Cilia and flagella associated protein 126

Overview
NameCilia and flagella associated protein 126
Smed IDSMED30020321
Length (bp)692
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cilia and flagella associated protein 126 (SMED30020321) t-SNE clustered cells

Violin plots show distribution of expression levels for Cilia and flagella associated protein 126 (SMED30020321) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cilia and flagella associated protein 126 (SMED30020321) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cilia and flagella associated protein 126 (SMED30020321) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020321

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30020321SMESG000048804.1 SmedASXL_003159SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30020321SMESG000048804.1 dd_Smed_v4_2157_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30020321SMESG000048804.1 dd_Smed_v4_2157_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30020321SMESG000048804.1 dd_Smed_v4_2157_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020321SMESG000048804.1 dd_Smed_v4_2157_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020321SMESG000048804.1 dd_Smed_v4_2157_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30020321SMESG000048804.1 dd_Smed_v4_2157_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020321SMESG000048804.1 Contig36657uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020321SMESG000048804.1 Contig36657newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020321SMESG000048804.1 Contig49610uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020321SMESG000048804.1 Contig49610newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30020321SMESG000048804.1 dd_Smed_v6_2157_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30020321SMESG000048804.1 Contig36657uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30020321SMESG000048804.1 Contig36657newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30020321SMESG000048804.1 dd_Smed_v4_2157_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cilia and flagella associated protein 126 vs. Ensembl Human
Match: CFAP126 (cilia and flagella associated protein 126 [Source:HGNC Symbol;Acc:HGNC:32325])

HSP 1 Score: 74.3294 bits (181), Expect = 5.987e-16
Identity = 30/73 (41.10%), Postives = 50/73 (68.49%), Query Frame = 3
Query:   48 MAFSFSANQYDEPFIAKRMQQYQIPHEYRERPRARTGFTRIITDDKGHMSMGVPKSKENPWGNFVNTWDLPIR 266
            MA ++SANQY++ F +K +Q +      +E   +  G+T+II +D+GH+   VP+SK NPWG+F+ TW +P++
Sbjct:    1 MATNYSANQYEKAFSSKYLQNWSPTKPTKESISSHEGYTQIIANDRGHLLPSVPRSKANPWGSFMGTWQMPLK 73          
BLAST of Cilia and flagella associated protein 126 vs. Ensembl Zebrafish
Match: cfap126 (cilia and flagella associated protein 126 [Source:NCBI gene;Acc:751706])

HSP 1 Score: 71.633 bits (174), Expect = 8.216e-15
Identity = 31/73 (42.47%), Postives = 46/73 (63.01%), Query Frame = 3
Query:   48 MAFSFSANQYDEPFIAKRMQQYQIPHEYRERPRARTGFTRIITDDKGHMSMGVPKSKENPWGNFVNTWDLPIR 266
            M+ S+SANQY+  F ++++Q + IP +++ERP A  G+T  I  D+GH+  GV     + W  F  TWDLP R
Sbjct:    1 MSTSYSANQYESAFKSQKLQNWTIPKQFKERPSAAEGYTTFIATDRGHLLPGVRTKHRSAWPAFQGTWDLPRR 73          
BLAST of Cilia and flagella associated protein 126 vs. Ensembl Zebrafish
Match: cfap126 (cilia and flagella associated protein 126 [Source:NCBI gene;Acc:751706])

HSP 1 Score: 71.633 bits (174), Expect = 8.216e-15
Identity = 31/73 (42.47%), Postives = 46/73 (63.01%), Query Frame = 3
Query:   48 MAFSFSANQYDEPFIAKRMQQYQIPHEYRERPRARTGFTRIITDDKGHMSMGVPKSKENPWGNFVNTWDLPIR 266
            M+ S+SANQY+  F ++++Q + IP +++ERP A  G+T  I  D+GH+  GV     + W  F  TWDLP R
Sbjct:    1 MSTSYSANQYESAFKSQKLQNWTIPKQFKERPSAAEGYTTFIATDRGHLLPGVRTKHRSAWPAFQGTWDLPRR 73          
BLAST of Cilia and flagella associated protein 126 vs. Ensembl Xenopus
Match: ENSXETT00000015766.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460425.1:151500:152726:-1 gene:ENSXETG00000009904.1 transcript:ENSXETT00000015766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 7.475e-7
Identity = 20/52 (38.46%), Postives = 33/52 (63.46%), Query Frame = 3
Query:   63 SANQYDEPFIAKRMQQYQIPHEYRERPRARTGFTRIITDDKGHMSMGVPKSK 218
            S  QY   F  K++Q + +P  Y+ERP    G+T+ I +++GH+  GVP+S+
Sbjct:    6 SLPQYQSAFTPKQLQSWNVPKAYKERPSDHDGYTQFIANERGHLLPGVPRSQ 57          
BLAST of Cilia and flagella associated protein 126 vs. Ensembl Mouse
Match: Cfap126 (cilia and flagella associated protein 126 [Source:MGI Symbol;Acc:MGI:1922722])

HSP 1 Score: 72.0182 bits (175), Expect = 4.065e-15
Identity = 28/73 (38.36%), Postives = 50/73 (68.49%), Query Frame = 3
Query:   48 MAFSFSANQYDEPFIAKRMQQYQIPHEYRERPRARTGFTRIITDDKGHMSMGVPKSKENPWGNFVNTWDLPIR 266
            MA ++SANQY++ ++   +Q +      +E+  A  G+T+II +D+GH+   VP+SK +PWG+F+ TW +P++
Sbjct:    1 MATNYSANQYEKAYLPTYLQNWSPARPTKEKIAAHEGYTQIIANDRGHLLPSVPRSKASPWGSFMGTWQMPLK 73          
BLAST of Cilia and flagella associated protein 126 vs. Ensembl Mouse
Match: Cfap126 (cilia and flagella associated protein 126 [Source:MGI Symbol;Acc:MGI:1922722])

HSP 1 Score: 72.0182 bits (175), Expect = 4.272e-15
Identity = 28/73 (38.36%), Postives = 50/73 (68.49%), Query Frame = 3
Query:   48 MAFSFSANQYDEPFIAKRMQQYQIPHEYRERPRARTGFTRIITDDKGHMSMGVPKSKENPWGNFVNTWDLPIR 266
            MA ++SANQY++ ++   +Q +      +E+  A  G+T+II +D+GH+   VP+SK +PWG+F+ TW +P++
Sbjct:    1 MATNYSANQYEKAYLPTYLQNWSPARPTKEKIAAHEGYTQIIANDRGHLLPSVPRSKASPWGSFMGTWQMPLK 73          
BLAST of Cilia and flagella associated protein 126 vs. Ensembl Mouse
Match: Cfap126 (cilia and flagella associated protein 126 [Source:MGI Symbol;Acc:MGI:1922722])

HSP 1 Score: 59.3066 bits (142), Expect = 3.272e-10
Identity = 22/64 (34.38%), Postives = 42/64 (65.62%), Query Frame = 3
Query:   75 YDEPFIAKRMQQYQIPHEYRERPRARTGFTRIITDDKGHMSMGVPKSKENPWGNFVNTWDLPIR 266
            Y++ ++   +Q +      +E+  A  G+T+II +D+GH+   VP+SK +PWG+F+ TW +P++
Sbjct:   54 YEKAYLPTYLQNWSPARPTKEKIAAHEGYTQIIANDRGHLLPSVPRSKASPWGSFMGTWQMPLK 117          
BLAST of Cilia and flagella associated protein 126 vs. Ensembl Mouse
Match: Cfap126 (cilia and flagella associated protein 126 [Source:MGI Symbol;Acc:MGI:1922722])

HSP 1 Score: 49.6766 bits (117), Expect = 3.787e-8
Identity = 22/61 (36.07%), Postives = 39/61 (63.93%), Query Frame = 3
Query:   48 MAFSFSANQYDEPFIAKRMQQYQIPHEYRERPRARTGFTRIITDDKGHMSMGVPKSKENPW 230
            MA ++SANQY++ ++   +Q +      +E+  A  G+T+II +D+GH+   VP+SK  P+
Sbjct:    1 MATNYSANQYEKAYLPTYLQNWSPARPTKEKIAAHEGYTQIIANDRGHLLPSVPRSKVFPY 61          
BLAST of Cilia and flagella associated protein 126 vs. Ensembl Mouse
Match: Cfap126 (cilia and flagella associated protein 126 [Source:MGI Symbol;Acc:MGI:1922722])

HSP 1 Score: 48.521 bits (114), Expect = 9.821e-8
Identity = 21/57 (36.84%), Postives = 37/57 (64.91%), Query Frame = 3
Query:   48 MAFSFSANQYDEPFIAKRMQQYQIPHEYRERPRARTGFTRIITDDKGHMSMGVPKSK 218
            MA ++SANQY++ ++   +Q +      +E+  A  G+T+II +D+GH+   VP+SK
Sbjct:    1 MATNYSANQYEKAYLPTYLQNWSPARPTKEKIAAHEGYTQIIANDRGHLLPSVPRSK 57          
BLAST of Cilia and flagella associated protein 126 vs. UniProt/SwissProt
Match: sp|A7RR34|FLTOP_NEMVE (Protein Flattop homolog OS=Nematostella vectensis OX=45351 GN=v1g200856 PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 3.896e-20
Identity = 34/70 (48.57%), Postives = 53/70 (75.71%), Query Frame = 3
Query:   48 MAFSFSANQYDEPFIAKRMQQYQIPHEYRERPRARTGFTRIITDDKGHMSMGVPKSKENPWGNFVNTWDL 257
            M+  FSANQY++ F AKR+Q +++P  ++E P +  GFT+II++D+GH+  G+P+S  +PWG FV TWD+
Sbjct:    1 MSTHFSANQYEKSFDAKRLQNWEVPKHFKEHPSSLEGFTQIISNDRGHILEGIPRSSRSPWGEFVGTWDM 70          
BLAST of Cilia and flagella associated protein 126 vs. UniProt/SwissProt
Match: sp|Q3KPS4|FLTOP_XENLA (Protein Flattop OS=Xenopus laevis OX=8355 GN=cfap126 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 3.299e-17
Identity = 30/73 (41.10%), Postives = 49/73 (67.12%), Query Frame = 3
Query:   48 MAFSFSANQYDEPFIAKRMQQYQIPHEYRERPRARTGFTRIITDDKGHMSMGVPKSKENPWGNFVNTWDLPIR 266
            MA  +SANQY   F  K++  + IP ++++ P     +T+ I +++GH+  GVP+S++NPWG F+ TWDLP +
Sbjct:    1 MATHYSANQYQSAFTPKQLHCWSIPKDFKQHPSTHDDYTQFIANERGHLLAGVPRSQKNPWGTFLGTWDLPTK 73          
BLAST of Cilia and flagella associated protein 126 vs. UniProt/SwissProt
Match: sp|Q3SZT6|FLTOP_BOVIN (Protein Flattop OS=Bos taurus OX=9913 GN=CFAP126 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 8.859e-17
Identity = 31/73 (42.47%), Postives = 52/73 (71.23%), Query Frame = 3
Query:   48 MAFSFSANQYDEPFIAKRMQQYQIPHEYRERPRARTGFTRIITDDKGHMSMGVPKSKENPWGNFVNTWDLPIR 266
            MA ++SANQY++PF  K +Q + +    +ER  +  G+T+II +D+GH+   VP+SK +PWG+F+ TW +P++
Sbjct:    1 MATNYSANQYEKPFSPKYLQNWSLAKPTKERISSHEGYTQIIANDRGHLLPSVPRSKASPWGSFMGTWQMPLK 73          
BLAST of Cilia and flagella associated protein 126 vs. UniProt/SwissProt
Match: sp|Q5VTH2|FLTOP_HUMAN (Protein Flattop OS=Homo sapiens OX=9606 GN=CFAP126 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.875e-15
Identity = 30/73 (41.10%), Postives = 50/73 (68.49%), Query Frame = 3
Query:   48 MAFSFSANQYDEPFIAKRMQQYQIPHEYRERPRARTGFTRIITDDKGHMSMGVPKSKENPWGNFVNTWDLPIR 266
            MA ++SANQY++ F +K +Q +      +E   +  G+T+II +D+GH+   VP+SK NPWG+F+ TW +P++
Sbjct:    1 MATNYSANQYEKAFSSKYLQNWSPTKPTKESISSHEGYTQIIANDRGHLLPSVPRSKANPWGSFMGTWQMPLK 73          
BLAST of Cilia and flagella associated protein 126 vs. UniProt/SwissProt
Match: sp|Q6P8X9|FLTOP_MOUSE (Protein Flattop OS=Mus musculus OX=10090 GN=Cfap126 PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.988e-14
Identity = 28/73 (38.36%), Postives = 50/73 (68.49%), Query Frame = 3
Query:   48 MAFSFSANQYDEPFIAKRMQQYQIPHEYRERPRARTGFTRIITDDKGHMSMGVPKSKENPWGNFVNTWDLPIR 266
            MA ++SANQY++ ++   +Q +      +E+  A  G+T+II +D+GH+   VP+SK +PWG+F+ TW +P++
Sbjct:    1 MATNYSANQYEKAYLPTYLQNWSPARPTKEKIAAHEGYTQIIANDRGHLLPSVPRSKASPWGSFMGTWQMPLK 73          
BLAST of Cilia and flagella associated protein 126 vs. TrEMBL
Match: A0A210QYT6 (Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT22451 PE=4 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 5.164e-28
Identity = 52/108 (48.15%), Postives = 75/108 (69.44%), Query Frame = 3
Query:   48 MAFSFSANQYDEPFIAKRMQQYQIPHEYRERPRARTGFTRIITDDKGHMSMGVPKSKENPWGNFVNTWDLPIRPNVPGNHVDNSMGRTKRHTERLRREQTEYNIQLRA 371
            MA  FSANQY++ F  K +Q +++P +YRERP A TGFT+I  +D+GH+  GV +S+E+PWG FV TWDLP++  +PGN++ N   RT    +RL R +T+  I L+ 
Sbjct:    1 MALHFSANQYNKSFDPKLLQNWEVPAQYRERPSAYTGFTQIKANDRGHLLPGVKRSRESPWGTFVGTWDLPLK--IPGNNMSNQTARTFDAVQRLDRCKTDGEIILKG 106          
BLAST of Cilia and flagella associated protein 126 vs. TrEMBL
Match: K1QNJ1 (Uncharacterized protein OS=Crassostrea gigas OX=29159 GN=CGI_10008200 PE=4 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 2.262e-26
Identity = 50/108 (46.30%), Postives = 76/108 (70.37%), Query Frame = 3
Query:   48 MAFSFSANQYDEPFIAKRMQQYQIPHEYRERPRARTGFTRIITDDKGHMSMGVPKSKENPWGNFVNTWDLPIRPNVPGNHVDNSMGRTKRHTERLRREQTEYNIQLRA 371
            M+  FSANQYD+ F   R+Q +++P ++R RPRA  GFT+I+ +++GH+  GV +S+E+PWGNFV TWD+P+  N+PGN + NS  RT     RL R +T+ +I ++ 
Sbjct:    1 MSLHFSANQYDQAFDPHRLQNWEVPKQFRPRPRAFDGFTQIVANNRGHLLSGVKRSRESPWGNFVGTWDMPL--NIPGNKMMNSTARTFHAQVRLERCKTDGDIIIKG 106          
BLAST of Cilia and flagella associated protein 126 vs. TrEMBL
Match: A0A1S3HR34 (protein Flattop homolog OS=Lingula unguis OX=7574 GN=LOC106177350 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.095e-21
Identity = 43/108 (39.81%), Postives = 71/108 (65.74%), Query Frame = 3
Query:   48 MAFSFSANQYDEPFIAKRMQQYQIPHEYRERPRARTGFTRIITDDKGHMSMGVPKSKENPWGNFVNTWDLPIRPNVPGNHVDNSMGRTKRHTERLRREQTEYNIQLRA 371
            MA  FS NQY++ F  KR+Q +++   +R+RP++  GFT+II  D+GH+  GV +S E+PWG FV TWD+P++  +PGN + N   R+    E+L + + E ++ ++ 
Sbjct:    1 MALHFSGNQYEQAFDPKRLQNWEVAKRHRQRPKSLDGFTQIIATDRGHLFPGVRRSGESPWGTFVGTWDMPLK--IPGNKMTNPTARSTYAQEKLHKLKGEGDLVIKG 106          
BLAST of Cilia and flagella associated protein 126 vs. TrEMBL
Match: A0A2G8LKH4 (Uncharacterized protein OS=Stichopus japonicus OX=307972 GN=BSL78_02321 PE=4 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 2.856e-21
Identity = 49/105 (46.67%), Postives = 70/105 (66.67%), Query Frame = 3
Query:   48 MAFSFSANQYDEPFIAKRMQQYQIPHEYRERPRARTGFTRIITDDKGHMSMGVPKSKENPWGNFVNTWDLPIRPNVPGN------HVDNSMGRTKRHTERLRREQ 344
            MA  FSANQY++ F ++R+Q +Q+P  Y+ERP +  GFT+II +D+GH+  GVPKS  +PWG FV TWD+P +  +PGN        D ++G  K  T+R+  EQ
Sbjct:    1 MASHFSANQYEKAFDSRRLQHWQLPKSYKERPDSYEGFTQIIANDRGHLMEGVPKSARSPWGEFVGTWDMPRK--IPGNITTYMARSDPAVGGIK--TQRIVHEQ 101          
BLAST of Cilia and flagella associated protein 126 vs. TrEMBL
Match: A0A1I8FYT1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 3.672e-21
Identity = 41/87 (47.13%), Postives = 61/87 (70.11%), Query Frame = 3
Query:   48 MAFSFSANQYDEPFIAKRMQQYQIPHEYRERPRARTGFTRIITDDKGHMSMGVPKSKENPWGNFVNTWDLPIRPNVPGNHVDNSMGR 308
            M+  F+ NQYD+ F A+R+QQY +P + +E P  R G T+II ++ GH+  GV +S+ +PWG+F  TWDLP R  +PGNH++N+  R
Sbjct:    1 MSSGFAVNQYDDAFRARRLQQYTVPKQLKEYPSTRAGSTKIIANELGHLLPGVGRSEGSPWGDFKGTWDLPNR--LPGNHLNNTCAR 85          
BLAST of Cilia and flagella associated protein 126 vs. Ensembl Cavefish
Match: cfap126 (cilia and flagella associated protein 126 [Source:NCBI gene;Acc:103022667])

HSP 1 Score: 73.1738 bits (178), Expect = 1.981e-15
Identity = 38/96 (39.58%), Postives = 56/96 (58.33%), Query Frame = 3
Query:   48 MAFSFSANQYDEPFIAKRMQQYQIPHEYRERPRARTGFTRIITDDKGHMSMGVPKSKENPWGNFVNTWDLPIRPNVPGNHVDNSMGRTKRHTERLR 335
            M+ S++ANQY+  F + R+Q + IP  ++ERP A  G T  I  D+GH+  GV +     W +F  TWDLP R  +P  H+ N   R++   ERL+
Sbjct:    1 MSSSYTANQYENAFKSHRLQSWTIPKHFKERPSAVEGHTGFIATDRGHLLPGVKRGSS--WTSFQGTWDLPSR--IPPVHI-NPTARSQEGQERLK 91          
BLAST of Cilia and flagella associated protein 126 vs. Ensembl Cavefish
Match: cfap126 (cilia and flagella associated protein 126 [Source:NCBI gene;Acc:103022667])

HSP 1 Score: 61.6178 bits (148), Expect = 2.882e-11
Identity = 33/87 (37.93%), Postives = 48/87 (55.17%), Query Frame = 3
Query:   75 YDEPFIAKRMQQYQIPHEYRERPRARTGFTRIITDDKGHMSMGVPKSKENPWGNFVNTWDLPIRPNVPGNHVDNSMGRTKRHTERLR 335
            Y+  F + R+Q + IP  ++ERP A  G T  I  D+GH+  GV +     W +F  TWDLP R  +P  H+ N   R++   ERL+
Sbjct:    1 YENAFKSHRLQSWTIPKHFKERPSAVEGHTGFIATDRGHLLPGVKRGSS--WTSFQGTWDLPSR--IPPVHI-NPTARSQEGQERLK 82          
BLAST of Cilia and flagella associated protein 126 vs. Ensembl Nematostella
Match: EDO46098 (UPF0740 protein v1g200856 [Source:UniProtKB/Swiss-Prot;Acc:A7RR34])

HSP 1 Score: 87.0409 bits (214), Expect = 1.597e-21
Identity = 34/70 (48.57%), Postives = 53/70 (75.71%), Query Frame = 3
Query:   48 MAFSFSANQYDEPFIAKRMQQYQIPHEYRERPRARTGFTRIITDDKGHMSMGVPKSKENPWGNFVNTWDL 257
            M+  FSANQY++ F AKR+Q +++P  ++E P +  GFT+II++D+GH+  G+P+S  +PWG FV TWD+
Sbjct:    1 MSTHFSANQYEKSFDAKRLQNWEVPKHFKEHPSSLEGFTQIISNDRGHILEGIPRSSRSPWGEFVGTWDM 70          
BLAST of Cilia and flagella associated protein 126 vs. Ensembl Medaka
Match: cfap126 (cilia and flagella associated protein 126 [Source:NCBI gene;Acc:101174912])

HSP 1 Score: 76.6406 bits (187), Expect = 1.526e-16
Identity = 43/105 (40.95%), Postives = 61/105 (58.10%), Query Frame = 3
Query:   30 RKLKF---EMAFSFSANQYDEPFIAKRMQQYQIPHEYRERPRARTGFTRIITDDKGHMSMGVPKSKENPWGNFVNTWDLPIRPNVPGNHVDNSMGRTKRHTERLR 335
            R+LK    EM+ S+SANQY   FI+ R+Q +     ++ERP AR G T  I DD+GH+  GV +S+   W  F  TWDLP   ++P  H+ N   R++    RL+
Sbjct:   20 RRLKAVDAEMSSSYSANQYASAFISHRLQNWGETKPFKERPSARVGHTSFIADDRGHLLPGVKRSRA--WPTFKGTWDLPA--HIPAPHI-NPTARSEEGLSRLK 119          
BLAST of Cilia and flagella associated protein 126 vs. Ensembl Medaka
Match: cfap126 (cilia and flagella associated protein 126 [Source:NCBI gene;Acc:101174912])

HSP 1 Score: 74.3294 bits (181), Expect = 6.355e-16
Identity = 39/96 (40.62%), Postives = 56/96 (58.33%), Query Frame = 3
Query:   48 MAFSFSANQYDEPFIAKRMQQYQIPHEYRERPRARTGFTRIITDDKGHMSMGVPKSKENPWGNFVNTWDLPIRPNVPGNHVDNSMGRTKRHTERLR 335
            M+ S+SANQY   FI+ R+Q +     ++ERP AR G T  I DD+GH+  GV +S+   W  F  TWDLP   ++P  H+ N   R++    RL+
Sbjct:    1 MSSSYSANQYASAFISHRLQNWGETKPFKERPSARVGHTSFIADDRGHLLPGVKRSRA--WPTFKGTWDLPA--HIPAPHI-NPTARSEEGLSRLK 91          
BLAST of Cilia and flagella associated protein 126 vs. Planmine SMEST
Match: SMESG000048804.1 (SMESG000048804.1)

HSP 1 Score: 349.747 bits (896), Expect = 3.688e-124
Identity = 178/179 (99.44%), Postives = 178/179 (99.44%), Query Frame = 3
Query:   48 MAFSFSANQYDEPFIAKRMQQYQIPHEYRERPRARTGFTRIITDDKGHMSMGVPKSKENPWGNFVNTWDLPIRPNVPGNHVDNSMGRTKRHTERLRREQTEYNIQLRAAGVVPLKPWLPKEPGQLHTQIDHQDFRDRYKIDHWDCDESKDEVXXXXXXXXXXXGEVKEQKQECRELECA 584
            MAFSFSANQYDEPFIAKRMQQYQIPHEYRERPRARTGFTRIITD KGHMSMGVPKSKENPWGNFVNTWDLPIRPNVPGNHVDNSMGRTKRHTERLRREQTEYNIQLRAAGVVPLKPWLPKEPGQLHTQIDHQDFRDRYKIDHWDCDESKDEVNLNASNSNNANGEVKEQKQECRELECA
Sbjct:    1 MAFSFSANQYDEPFIAKRMQQYQIPHEYRERPRARTGFTRIITDGKGHMSMGVPKSKENPWGNFVNTWDLPIRPNVPGNHVDNSMGRTKRHTERLRREQTEYNIQLRAAGVVPLKPWLPKEPGQLHTQIDHQDFRDRYKIDHWDCDESKDEVNLNASNSNNANGEVKEQKQECRELECA 179          
The following BLAST results are available for this feature:
BLAST of Cilia and flagella associated protein 126 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CFAP1265.987e-1641.10cilia and flagella associated protein 126 [Source:... [more]
back to top
BLAST of Cilia and flagella associated protein 126 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia and flagella associated protein 126 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia and flagella associated protein 126 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cfap1268.216e-1542.47cilia and flagella associated protein 126 [Source:... [more]
cfap1268.216e-1542.47cilia and flagella associated protein 126 [Source:... [more]
back to top
BLAST of Cilia and flagella associated protein 126 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000015766.17.475e-738.46pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
back to top
BLAST of Cilia and flagella associated protein 126 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cfap1264.065e-1538.36cilia and flagella associated protein 126 [Source:... [more]
Cfap1264.272e-1538.36cilia and flagella associated protein 126 [Source:... [more]
Cfap1263.272e-1034.38cilia and flagella associated protein 126 [Source:... [more]
Cfap1263.787e-836.07cilia and flagella associated protein 126 [Source:... [more]
Cfap1269.821e-836.84cilia and flagella associated protein 126 [Source:... [more]
back to top
BLAST of Cilia and flagella associated protein 126 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A7RR34|FLTOP_NEMVE3.896e-2048.57Protein Flattop homolog OS=Nematostella vectensis ... [more]
sp|Q3KPS4|FLTOP_XENLA3.299e-1741.10Protein Flattop OS=Xenopus laevis OX=8355 GN=cfap1... [more]
sp|Q3SZT6|FLTOP_BOVIN8.859e-1742.47Protein Flattop OS=Bos taurus OX=9913 GN=CFAP126 P... [more]
sp|Q5VTH2|FLTOP_HUMAN2.875e-1541.10Protein Flattop OS=Homo sapiens OX=9606 GN=CFAP126... [more]
sp|Q6P8X9|FLTOP_MOUSE2.988e-1438.36Protein Flattop OS=Mus musculus OX=10090 GN=Cfap12... [more]
back to top
BLAST of Cilia and flagella associated protein 126 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QYT65.164e-2848.15Uncharacterized protein OS=Mizuhopecten yessoensis... [more]
K1QNJ12.262e-2646.30Uncharacterized protein OS=Crassostrea gigas OX=29... [more]
A0A1S3HR342.095e-2139.81protein Flattop homolog OS=Lingula unguis OX=7574 ... [more]
A0A2G8LKH42.856e-2146.67Uncharacterized protein OS=Stichopus japonicus OX=... [more]
A0A1I8FYT13.672e-2147.13Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Cilia and flagella associated protein 126 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cfap1261.981e-1539.58cilia and flagella associated protein 126 [Source:... [more]
cfap1262.882e-1137.93cilia and flagella associated protein 126 [Source:... [more]
back to top
BLAST of Cilia and flagella associated protein 126 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia and flagella associated protein 126 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia and flagella associated protein 126 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO460981.597e-2148.57UPF0740 protein v1g200856 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Cilia and flagella associated protein 126 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cfap1261.526e-1640.95cilia and flagella associated protein 126 [Source:... [more]
cfap1266.355e-1640.63cilia and flagella associated protein 126 [Source:... [more]
back to top
BLAST of Cilia and flagella associated protein 126 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000048804.13.688e-12499.44SMESG000048804.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020321 ID=SMED30020321|Name=Cilia and flagella associated protein 126|organism=Schmidtea mediterranea sexual|type=transcript|length=692bp
TTTCGTTGTCATAGATATCAAGGTTAGAACGAAAGCTGAAATTTGAAATG
GCATTTTCTTTTAGTGCTAATCAGTACGATGAGCCATTTATTGCAAAGCG
AATGCAACAATACCAGATACCCCATGAATATAGAGAAAGACCAAGAGCTC
GTACTGGGTTCACCAGAATTATAACCGATGACAAAGGTCACATGAGCATG
GGCGTTCCAAAATCTAAGGAAAATCCATGGGGGAATTTCGTTAATACCTG
GGACTTACCAATCCGACCAAATGTTCCCGGTAACCATGTTGACAATTCTA
TGGGTCGAACCAAAAGGCACACTGAACGGCTAAGAAGAGAACAAACGGAA
TATAACATCCAGCTGCGTGCGGCTGGCGTTGTGCCATTGAAACCTTGGCT
ACCGAAAGAACCGGGCCAATTACATACCCAGATTGACCACCAAGATTTCC
GGGATAGATACAAAATCGACCACTGGGACTGTGATGAAAGCAAAGATGAA
GTCAATCTCAATGCATCCAATTCCAACAATGCGAACGGCGAGGTTAAGGA
ACAGAAACAAGAGTGTCGGGAACTGGAGTGCGCGTAAATAAGGAACACCT
TTATAGGCAATTCGATGTTTGTTGGGACTTTACTCGTATCAAACTGTGTT
TAAATGAATAAATACTTTTGCTTTCTTCAAAAAAGATCGGAA
back to top

protein sequence of SMED30020321-orf-1

>SMED30020321-orf-1 ID=SMED30020321-orf-1|Name=SMED30020321-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=180bp
MAFSFSANQYDEPFIAKRMQQYQIPHEYRERPRARTGFTRIITDDKGHMS
MGVPKSKENPWGNFVNTWDLPIRPNVPGNHVDNSMGRTKRHTERLRREQT
EYNIQLRAAGVVPLKPWLPKEPGQLHTQIDHQDFRDRYKIDHWDCDESKD
EVNLNASNSNNANGEVKEQKQECRELECA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR038797Fltp
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0005929cilium
GO:0016020membrane
GO:0016324apical plasma membrane
GO:0036064ciliary basal body
GO:0042995cell projection
Vocabulary: biological process
TermDefinition
GO:0030030cell projection organization
GO:0044782cilium organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 159..179
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 155..174
IPR038797Protein FlattopPANTHERPTHR34639FAMILY NOT NAMEDcoord: 1..143