  +++ +G CL  ++ ++  A
Sbjct:  301 RKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRPTPALNSGGGKLPFTFVTKEVAEATCNCLLAQAEQADKKGKSKAAAERMILEEFGRCLMSVINSAGKA 519          
BLAST of Protein lin-54 homolog vs. UniProt/SwissProt
Match: sp|Q0IHV2|LIN54_XENTR (Protein lin-54 homolog OS=Xenopus tropicalis OX=8364 GN=lin54 PE=2 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 5.800e-54
Identity = 111/219 (50.68%), Postives = 147/219 (67.12%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGE--RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNA--------ITKNLIKPPHE------RLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTA 1015
            RKPCNCTKS CLKLYC+CFANG+ C+ CNCTNC NNL  E+ER +AIK  LDRNP AF PKIG+G EGE  R+H+KGCNCKRSGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L  L   + ++  Q  A        I+  L +P         +LP +F+T EV EA   C+L++AE+ E+   +    E  +++ +G CL +++ ++  A
Sbjct:  514 RKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRPAPPMNSGGGKLPFTFVTKEVAEATCECLLAQAEQAEKQLKSKAATERMILEEFGRCLMRVINSAGKA 732          
BLAST of Protein lin-54 homolog vs. UniProt/SwissProt
Match: sp|Q08CM4|LIN54_DANRE (Protein lin-54 homolog OS=Danio rerio OX=7955 GN=lin54 PE=1 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 3.504e-53
Identity = 107/213 (50.23%), Postives = 140/213 (65.73%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGE--RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNAITKNL--------------IKPPHERLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIV 997
            RKPCNCT+S CLKLYC+CFANG+ C+ CNC NC NNL+ E ER +AIK  LDRNP AF PKIG+G EGE  R+H+KGCNCK+SGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L  L   + ++  Q  A    L              I     +LP++F+T EV EA   C+L +AE+ E +       E  +++ +G CL++I+
Sbjct:  545 RKPCNCTRSQCLKLYCDCFANGEFCNNCNCVNCFNNLDHESERLKAIKACLDRNPVAFKPKIGKGKEGESDRRHSKGCNCKKSGCLKNYCECYEAKIMCSSICKCMGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRTTPAITSGGGKLPYTFVTKEVAEATCDCLLEQAEQAELTNQPQAMAERLILEEFGRCLHRII 757          
BLAST of Protein lin-54 homolog vs. UniProt/SwissProt
Match: sp|Q6MZP7|LIN54_HUMAN (Protein lin-54 homolog OS=Homo sapiens OX=9606 GN=LIN54 PE=1 SV=3)

HSP 1 Score: 194.512 bits (493), Expect = 3.778e-53
Identity = 110/219 (50.23%), Postives = 146/219 (66.67%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGE--RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNA--------ITKNLIKPPHE------RLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTA 1015
            RKPCNCTKS CLKLYC+CFANG+ C+ CNCTNC NNL  E+ER +AIK  LDRNP AF PKIG+G EGE  R+H+KGCNCKRSGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L  L   + ++  Q  A        I+  L +P         +LP +F+T EV EA   C+L++AE+ ++   +    E  +++ +G CL  ++ ++  A
Sbjct:  522 RKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRPTPALNSGGGKLPFTFVTKEVAEATCNCLLAQAEQADKKGKSKAAAERMILEEFGRCLMSVINSAGKA 740          
BLAST of Protein lin-54 homolog vs. UniProt/SwissProt
Match: sp|Q641Z1|LIN54_RAT (Protein lin-54 homolog OS=Rattus norvegicus OX=10116 GN=Lin54 PE=1 SV=2)

HSP 1 Score: 194.512 bits (493), Expect = 4.133e-53
Identity = 110/219 (50.23%), Postives = 146/219 (66.67%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGE--RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNA--------ITKNLIKPPHE------RLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTA 1015
            RKPCNCTKS CLKLYC+CFANG+ C+ CNCTNC NNL  E+ER +AIK  LDRNP AF PKIG+G EGE  R+H+KGCNCKRSGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L  L   + ++  Q  A        I+  L +P         +LP +F+T EV EA   C+L++AE+ ++   +    E  +++ +G CL  ++ ++  A
Sbjct:  522 RKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRPTPALNSGGGKLPFTFVTKEVAEATCNCLLAQAEQADKKGKSKAAAERMILEEFGRCLMSVINSAGKA 740          
BLAST of Protein lin-54 homolog vs. TrEMBL
Match: A0A0R3UJA7 (CRC domain-containing protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS7580 PE=4 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 9.720e-93
Identity = 146/202 (72.28%), Postives = 168/202 (83.17%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRGEGERKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNAITKNLIKPPHERLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTA 1015
            RKPCNCTKSHCLKLYCECFA GQLC  CNC NCMNNL +E+ER RAIKMTL+RNPTAFHPKIGRGEGERKHTKGCNCKRSGCLKNYCECYEAKISC+D CRC GC+NTEDSIERRSL RL AM SL+S QPNA  K+LIKPP E+LPH F TWE IEA  +C+L++AE+ ER +L    QE  +++ +G  L+++VE +  A
Sbjct:  143 RKPCNCTKSHCLKLYCECFAQGQLCQNCNCNNCMNNLAYEEERGRAIKMTLERNPTAFHPKIGRGEGERKHTKGCNCKRSGCLKNYCECYEAKISCSDLCRCLGCRNTEDSIERRSLMRLAAMGSLRSRQPNAFKKHLIKPPAEKLPHVFFTWETIEAAASCLLAQAEDAERRDLPPASQERIILEEFGRTLDRVVEATSKA 344          
BLAST of Protein lin-54 homolog vs. TrEMBL
Match: A0A3Q0KTL3 (Tesmin-related OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 3.342e-92
Identity = 144/218 (66.06%), Postives = 175/218 (80.28%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRGEGERKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNAITKNLIKPPHERLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTALFNNNMNQFSNIMVDN 1063
            RKPCNCTKSHCLKLYCECFA GQLC  CNC NCMNNL +E+ER RAIKMTL+RNPTAFHPKIGRGEGERKHTKGCNCKRSGCLKNYCECYEAKISC+D CRCQGC+NTEDS+ERRSL RL AM +L+S QP++  K+L+KPP E LPH F TWEVIEA  +C+L++A+E ER +L    QE  L++ +G  L +++E +  A   ++    ++  +D+
Sbjct:   82 RKPCNCTKSHCLKLYCECFAQGQLCQNCNCNNCMNNLAYEEERGRAIKMTLERNPTAFHPKIGRGEGERKHTKGCNCKRSGCLKNYCECYEAKISCSDLCRCQGCRNTEDSVERRSLMRLAAMGALRSRQPSSFKKHLVKPPSETLPHVFFTWEVIEATASCLLAQADEAERRDLPPAAQERILLEEFGRTLERVIEAASKAQIRSSSGIHTSASIDD 299          
BLAST of Protein lin-54 homolog vs. TrEMBL
Match: A0A0R3VUT6 (CRC domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS1111 PE=4 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 5.451e-92
Identity = 144/202 (71.29%), Postives = 167/202 (82.67%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRGEGERKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNAITKNLIKPPHERLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTA 1015
            RKPCNCTKSHCLKLYCECFA GQLC  CNC +CMNNL +E+ER RAIKMTL+RNPTAFHPKIGRGEGERKHTKGCNCKRSGCLKNYCECYEAKISC+D CRC GC+NTEDSIERRSL RL AM SL+S QPNA  K+LIKPP E +PH F TWE IEA  +C+L++AE+ ER +L    QE  +++ +G  L+++VE +  A
Sbjct:  143 RKPCNCTKSHCLKLYCECFAQGQLCQNCNCNHCMNNLAYEEERGRAIKMTLERNPTAFHPKIGRGEGERKHTKGCNCKRSGCLKNYCECYEAKISCSDLCRCLGCRNTEDSIERRSLMRLAAMGSLRSRQPNAFRKHLIKPPAETMPHVFFTWETIEAAASCLLAQAEDAERRDLPPASQERIILEEFGRTLDRVVEATSKA 344          
BLAST of Protein lin-54 homolog vs. TrEMBL
Match: A0A095A3T5 (Protein lin-54-like protein OS=Schistosoma haematobium OX=6185 GN=MS3_10546 PE=4 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 5.614e-92
Identity = 144/218 (66.06%), Postives = 175/218 (80.28%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRGEGERKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNAITKNLIKPPHERLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTALFNNNMNQFSNIMVDN 1063
            RKPCNCTKSHCLKLYCECFA GQLC  CNC NCMNNL +E+ER RAIKMTL+RNPTAFHPKIGRGEGERKHTKGCNCKRSGCLKNYCECYEAKISC+D CRCQGC+NTEDS+ERRSL RL AM +L+S QP++  K+L+KPP E LPH F TWEVIEA  +C+L++A+E ER +L    QE  L++ +G  L +++E +  A   ++    ++  +D+
Sbjct:   82 RKPCNCTKSHCLKLYCECFAQGQLCQNCNCNNCMNNLAYEEERGRAIKMTLERNPTAFHPKIGRGEGERKHTKGCNCKRSGCLKNYCECYEAKISCSDLCRCQGCRNTEDSVERRSLMRLAAMGALRSRQPSSFKKHLVKPPSETLPHVFFTWEVIEATASCLLAQADEAERRDLPPAAQERILLEEFGRTLERVIEAASKAQIRSSSAIHTSASIDD 299          
BLAST of Protein lin-54 homolog vs. TrEMBL
Match: G4VTN6 (Tesmin-related OS=Schistosoma mansoni OX=6183 GN=Smp_178740 PE=4 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 6.109e-92
Identity = 142/199 (71.36%), Postives = 167/199 (83.92%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRGEGERKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNAITKNLIKPPHERLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETS 1006
            RKPCNCTKSHCLKLYCECFA GQLC  CNC NCMNNL +E+ER RAIKMTL+RNPTAFHPKIGRGEGERKHTKGCNCKRSGCLKNYCECYEAKISC+D CRCQGC+NTEDS+ERRSL RL AM +L+S QP++  K+L+KPP E LPH F TWEVIEA  +C+L++A+E ER +L    QE  L++ +G  L +++E +
Sbjct:  144 RKPCNCTKSHCLKLYCECFAQGQLCQNCNCNNCMNNLAYEEERGRAIKMTLERNPTAFHPKIGRGEGERKHTKGCNCKRSGCLKNYCECYEAKISCSDLCRCQGCRNTEDSVERRSLMRLAAMGALRSRQPSSFKKHLVKPPSETLPHVFFTWEVIEATASCLLAQADEAERRDLPPAAQERILLEEFGRTLERVIEAA 342          
BLAST of Protein lin-54 homolog vs. Ensembl Cavefish
Match: lin54 (lin-54 DREAM MuvB core complex component [Source:NCBI gene;Acc:103038067])

HSP 1 Score: 194.897 bits (494), Expect = 4.953e-54
Identity = 113/229 (49.34%), Postives = 149/229 (65.07%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGE--RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNAITKNL--------------IKPPHERLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQ---EWKLIDIYGTCLNKIVETSRTALFNNNMN 1036
            RKPCNCTKS CLKLYC+CFANG+ C+ CNC NC NNL+ E ER +AIK  LDRNP AF PKIG+G EGE  R+H+KGCNCK+SGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L  L   + ++  Q  A    L              I     +LP++F+T EV EA   C+L   E+ E++ELT + Q   E  +++ +G CL +I+  +  A  + ++N
Sbjct:  572 RKPCNCTKSQCLKLYCDCFANGEFCNNCNCVNCFNNLDHESERLKAIKACLDRNPVAFKPKIGKGKEGESDRRHSKGCNCKKSGCLKNYCECYEAKIMCSSICKCVGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRTTPAITSGGGKLPYTFVTKEVAEATCDCLL---EQAEKAELTNQSQVLAERLILEEFGRCLRRIISFASKAKTDCSIN 797          
BLAST of Protein lin-54 homolog vs. Ensembl Cavefish
Match: lin54 (lin-54 DREAM MuvB core complex component [Source:NCBI gene;Acc:103038067])

HSP 1 Score: 194.897 bits (494), Expect = 4.953e-54
Identity = 113/229 (49.34%), Postives = 149/229 (65.07%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGE--RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNAITKNL--------------IKPPHERLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQ---EWKLIDIYGTCLNKIVETSRTALFNNNMN 1036
            RKPCNCTKS CLKLYC+CFANG+ C+ CNC NC NNL+ E ER +AIK  LDRNP AF PKIG+G EGE  R+H+KGCNCK+SGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L  L   + ++  Q  A    L              I     +LP++F+T EV EA   C+L   E+ E++ELT + Q   E  +++ +G CL +I+  +  A  + ++N
Sbjct:  572 RKPCNCTKSQCLKLYCDCFANGEFCNNCNCVNCFNNLDHESERLKAIKACLDRNPVAFKPKIGKGKEGESDRRHSKGCNCKKSGCLKNYCECYEAKIMCSSICKCVGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRTTPAITSGGGKLPYTFVTKEVAEATCDCLL---EQAEKAELTNQSQVLAERLILEEFGRCLRRIISFASKAKTDCSIN 797          
BLAST of Protein lin-54 homolog vs. Ensembl Cavefish
Match: lin54 (lin-54 DREAM MuvB core complex component [Source:NCBI gene;Acc:103038067])

HSP 1 Score: 172.17 bits (435), Expect = 4.139e-46
Identity = 89/141 (63.12%), Postives = 106/141 (75.18%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGE--RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNAITKNL 823
            RKPCNCTKS CLKLYC+CFANG+ C+ CNC NC NNL+ E ER +AIK  LDRNP AF PKIG+G EGE  R+H+KGCNCK+SGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L  L   + ++  Q  A    L
Sbjct:  572 RKPCNCTKSQCLKLYCDCFANGEFCNNCNCVNCFNNLDHESERLKAIKACLDRNPVAFKPKIGKGKEGESDRRHSKGCNCKKSGCLKNYCECYEAKIMCSSICKCVGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKL 712          
BLAST of Protein lin-54 homolog vs. Ensembl Cavefish
Match: ENSAMXT00000052900.1 (protein lin-54 homolog [Source:NCBI gene;Acc:103041235])

HSP 1 Score: 166.007 bits (419), Expect = 3.065e-45
Identity = 96/201 (47.76%), Postives = 129/201 (64.18%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIG---RGEGERKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNAITKNLIKPPHERLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVET 1003
            +KPCNCT+S CLKLYC+CFA+G++C  CNCTNC NN+  + ER RA+K+ L RNP AFHPK G    G+ + +HTKGCNCKRSGCLKNYCECYEAKI C+ +C+C GC+N + S  R    R    +   S+               + P S +T +V+EA   C+L++AEE ER   T    E  +++ +G CL +IV +
Sbjct:  292 KKPCNCTRSQCLKLYCDCFASGEVCSNCNCTNCCNNMEHKSERYRAMKICLKRNPKAFHPKTGIRKVGDVKSRHTKGCNCKRSGCLKNYCECYEAKIMCSSTCKCIGCRNYDGSPVRELTGRETPNTPENSSG------------LHKCPLSCITPDVVEATCGCLLAQAEEAERERHTQPHAERMILEEFGQCLTQIVRS 480          
BLAST of Protein lin-54 homolog vs. Ensembl Cavefish
Match: ENSAMXT00000044901.1 (protein lin-54 homolog [Source:NCBI gene;Acc:103041235])

HSP 1 Score: 166.007 bits (419), Expect = 3.065e-45
Identity = 96/201 (47.76%), Postives = 129/201 (64.18%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIG---RGEGERKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNAITKNLIKPPHERLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVET 1003
            +KPCNCT+S CLKLYC+CFA+G++C  CNCTNC NN+  + ER RA+K+ L RNP AFHPK G    G+ + +HTKGCNCKRSGCLKNYCECYEAKI C+ +C+C GC+N + S  R    R    +   S+               + P S +T +V+EA   C+L++AEE ER   T    E  +++ +G CL +IV +
Sbjct:  292 KKPCNCTRSQCLKLYCDCFASGEVCSNCNCTNCCNNMEHKSERYRAMKICLKRNPKAFHPKTGIRKVGDVKSRHTKGCNCKRSGCLKNYCECYEAKIMCSSTCKCIGCRNYDGSPVRELTGRETPNTPENSSG------------LHKCPLSCITPDVVEATCGCLLAQAEEAERERHTQPHAERMILEEFGQCLTQIVRS 480          
BLAST of Protein lin-54 homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002180.1 (pep scaffold:Pmarinus_7.0:GL479132:6575:20305:-1 gene:ENSPMAG00000001976.1 transcript:ENSPMAT00000002180.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 194.126 bits (492), Expect = 3.438e-56
Identity = 109/214 (50.93%), Postives = 141/214 (65.89%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG---EGERKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLK--------RLIAMSSLKSNQPNAITKNLIKPPH----ERLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETS 1006
            RKPCNCTKS CLKLYCECFANG+ C  CNC NC NNL  E +R RAIK  LDRNP AF PKIG+G   E ER+H KGC+CKRSGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L         R++  ++ K+   + I+    +PP     ERLP +F+T EV EA   C+L+  +E   +  T    E +++  +G CL +I+ ++
Sbjct:  290 RKPCNCTKSQCLKLYCECFANGEFCYNCNCRNCSNNLVHESDRQRAIKSCLDRNPEAFRPKIGKGKEGEAERRHNKGCHCKRSGCLKNYCECYEAKIMCSSMCKCVGCKNFEESPERKTLMHLADAAEVRVLQQTAAKTKLSSQISDLPTRPPANGTGERLPFNFVTREVAEATCDCLLTVVDEVLGAGETRAVAERRVLQEFGRCLQQIINSA 503          
BLAST of Protein lin-54 homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002192.1 (pep scaffold:Pmarinus_7.0:GL479132:7799:25064:-1 gene:ENSPMAG00000001976.1 transcript:ENSPMAT00000002192.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 196.438 bits (498), Expect = 2.274e-55
Identity = 109/214 (50.93%), Postives = 141/214 (65.89%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG---EGERKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLK--------RLIAMSSLKSNQPNAITKNLIKPPH----ERLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETS 1006
            RKPCNCTKS CLKLYCECFANG+ C  CNC NC NNL  E +R RAIK  LDRNP AF PKIG+G   E ER+H KGC+CKRSGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L         R++  ++ K+   + I+    +PP     ERLP +F+T EV EA   C+L+  +E   +  T    E +++  +G CL +I+ ++
Sbjct:  535 RKPCNCTKSQCLKLYCECFANGEFCYNCNCRNCSNNLVHESDRQRAIKSCLDRNPEAFRPKIGKGKEGEAERRHNKGCHCKRSGCLKNYCECYEAKIMCSSMCKCVGCKNFEESPERKTLMHLADAAEVRVLQQTAAKTKLSSQISDLPTRPPANGTGERLPFNFVTREVAEATCDCLLTVVDEVLGAGETRAVAERRVLQEFGRCLQQIINSA 748          
BLAST of Protein lin-54 homolog vs. Ensembl Nematostella
Match: EDO39204 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAT6])

HSP 1 Score: 192.2 bits (487), Expect = 2.428e-58
Identity = 109/215 (50.70%), Postives = 142/215 (66.05%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG---EGERKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNAITKNL--------IKPP-----HERLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETS 1006
            RKPCNCTKS CLKLYC+CFA G+ C  CNC NC NN+  E ER++AIK  L+RNP AFHPKIG+G   E ER+H KGC+CKRSGCLKNYCECYEAKI CT  C+C GCKN E+S ER++L  L   + ++  Q NA    L         +PP      ERLP SF+T +V +A   C++++A E E+  L+    E  +++ +G  L +I+ T+
Sbjct:    4 RKPCNCTKSQCLKLYCDCFAQGEFCSNCNCVNCSNNIEHERERSKAIKACLERNPHAFHPKIGKGKVGESERRHNKGCHCKRSGCLKNYCECYEAKILCTSLCKCTGCKNFEESPERKTLMHLADAAEVRVKQQNAAKTKLESQIEDLPTRPPTMTSSGERLPFSFVTEDVAQATCQCVIAQAVEAEKMGLSPAMAEKMILEEFGRSLLQIIHTA 218          
BLAST of Protein lin-54 homolog vs. Ensembl Medaka
Match: lin54 (lin-54 DREAM MuvB core complex component [Source:NCBI gene;Acc:101166149])

HSP 1 Score: 201.83 bits (512), Expect = 6.935e-57
Identity = 113/219 (51.60%), Postives = 144/219 (65.75%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGE--RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNAI--------------TKNLIKPPHERLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTA 1015
            RKPCNCTKS CLKLYC+CFANG+ C+MCNC NC NNL  E ER +AIK  LDRNP AF PKIG+G EGE  R+H+KGCNCKRSGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L  L   + ++  Q  A               T  +I     RLP++FLT EV+EA   C+L KA   E+++    + E  +++ +G CL  I+ ++  A
Sbjct:  486 RKPCNCTKSQCLKLYCDCFANGEFCNMCNCNNCFNNLEHETERLKAIKTCLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLMRTTPVISSGSGRLPYTFLTKEVVEATCECLLDKARRAEQTDQLTSEAERLILEEFGHCLMNIITSAGKA 704          
BLAST of Protein lin-54 homolog vs. Ensembl Medaka
Match: lin54 (lin-54 DREAM MuvB core complex component [Source:NCBI gene;Acc:101166149])

HSP 1 Score: 202.601 bits (514), Expect = 9.973e-57
Identity = 113/219 (51.60%), Postives = 144/219 (65.75%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGE--RKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNAI--------------TKNLIKPPHERLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTA 1015
            RKPCNCTKS CLKLYC+CFANG+ C+MCNC NC NNL  E ER +AIK  LDRNP AF PKIG+G EGE  R+H+KGCNCKRSGCLKNYCECYEAKI C+  C+C GCKN E+S ER++L  L   + ++  Q  A               T  +I     RLP++FLT EV+EA   C+L KA   E+++    + E  +++ +G CL  I+ ++  A
Sbjct:  571 RKPCNCTKSQCLKLYCDCFANGEFCNMCNCNNCFNNLEHETERLKAIKTCLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLMRTTPVISSGSGRLPYTFLTKEVVEATCECLLDKARRAEQTDQLTSEAERLILEEFGHCLMNIITSAGKA 789          
BLAST of Protein lin-54 homolog vs. Planmine SMEST
Match: SMESG000004147.1 (SMESG000004147.1)

HSP 1 Score: 749.199 bits (1933), Expect = 0.000e+0
Identity = 456/456 (100.00%), Postives = 456/456 (100.00%), Query Frame = 2
Query:   80 MQQSYQITKGVNTPGGKVVKIVQLSNSGNNYVATFQGFNTIPIRSNNSNVGSDVLGTLLSQHPLGYLTNQTSQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRGEGERKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNAITKNLIKPPHERLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTALFNNNMNQFSNIMVDNYLMNSNISGDLLRSLDNDGSRRERNIQESRSXXXXXXXXXXXXXXXXXXAIVMNDDEDDDSEMVYSRRHSHXXXXXXXXXXXXXXXPSDNADPAWRPGKAKHNRQNQYYVTSSRSRRRNYENDDMLNV 1447
            MQQSYQITKGVNTPGGKVVKIVQLSNSGNNYVATFQGFNTIPIRSNNSNVGSDVLGTLLSQHPLGYLTNQTSQPSSLLSSNIAENININQQSNANLSNNGQNSNSSHHSSRKPCNCTKSHCLKLYCECFANGQLCDMCNCTNCMNNLNFEDERARAIKMTLDRNPTAFHPKIGRGEGERKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNAITKNLIKPPHERLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTALFNNNMNQFSNIMVDNYLMNSNISGDLLRSLDNDGSRRERNIQESRSDLGDDEEGDDELDVDLEDAIVMNDDEDDDSEMVYSRRHSHTTESYSSRTGRRRGRPSDNADPAWRPGKAKHNRQNQYYVTSSRSRRRNYENDDMLNV
Sbjct:    1 MQQSYQITKGVNTPGGKVVKIVQLSNSGNNYVATFQGFNTIPIRSNNSNVGSDVLGTLLSQHPLGYLTNQTSQPSSLLSSNIAENININQQSNANLSNNGQNSNSSHHSSRKPCNCTKSHCLKLYCECFANGQLCDMCNCTNCMNNLNFEDERARAIKMTLDRNPTAFHPKIGRGEGERKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNAITKNLIKPPHERLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGTCLNKIVETSRTALFNNNMNQFSNIMVDNYLMNSNISGDLLRSLDNDGSRRERNIQESRSDLGDDEEGDDELDVDLEDAIVMNDDEDDDSEMVYSRRHSHTTESYSSRTGRRRGRPSDNADPAWRPGKAKHNRQNQYYVTSSRSRRRNYENDDMLNV 456          
BLAST of Protein lin-54 homolog vs. Planmine SMEST
Match: SMESG000058758.1 (SMESG000058758.1)

HSP 1 Score: 136.732 bits (343), Expect = 6.140e-34
Identity = 72/107 (67.29%), Postives = 82/107 (76.64%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRGEGERKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKN 730
             +PCNCTKS+CLKLYCECFA  +LC  CNC NCMNN+  E  R+ A+   LD+NP AF PKIG G+G + H KGCNCKRS CLKNYCEC EAKI C+  CRCQGCKN
Sbjct:   84 HRPCNCTKSYCLKLYCECFARDKLCLNCNCNNCMNNIGHEKSRSTALLRILDKNPLAFLPKIGSGQGHKLHRKGCNCKRSECLKNYCECREAKIECSMLCRCQGCKN 190          
BLAST of Protein lin-54 homolog vs. Planmine SMEST
Match: SMESG000058758.1 (SMESG000058758.1)

HSP 1 Score: 136.346 bits (342), Expect = 7.664e-34
Identity = 72/107 (67.29%), Postives = 82/107 (76.64%), Query Frame = 2
Query:  410 RKPCNCTKSHCLKLYCECFANGQXXXXXXXXXXXXXXXFEDERARAIKMTLDRNPTAFHPKIGRGEGERKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKN 730
             +PCNCTKS+CLKLYCECFA  +LC  CNC NCMNN+  E  R+ A+   LD+NP AF PKIG G+G + H KGCNCKRS CLKNYCEC EAKI C+  CRCQGCKN
Sbjct:   84 HRPCNCTKSYCLKLYCECFARDKLCLNCNCNNCMNNIGHEKSRSTALLRILDKNPLAFLPKIGSGQGHKLHRKGCNCKRSECLKNYCECREAKIECSMLCRCQGCKN 190          
BLAST of Protein lin-54 homolog vs. Planmine SMEST
Match: SMESG000065196.1 (SMESG000065196.1)

HSP 1 Score: 105.916 bits (263), Expect = 6.752e-24
Identity = 57/109 (52.29%), Postives = 72/109 (66.06%), Query Frame = 2
Query:  419 CNCTKSHCLKLYCECFANGQXXXXXXXXXX-XXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGERKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTED 739
            C CTKS CLKLYCECFANG LC          NN N ++ERA+ +   L+R+P  F+ KI    E  +KH+KGCNC +S CLKNYCEC+E K+ C+  CRC+ C N E+
Sbjct:  242 CTCTKSSCLKLYCECFANGNLCCSGCTCINCRNNDNHKEERAKIVSSYLERDPWVFNSKIAENKEVGKKHSKGCNCLKSSCLKNYCECFENKVFCSSLCRCRMCYNNEE 350          
BLAST of Protein lin-54 homolog vs. Planmine SMEST
Match: SMESG000050053.1 (SMESG000050053.1)

HSP 1 Score: 105.916 bits (263), Expect = 6.895e-24
Identity = 57/109 (52.29%), Postives = 72/109 (66.06%), Query Frame = 2
Query:  419 CNCTKSHCLKLYCECFANGQXXXXXXXXXX-XXXXXFEDERARAIKMTLDRNPTAFHPKIGRG-EGERKHTKGCNCKRSGCLKNYCECYEAKISCTDSCRCQGCKNTED 739
            C CTKS CLKLYCECFANG LC          NN N ++ERA+ +   L+R+P  F+ KI    E  +KH+KGCNC +S CLKNYCEC+E K+ C+  CRC+ C N E+
Sbjct:  356 CTCTKSSCLKLYCECFANGNLCCSGCTCINCRNNDNHKEERAKIVSSYLERDPWVFNSKIAENKEVGKKHSKGCNCLKSSCLKNYCECFENKVFCSSLCRCRMCYNNEE 464          
The following BLAST results are available for this feature:
BLAST of Protein lin-54 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LIN541.127e-5450.23lin-54 DREAM MuvB core complex component [Source:H... [more]
LIN541.127e-5450.23lin-54 DREAM MuvB core complex component [Source:H... [more]
LIN541.127e-5450.23lin-54 DREAM MuvB core complex component [Source:H... [more]
LIN544.476e-5450.23lin-54 DREAM MuvB core complex component [Source:H... [more]
LIN547.867e-5450.23lin-54 DREAM MuvB core complex component [Source:H... [more]
back to top
BLAST of Protein lin-54 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lin-542.827e-4541.77pep chromosome:WBcel235:IV:13241062:13243369:1 gen... [more]
lin-543.354e-4541.77pep chromosome:WBcel235:IV:13241051:13243401:1 gen... [more]
back to top
BLAST of Protein lin-54 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mip1201.742e-4247.55gene:FBgn0033846 transcript:FBtr0301388[more]
mip1201.891e-4247.55gene:FBgn0033846 transcript:FBtr0087669[more]
tomb1.198e-862.86gene:FBgn0031715 transcript:FBtr0079127[more]
back to top
BLAST of Protein lin-54 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
lin544.330e-5450.23lin-54 DREAM MuvB core complex component [Source:N... [more]
tesmin4.115e-4547.20testis expressed metallothionein like protein [Sou... [more]
lin542.931e-4447.74lin-54 DREAM MuvB core complex component [Source:N... [more]
back to top
BLAST of Protein lin-54 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin541.915e-5550.68lin-54 DREAM MuvB core complex component [Source:N... [more]
lin544.572e-5550.68lin-54 DREAM MuvB core complex component [Source:N... [more]
lin541.095e-5450.68lin-54 DREAM MuvB core complex component [Source:N... [more]
lin541.108e-5450.68lin-54 DREAM MuvB core complex component [Source:N... [more]
lin541.612e-5450.68lin-54 DREAM MuvB core complex component [Source:N... [more]
back to top
BLAST of Protein lin-54 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lin548.845e-5550.23lin-54 homolog (C. elegans) [Source:MGI Symbol;Acc... [more]
Lin548.845e-5550.23lin-54 homolog (C. elegans) [Source:MGI Symbol;Acc... [more]
Lin548.845e-5550.23lin-54 homolog (C. elegans) [Source:MGI Symbol;Acc... [more]
Lin542.246e-5450.23lin-54 homolog (C. elegans) [Source:MGI Symbol;Acc... [more]
Lin545.967e-5450.23lin-54 homolog (C. elegans) [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Protein lin-54 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RBN8|LIN54_PONAB5.411e-5450.23Protein lin-54 homolog OS=Pongo abelii OX=9601 GN=... [more]
sp|Q0IHV2|LIN54_XENTR5.800e-5450.68Protein lin-54 homolog OS=Xenopus tropicalis OX=83... [more]
sp|Q08CM4|LIN54_DANRE3.504e-5350.23Protein lin-54 homolog OS=Danio rerio OX=7955 GN=l... [more]
sp|Q6MZP7|LIN54_HUMAN3.778e-5350.23Protein lin-54 homolog OS=Homo sapiens OX=9606 GN=... [more]
sp|Q641Z1|LIN54_RAT4.133e-5350.23Protein lin-54 homolog OS=Rattus norvegicus OX=101... [more]
back to top
BLAST of Protein lin-54 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3UJA79.720e-9372.28CRC domain-containing protein OS=Mesocestoides cor... [more]
A0A3Q0KTL33.342e-9266.06Tesmin-related OS=Schistosoma mansoni OX=6183 PE=4... [more]
A0A0R3VUT65.451e-9271.29CRC domain-containing protein OS=Taenia asiatica O... [more]
A0A095A3T55.614e-9266.06Protein lin-54-like protein OS=Schistosoma haemato... [more]
G4VTN66.109e-9271.36Tesmin-related OS=Schistosoma mansoni OX=6183 GN=S... [more]
back to top
BLAST of Protein lin-54 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin544.953e-5449.34lin-54 DREAM MuvB core complex component [Source:N... [more]
lin544.953e-5449.34lin-54 DREAM MuvB core complex component [Source:N... [more]
lin544.139e-4663.12lin-54 DREAM MuvB core complex component [Source:N... [more]
ENSAMXT00000052900.13.065e-4547.76protein lin-54 homolog [Source:NCBI gene;Acc:10304... [more]
ENSAMXT00000044901.13.065e-4547.76protein lin-54 homolog [Source:NCBI gene;Acc:10304... [more]
back to top
BLAST of Protein lin-54 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000002180.13.438e-5650.93pep scaffold:Pmarinus_7.0:GL479132:6575:20305:-1 g... [more]
ENSPMAT00000002192.12.274e-5550.93pep scaffold:Pmarinus_7.0:GL479132:7799:25064:-1 g... [more]
back to top
BLAST of Protein lin-54 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein lin-54 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO392042.428e-5850.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein lin-54 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lin546.935e-5751.60lin-54 DREAM MuvB core complex component [Source:N... [more]
lin549.973e-5751.60lin-54 DREAM MuvB core complex component [Source:N... [more]
back to top
BLAST of Protein lin-54 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004147.10.000e+0100.00SMESG000004147.1[more]
SMESG000058758.16.140e-3467.29SMESG000058758.1[more]
SMESG000058758.17.664e-3467.29SMESG000058758.1[more]
SMESG000065196.16.752e-2452.29SMESG000065196.1[more]
SMESG000050053.16.895e-2452.29SMESG000050053.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020325 ID=SMED30020325|Name=Protein lin-54 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1478bp
TTTAAATTTAAAAATTGTTATTACCCATTTAAATATTAATATAATTTTTA
AAATAGAAAGATTTTAAAATCCTGTTGATATGCAACAAAGTTATCAAATT
ACAAAAGGTGTTAATACTCCAGGAGGGAAAGTCGTCAAAATTGTTCAACT
CTCTAATTCAGGAAATAATTATGTTGCTACTTTTCAAGGATTTAATACTA
TTCCGATTCGTTCAAATAATTCTAATGTCGGTAGTGACGTATTAGGCACG
CTTTTGTCTCAACATCCTTTAGGATATCTAACTAATCAGACAAGCCAACC
AAGTAGTTTATTATCATCTAATATAGCAGAAAATATTAACATTAATCAAC
AATCAAATGCAAATTTATCAAACAATGGACAAAATAGCAATTCAAGTCAT
CATAGTTCTCGAAAGCCATGTAATTGTACGAAATCTCATTGCCTTAAGTT
ATACTGTGAATGTTTTGCTAATGGACAATTATGTGATATGTGCAACTGCA
CAAATTGTATGAATAATTTAAATTTTGAAGACGAAAGAGCCAGAGCTATT
AAGATGACACTCGATAGAAATCCTACGGCTTTTCATCCAAAAATAGGACG
TGGGGAAGGTGAAAGAAAACATACCAAAGGTTGTAATTGCAAGCGATCTG
GATGCCTTAAAAATTATTGTGAATGCTATGAAGCTAAAATTAGCTGTACT
GATAGTTGTAGATGTCAGGGGTGTAAAAATACTGAAGACAGTATTGAGAG
GCGTTCGTTAAAGCGACTTATAGCGATGTCTTCATTGAAATCAAATCAAC
CCAACGCAATTACTAAAAACCTAATTAAACCGCCTCATGAAAGGTTACCT
CATTCATTTTTAACCTGGGAAGTAATAGAAGCAATGACAACTTGTATGCT
TTCAAAGGCGGAAGAATTCGAACGATCTGAATTAACTGTGGAACAGCAGG
AGTGGAAACTTATTGATATCTACGGAACTTGTCTGAATAAAATTGTTGAA
ACTTCTCGAACAGCACTTTTTAATAATAATATGAATCAATTCTCTAACAT
CATGGTTGATAATTATTTGATGAATTCAAACATATCTGGTGATTTGTTGA
GGTCTTTGGACAACGACGGCTCTCGGAGAGAAAGGAATATCCAGGAGAGT
CGCAGTGATCTGGGCGATGATGAAGAGGGTGATGATGAACTGGATGTCGA
TTTGGAAGATGCAATAGTAATGAACGATGATGAAGATGATGATTCGGAAA
TGGTTTATTCGAGGCGTCATTCTCACACAACTGAGTCCTACAGCTCTCGA
ACAGGCAGACGGCGTGGTCGCCCATCAGACAACGCAGATCCAGCCTGGAG
ACCAGGCAAGGCCAAGCACAACCGACAGAATCAGTACTATGTGACATCAA
GCCGATCGAGAAGAAGAAATTATGAAAACGATGATATGTTAAATGTATAA
ATAATAATTAAATATATTTTGTAATGTG
back to top

protein sequence of SMED30020325-orf-1

>SMED30020325-orf-1 ID=SMED30020325-orf-1|Name=SMED30020325-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=457bp
MQQSYQITKGVNTPGGKVVKIVQLSNSGNNYVATFQGFNTIPIRSNNSNV
GSDVLGTLLSQHPLGYLTNQTSQPSSLLSSNIAENININQQSNANLSNNG
QNSNSSHHSSRKPCNCTKSHCLKLYCECFANGQLCDMCNCTNCMNNLNFE
DERARAIKMTLDRNPTAFHPKIGRGEGERKHTKGCNCKRSGCLKNYCECY
EAKISCTDSCRCQGCKNTEDSIERRSLKRLIAMSSLKSNQPNAITKNLIK
PPHERLPHSFLTWEVIEAMTTCMLSKAEEFERSELTVEQQEWKLIDIYGT
CLNKIVETSRTALFNNNMNQFSNIMVDNYLMNSNISGDLLRSLDNDGSRR
ERNIQESRSDLGDDEEGDDELDVDLEDAIVMNDDEDDDSEMVYSRRHSHT
TESYSSRTGRRRGRPSDNADPAWRPGKAKHNRQNQYYVTSSRSRRRNYEN
DDMLNV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0003677DNA binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR028307Lin-54_fam
IPR033467Tesmin/TSO1-like_CXC
IPR005172CRC
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0007049cell cycle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR033467Tesmin/TSO1-like CXC domainSMARTSM01114CXC_2coord: 180..221
e-value: 3.2E-19
score: 79.9
coord: 109..149
e-value: 2.4E-14
score: 63.7
IPR005172CRC domainPFAMPF03638TCRcoord: 183..219
e-value: 1.9E-12
score: 47.2
coord: 112..146
e-value: 1.6E-11
score: 44.3
IPR005172CRC domainPROSITEPS51634CRCcoord: 110..220
score: 33.394
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 361..388
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 389..427
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 345..360
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 345..456
IPR028307Lin-54 familyPANTHERPTHR12446TESMIN/TSO1-RELATEDcoord: 70..312