Glycerophosphodiester phosphodiesterase domain-containing protein 1

Overview
NameGlycerophosphodiester phosphodiesterase domain-containing protein 1
Smed IDSMED30020320
Length (bp)1197
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glycerophosphodiester phosphodiesterase domain-containing protein 1 (SMED30020320) t-SNE clustered cells

Violin plots show distribution of expression levels for Glycerophosphodiester phosphodiesterase domain-containing protein 1 (SMED30020320) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glycerophosphodiester phosphodiesterase domain-containing protein 1 (SMED30020320) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glycerophosphodiester phosphodiesterase domain-containing protein 1 (SMED30020320) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020320

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30020320h1SMcG0003595 Contig53998newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020320h1SMcG0003595 Contig53998uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Human
Match: GDPD1 (glycerophosphodiester phosphodiesterase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:20883])

HSP 1 Score: 280.411 bits (716), Expect = 7.241e-92
Identity = 154/305 (50.49%), Postives = 214/305 (70.16%), Query Frame = 2
Query:  107 IVGLLGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLN 1021
            ++  LG Y++TS +LLK P +LH+++K+ F + HISHRGGAGE LENT  AFQ AV + TDMLELDCH+  +  VV+SHD +L R TGV  +IS      LPP L  L ++F   +       ++ +  LL++VFEAFP  PINIDIK+N++ LI++V+E+V ++NREH+T+WGN ++EI  KC+K N++I  LFS +R++ IL LF+TGLLPF PI E  FEIPM  I+L+       S+S++++IW  D LLMR +L  HL  RGI  Y+WV N +Q+++ AF+ GA GVMTDYPT L  FL+
Sbjct:    9 LLSTLGGYLVTSFLLLKYPTLLHQRKKQRFLSKHISHRGGAGENLENTMAAFQHAVKIGTDMLELDCHITKDEQVVVSHDENLKRATGVNVNISDLKYCELPPYLGKLDVSF---QRACQCEGKDNRIPLLKEVFEAFPNTPINIDIKVNNNVLIKKVSELVKRYNREHLTVWGNANYEIVEKCYKENSDIPILFSLQRVLLILGLFFTGLLPFVPIREQFFEIPMPSIILKLKEPHTMSRSQKFLIWLSDLLLMRKALFDHLTARGIQVYIWVLNEEQEYKRAFDLGATGVMTDYPTKLRDFLH 310          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Human
Match: GDPD1 (glycerophosphodiester phosphodiesterase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:20883])

HSP 1 Score: 237.269 bits (604), Expect = 2.461e-75
Identity = 135/273 (49.45%), Postives = 188/273 (68.86%), Query Frame = 2
Query:  107 IVGLLGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVW 925
            ++  LG Y++TS +LLK P +LH+++K+ F + HISHRGGAGE LENT  AFQ AV + TDMLELDCH+  +  VV+SHD +L R TGV  +IS      LPP L  L ++F   +       ++ +  LL++VFEAFP  PINIDIK+N++ LI++V+E+V ++NREH+T+WGN ++EI  KC+K N++I  LFS +R++ IL LF+TGLLPF PI E  FEIPM  I+L+       S+S++++IW  D LLMR +L  HL  RGI    W
Sbjct:    9 LLSTLGGYLVTSFLLLKYPTLLHQRKKQRFLSKHISHRGGAGENLENTMAAFQHAVKIGTDMLELDCHITKDEQVVVSHDENLKRATGVNVNISDLKYCELPPYLGKLDVSF---QRACQCEGKDNRIPLLKEVFEAFPNTPINIDIKVNNNVLIKKVSELVKRYNREHLTVWGNANYEIVEKCYKENSDIPILFSLQRVLLILGLFFTGLLPFVPIREQFFEIPMPSIILKLKEPHTMSRSQKFLIWLSDLLLMRKALFDHLTARGIQVSFW 278          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Human
Match: GDPD1 (glycerophosphodiester phosphodiesterase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:20883])

HSP 1 Score: 229.18 bits (583), Expect = 2.821e-72
Identity = 131/264 (49.62%), Postives = 184/264 (69.70%), Query Frame = 2
Query:  107 IVGLLGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLH 898
            ++  LG Y++TS +LLK P +LH+++K+ F + HISHRGGAGE LENT  AFQ AV + TDMLELDCH+  +  VV+SHD +L R TGV  +IS      LPP L  L ++F   +       ++ +  LL++VFEAFP  PINIDIK+N++ LI++V+E+V ++NREH+T+WGN ++EI  KC+K N++I  LFS +R++ IL LF+TGLLPF PI E  FEIPM  I+L+       S+S++++IW  D LLMR +L   LH
Sbjct:    9 LLSTLGGYLVTSFLLLKYPTLLHQRKKQRFLSKHISHRGGAGENLENTMAAFQHAVKIGTDMLELDCHITKDEQVVVSHDENLKRATGVNVNISDLKYCELPPYLGKLDVSF---QRACQCEGKDNRIPLLKEVFEAFPNTPINIDIKVNNNVLIKKVSELVKRYNREHLTVWGNANYEIVEKCYKENSDIPILFSLQRVLLILGLFFTGLLPFVPIREQFFEIPMPSIILKLKEPHTMSRSQKFLIWLSDLLLMRKALFEPLH 269          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Human
Match: GDPD3 (glycerophosphodiester phosphodiesterase domain containing 3 [Source:HGNC Symbol;Acc:HGNC:28638])

HSP 1 Score: 177.948 bits (450), Expect = 5.029e-52
Identity = 107/302 (35.43%), Postives = 167/302 (55.30%), Query Frame = 2
Query:  122 GAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNEN 1027
            G+Y + S+  L++P +LH  R   F     +HRGG+GE LENT  A + +++  +D+LELDC L  +  VV+SHD +L R +G+  D+       LP   E L++ FSP  F   +   +R+   L+D+F+ FP  P++++IK  ++ LI+ +  +V +++R  ITIW +    +  KC   N  +   F+  R   +L+ +Y GLLPF PI E  F   +  I+    F    S   + +      L+MR SLIRHL +RG+    W  N +  F+ AF  GA GV+TDYPT L  +L+ +
Sbjct:   13 GSYAMLSIFFLRRPHLLHTPRAPTFRIRLGAHRGGSGELLENTMEAMENSMAQRSDLLELDCQLTRDRVVVVSHDENLCRQSGLNRDVGSLDFEDLPLYKEKLEVYFSPGHFAHGS---DRRMVRLEDLFQRFPRTPMSVEIKGKNEELIREIAGLVRRYDRNEITIWASEKSSVMKKCKAANPEMPLSFTISRGFWVLLSYYLGLLPFIPIPEKFFFCFLPNIINRTYFPFSCSCLNQLLAVVSKWLIMRKSLIRHLEERGVQVVFWCLNEESDFEAAFSVGATGVITDYPTALRHYLDNH 311          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Human
Match: GDPD1 (glycerophosphodiester phosphodiesterase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:20883])

HSP 1 Score: 159.844 bits (403), Expect = 1.810e-46
Identity = 93/186 (50.00%), Postives = 132/186 (70.97%), Query Frame = 2
Query:  107 IVGLLGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFK 664
            ++  LG Y++TS +LLK P +LH+++K+ F + HISHRGGAGE LENT  AFQ AV + TDMLELDCH+  +  VV+SHD +L R TGV  +IS      LPP L  L ++F   +       ++ +  LL++VFEAFP  PINIDIK+N++ LI++V+E+V ++NREH+T+WGN ++EI  KC+K
Sbjct:    9 LLSTLGGYLVTSFLLLKYPTLLHQRKKQRFLSKHISHRGGAGENLENTMAAFQHAVKIGTDMLELDCHITKDEQVVVSHDENLKRATGVNVNISDLKYCELPPYLGKLDVSF---QRACQCEGKDNRIPLLKEVFEAFPNTPINIDIKVNNNVLIKKVSELVKRYNREHLTVWGNANYEIVEKCYK 191          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Celegans
Match: T22G5.1 (pep chromosome:WBcel235:V:13876837:13877949:1 gene:WBGene00011929.1 transcript:T22G5.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T22G5.1)

HSP 1 Score: 48.521 bits (114), Expect = 4.327e-6
Identity = 27/93 (29.03%), Postives = 48/93 (51.61%), Query Frame = 2
Query:  131 ILTSLVLLKKPGILHRKRKRYFYASHI--SHRGGAGERL-ENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSV 400
            I+ +  + + P +++   K  F+ +     HRG A + + EN+  AF    S    + E+D  +  +G  VI HDS+  R+TGV  +IS  ++
Sbjct:   43 IMLAFFIFRIPQLINETHKTQFFDTWKIGGHRGSAHDNIPENSLEAFSAVKSEGGQLAEMDIQITMDGVPVICHDSNTVRVTGVDKEISAMNI 135          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Zebrafish
Match: gdpd1 (glycerophosphodiester phosphodiesterase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-040822-22])

HSP 1 Score: 270.396 bits (690), Expect = 4.209e-88
Identity = 157/317 (49.53%), Postives = 210/317 (66.25%), Query Frame = 2
Query:   77 MSLAVVMTGAIVGLLGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNEN 1027
            MS  V +   + G    Y+LTS  LLK P +LHR+++  F + HISHRGGAGE LENT  AF+ AV L TDMLELDCHL  +  VV+ HDS L R TG+ + ++  +   LPP L  L ++F  D +      E+++  LL+DVFEAFP  P+NIDIK+N+D LI++V+E+V Q+ R+ +T+WGN S+EI  KC K N  I  LFS  R++ +L LFYTGLLPF PI E   EIPM  I+ +    +  ++S+R+I W  DK+LMR SL  HL  RGI  Y+WV N ++ FQ AF+ GA GVMTDYPT L +F+ +N
Sbjct:    1 MSAVVYVLSTVTG----YVLTSAFLLKCPSLLHRRKREAFRSRHISHRGGAGENLENTMAAFKHAVKLGTDMLELDCHLTKDEQVVVLHDSSLKRSTGINAYVADVAYADLPPYLCKLGVSFKRDCYCEGG--EDKRIPLLRDVFEAFPSTPVNIDIKVNNDTLIKKVSELVIQYKRQDLTVWGNSSNEIVKKCHKENPQIPILFSLPRVLLLLGLFYTGLLPFVPIKEQFLEIPMPSIVSKLKDPQRQTRSQRFITWLADKVLMRKSLFDHLTGRGIQVYIWVLNDEEDFQRAFDLGATGVMTDYPTKLKEFMEKN 311          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Zebrafish
Match: gdpd1 (glycerophosphodiester phosphodiesterase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-040822-22])

HSP 1 Score: 270.396 bits (690), Expect = 4.209e-88
Identity = 157/317 (49.53%), Postives = 210/317 (66.25%), Query Frame = 2
Query:   77 MSLAVVMTGAIVGLLGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNEN 1027
            MS  V +   + G    Y+LTS  LLK P +LHR+++  F + HISHRGGAGE LENT  AF+ AV L TDMLELDCHL  +  VV+ HDS L R TG+ + ++  +   LPP L  L ++F  D +      E+++  LL+DVFEAFP  P+NIDIK+N+D LI++V+E+V Q+ R+ +T+WGN S+EI  KC K N  I  LFS  R++ +L LFYTGLLPF PI E   EIPM  I+ +    +  ++S+R+I W  DK+LMR SL  HL  RGI  Y+WV N ++ FQ AF+ GA GVMTDYPT L +F+ +N
Sbjct:    1 MSAVVYVLSTVTG----YVLTSAFLLKCPSLLHRRKREAFRSRHISHRGGAGENLENTMAAFKHAVKLGTDMLELDCHLTKDEQVVVLHDSSLKRSTGINAYVADVAYADLPPYLCKLGVSFKRDCYCEGG--EDKRIPLLRDVFEAFPSTPVNIDIKVNNDTLIKKVSELVIQYKRQDLTVWGNSSNEIVKKCHKENPQIPILFSLPRVLLLLGLFYTGLLPFVPIKEQFLEIPMPSIVSKLKDPQRQTRSQRFITWLADKVLMRKSLFDHLTGRGIQVYIWVLNDEEDFQRAFDLGATGVMTDYPTKLKEFMEKN 311          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Zebrafish
Match: gdpd3a (glycerophosphodiester phosphodiesterase domain containing 3a [Source:ZFIN;Acc:ZDB-GENE-040426-2279])

HSP 1 Score: 224.172 bits (570), Expect = 4.317e-70
Identity = 137/303 (45.21%), Postives = 200/303 (66.01%), Query Frame = 2
Query:  119 LGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEI---PMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFL 1018
            +G Y LTSL  L+ P ILH+ ++  F  +HISHRGG+GER+ENT  AF  AV + T+MLELDCHL  +G V++SHD +L R TG    IS  ++  LPP  ETL++TF    F   +T  +RK  LL+DVF  FP   +NI++K N+  LI++++E+V Q+NRE I++W +    I   C K+N+++  +FSQ+R +++L+L+YTGLLPF P+ ES  +    P+      PD E   S   R +I+ +++L MR +L +HL +RGI  +++VCN +Q    AF AGA GVMTDYPTLL+ ++
Sbjct:   12 VGGYALTSLYFLRNPQILHKMKQTAFRCTHISHRGGSGERIENTIEAFTHAVEVGTEMLELDCHLTKDGFVMVSHDENLLRQTGQDVSISSLNLEDLPPYKETLEVTFKTGHF---STGSDRKLALLEDVFRKFPHTAVNIEVKENNIVLIEKISELVKQYNREGISVWASVDSTIMENCRKINSSMPYMFSQKRGLQLLLLYYTGLLPFVPLGESFLQFYFPPIFNKAYIPDTEILKS---RLVIFLIERLTMRKALFKHLRERGIQIHLFVCNEEQDIDAAFAAGATGVMTDYPTLLSNYI 308          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Zebrafish
Match: gdpd3b (glycerophosphodiester phosphodiesterase domain containing 3b [Source:ZFIN;Acc:ZDB-GENE-121210-2])

HSP 1 Score: 214.927 bits (546), Expect = 1.831e-66
Identity = 128/301 (42.52%), Postives = 195/301 (64.78%), Query Frame = 2
Query:  128 YILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNENP 1030
            Y++ SL LL+ P ILH++++  FY  HISHRGG+GER+ENT  AF  AVS  TDMLE+DCHL  +G VV+SHD++L R TG    +S      LP   E L++TF    +   +T ++R+F LL++V + FP +P+ ++IK N+D LI++V+ +V ++ REHIT+W +  HE+ +KC K N ++  +F+ RR+I +L+LFYTGLLPF P+ ES     + +I+             R++++ + KL+   SL  HL  RG+   ++VCN +     AF  GA GVMTDYPT+L+ ++ ++P
Sbjct:   17 YVVCSLFLLRYPLILHKRKRLEFYCRHISHRGGSGERIENTMEAFTHAVSAGTDMLEMDCHLTLDGYVVVSHDNNLLRQTGDDKTVSSLKFQDLPLYEEKLEVTFYVGHY---STGKDRRFVLLENVLKNFPNMPMTLEIKENNDLLIKKVSNLVHKYGREHITVWASEEHEVMAKCLKQNPSMPYMFTMRRVIMLLLLFYTGLLPFVPLGESVLMFYLPRIINRTYIPEEAYMKNRFVVYLLQKLITWKSLFEHLIKRGLQVQLFVCNEETDMAAAFAMGATGVMTDYPTVLSDYIRKHP 314          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Zebrafish
Match: gdpd3b (glycerophosphodiester phosphodiesterase domain containing 3b [Source:ZFIN;Acc:ZDB-GENE-121210-2])

HSP 1 Score: 211.46 bits (537), Expect = 3.459e-65
Identity = 123/301 (40.86%), Postives = 190/301 (63.12%), Query Frame = 2
Query:  128 YILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNENP 1030
            Y++ SL LL+ P ILH++++  FY  HISHRGG+GER+ENT  AF  AVS  TDMLE+DCHL  +G VV+SHD++L R TG   D +   ++     +      +S        T ++R+F LL++V + FP +P+ ++IK N+D LI++V+ +V ++ REHIT+W +  HE+ +KC K N ++  +F+ RR+I +L+LFYTGLLPF P+ ES     + +I+             R++++ + KL+   SL  HL  RG+   ++VCN +     AF  GA GVMTDYPT+L+ ++ ++P
Sbjct:   17 YVVCSLFLLRYPLILHKRKRLEFYCRHISHRGGSGERIENTMEAFTHAVSAGTDMLEMDCHLTLDGYVVVSHDNNLLRQTG--DDKTDLPLYEEKLEVTFYVGHYS--------TGKDRRFVLLENVLKNFPNMPMTLEIKENNDLLIKKVSNLVHKYGREHITVWASEEHEVMAKCLKQNPSMPYMFTMRRVIMLLLLFYTGLLPFVPLGESVLMFYLPRIINRTYIPEEAYMKNRFVVYLLQKLITWKSLFEHLIKRGLQVQLFVCNEETDMAAAFAMGATGVMTDYPTVLSDYIRKHP 307          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Xenopus
Match: ddc (dopa decarboxylase [Source:Xenbase;Acc:XB-GENE-983285])

HSP 1 Score: 269.626 bits (688), Expect = 1.213e-87
Identity = 146/306 (47.71%), Postives = 208/306 (67.97%), Query Frame = 2
Query:  119 LGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNENPKY 1036
            LG Y+LTS++LLK P +LH+K+++ F   HISHRGGAGE LENT  AF+ AVSL TDMLELDCHL  +  VV+SHD +L R TGV  +I   +   LPP L  L +TF  D        E++   LL+DVFEAFP  PINIDIK+N++ L+++V+++V ++ REH+T+WGN  ++I  KC + N +I  LF  +R++ ++ LFYTGLLPF P+ E   EIPM  I+++       S+S ++++W  D L+MR +L  HL  RGI  Y+WV N  ++++ AF+ GA G+MTDYPT L +FL ++  +
Sbjct:   11 LGGYVLTSVLLLKFPNLLHKKKQQKFRCRHISHRGGAGENLENTMAAFRHAVSLGTDMLELDCHLTKDEQVVVSHDGNLKRSTGVNLNIPDLNYCDLPPYLCQLDVTFEKD--CCCRGGEDKSIPLLKDVFEAFPDTPINIDIKVNNNILVKKVSDLVREYKREHLTVWGNADYDIVQKCHRENCDIPLLFCFQRVLLLVGLFYTGLLPFVPLREQFLEIPMPSIIMKLKDPSKMSRSHKFVVWLADALIMRKALFDHLKARGIQVYIWVLNNDEEYKRAFDLGATGIMTDYPTRLKEFLEKHSHF 314          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Xenopus
Match: ddc (dopa decarboxylase [Source:Xenbase;Acc:XB-GENE-983285])

HSP 1 Score: 269.626 bits (688), Expect = 1.213e-87
Identity = 146/306 (47.71%), Postives = 208/306 (67.97%), Query Frame = 2
Query:  119 LGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNENPKY 1036
            LG Y+LTS++LLK P +LH+K+++ F   HISHRGGAGE LENT  AF+ AVSL TDMLELDCHL  +  VV+SHD +L R TGV  +I   +   LPP L  L +TF  D        E++   LL+DVFEAFP  PINIDIK+N++ L+++V+++V ++ REH+T+WGN  ++I  KC + N +I  LF  +R++ ++ LFYTGLLPF P+ E   EIPM  I+++       S+S ++++W  D L+MR +L  HL  RGI  Y+WV N  ++++ AF+ GA G+MTDYPT L +FL ++  +
Sbjct:   11 LGGYVLTSVLLLKFPNLLHKKKQQKFRCRHISHRGGAGENLENTMAAFRHAVSLGTDMLELDCHLTKDEQVVVSHDGNLKRSTGVNLNIPDLNYCDLPPYLCQLDVTFEKD--CCCRGGEDKSIPLLKDVFEAFPDTPINIDIKVNNNILVKKVSDLVREYKREHLTVWGNADYDIVQKCHRENCDIPLLFCFQRVLLLVGLFYTGLLPFVPLREQFLEIPMPSIIMKLKDPSKMSRSHKFVVWLADALIMRKALFDHLKARGIQVYIWVLNNDEEYKRAFDLGATGIMTDYPTRLKEFLEKHSHF 314          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Xenopus
Match: ddc (dopa decarboxylase [Source:Xenbase;Acc:XB-GENE-983285])

HSP 1 Score: 269.626 bits (688), Expect = 1.213e-87
Identity = 146/306 (47.71%), Postives = 208/306 (67.97%), Query Frame = 2
Query:  119 LGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNENPKY 1036
            LG Y+LTS++LLK P +LH+K+++ F   HISHRGGAGE LENT  AF+ AVSL TDMLELDCHL  +  VV+SHD +L R TGV  +I   +   LPP L  L +TF  D        E++   LL+DVFEAFP  PINIDIK+N++ L+++V+++V ++ REH+T+WGN  ++I  KC + N +I  LF  +R++ ++ LFYTGLLPF P+ E   EIPM  I+++       S+S ++++W  D L+MR +L  HL  RGI  Y+WV N  ++++ AF+ GA G+MTDYPT L +FL ++  +
Sbjct:   11 LGGYVLTSVLLLKFPNLLHKKKQQKFRCRHISHRGGAGENLENTMAAFRHAVSLGTDMLELDCHLTKDEQVVVSHDGNLKRSTGVNLNIPDLNYCDLPPYLCQLDVTFEKD--CCCRGGEDKSIPLLKDVFEAFPDTPINIDIKVNNNILVKKVSDLVREYKREHLTVWGNADYDIVQKCHRENCDIPLLFCFQRVLLLVGLFYTGLLPFVPLREQFLEIPMPSIIMKLKDPSKMSRSHKFVVWLADALIMRKALFDHLKARGIQVYIWVLNNDEEYKRAFDLGATGIMTDYPTRLKEFLEKHSHF 314          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Xenopus
Match: ddc (dopa decarboxylase [Source:Xenbase;Acc:XB-GENE-983285])

HSP 1 Score: 242.662 bits (618), Expect = 2.770e-77
Identity = 137/306 (44.77%), Postives = 198/306 (64.71%), Query Frame = 2
Query:  119 LGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNENPKY 1036
            LG Y+LTS++LLK P +LH+K+++ F   HISHRGG              AVSL TDMLELDCHL  +  VV+SHD +L R TGV  +I   +   LPP L  L +TF  D        E++   LL+DVFEAFP  PINIDIK+N++ L+++V+++V ++ REH+T+WGN  ++I  KC + N +I  LF  +R++ ++ LFYTGLLPF P+ E   EIPM  I+++       S+S ++++W  D L+MR +L  HL  RGI  Y+WV N  ++++ AF+ GA G+MTDYPT L +FL ++  +
Sbjct:   11 LGGYVLTSVLLLKFPNLLHKKKQQKFRCRHISHRGG-------------NAVSLGTDMLELDCHLTKDEQVVVSHDGNLKRSTGVNLNIPDLNYCDLPPYLCQLDVTFEKD--CCCRGGEDKSIPLLKDVFEAFPDTPINIDIKVNNNILVKKVSDLVREYKREHLTVWGNADYDIVQKCHRENCDIPLLFCFQRVLLLVGLFYTGLLPFVPLREQFLEIPMPSIIMKLKDPSKMSRSHKFVVWLADALIMRKALFDHLKARGIQVYIWVLNNDEEYKRAFDLGATGIMTDYPTRLKEFLEKHSHF 301          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Mouse
Match: Gdpd1 (glycerophosphodiester phosphodiesterase domain containing 1 [Source:MGI Symbol;Acc:MGI:1913819])

HSP 1 Score: 277.715 bits (709), Expect = 5.821e-91
Identity = 154/306 (50.33%), Postives = 210/306 (68.63%), Query Frame = 2
Query:  104 AIVGLLGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLN 1021
             ++  LG Y++TS +LLK P +LH+++K+ F + HISHRGGAGE LENT  AFQ AV++ TDMLELDCH+  +  VV+SHD++L R TGV  ++S      LPP L  L + F   +       ++ +  LL++VFEAFP  PINIDIK+N++ LI++V+E+V Q+ REH+T+WGN + EI  KC+K N++I  LFS +R++ IL LF+TGLLPF PI E  FEIPM  I+L+       SK  +++IW  D LLMR +L  HL  RGI  YVWV N + +++ AF+ GA GVMTDYPT L  FLN
Sbjct:    8 CLLSTLGGYLVTSFLLLKYPALLHQRKKQRFLSRHISHRGGAGENLENTMAAFQHAVTIGTDMLELDCHITKDEQVVVSHDANLKRSTGVNVNVSDLKYCELPPYLCKLDVPF---QRACKCEGKDTRIPLLKEVFEAFPETPINIDIKVNNNVLIKKVSELVKQYKREHLTVWGNANSEIVDKCYKENSDIPILFSLQRVLLILGLFFTGLLPFVPIREQFFEIPMPSIILKLKEPHTISKGHKFLIWLSDTLLMRKALFDHLTARGIQVYVWVLNEEYEYKRAFDLGATGVMTDYPTKLKDFLN 310          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Mouse
Match: Gdpd3 (glycerophosphodiester phosphodiesterase domain containing 3 [Source:MGI Symbol;Acc:MGI:1915866])

HSP 1 Score: 171.785 bits (434), Expect = 1.012e-49
Identity = 111/315 (35.24%), Postives = 170/315 (53.97%), Query Frame = 2
Query:  107 IVGLLGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNENPKYLHYPK 1051
            ++  LG+Y++ S+  L++P +LH  R   F     +HRGG+GERLENT  A + +++   D+LE DC L  +G VV+SHD +L+R +G+  D++      LP   E L++ FSP  F   +   +R    L+DVF+ FP  P+ +++K  ++ LI +V  +  +F+R  ITIW      +  +C   N  +   F+  R   IL+L+Y GLLPF  I E  F   +  I+    F        +        ++MR SLIRHL DRG+    W  N +  F+ AF  GA GVMTDYPT L  +L++  +    P+
Sbjct:    8 VLPTLGSYVMLSIFFLRRPHLLHTPRAPVFPIRLAAHRGGSGERLENTMEAVENSMAQRADLLEFDCQLTRDGVVVVSHDKNLSRQSGLNKDVNTLDFEELPLYKEELEIYFSPGHFAHGS---DRHMISLEDVFQKFPRTPMCLEVKERNEELIHKVANLTRRFDRNEITIWAAEKSSVMKRCRAANPEMPMAFTIWRSFWILLLYYLGLLPFVSIPEKFFFCFLPTIINRTYFPFRCGWMNQLSATITKWIIMRKSLIRHLQDRGVQVLFWCLNEESDFEVAFSLGANGVMTDYPTALRHYLDKQEEETQPPQ 319          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q0VGK4|GDPD1_RAT (Lysophospholipase D GDPD1 OS=Rattus norvegicus OX=10116 GN=Gdpd1 PE=2 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 6.989e-92
Identity = 156/306 (50.98%), Postives = 210/306 (68.63%), Query Frame = 2
Query:  104 AIVGLLGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLN 1021
             ++  LG Y++TS +LLK P +LH+++K+ F + HISHRGGAGE LENT  AFQ AV++ TDMLELDCH+  +  VV+SHD++L R TGV  ++S      LPP L  L + F        T   + +  LL++VFEAFP  PINIDIK+N++ LIQ+V+E+V Q+ REH+T+WGN S EI  KC+K N++I  LFS +R++ IL LF+TGLLPF PI E  FEIPM  I+L+       SK  +++IW  D LLMR +L  HL  RGI  Y+WV N + +++ AF+ GA GVMTDYPT L +FLN
Sbjct:    8 CLLSTLGGYLVTSFLLLKYPALLHQRKKQRFLSRHISHRGGAGENLENTMAAFQHAVTIGTDMLELDCHITKDEQVVVSHDANLKRSTGVNVNVSDLKYCELPPYLCKLDVPFQRACKCEGT---DTRIPLLKEVFEAFPETPINIDIKVNNNVLIQKVSELVKQYKREHLTVWGNASSEIVDKCYKENSDIPILFSLQRVLLILGLFFTGLLPFVPIREQFFEIPMPSIILKLKEPHIISKGHKFLIWLSDTLLMRKALFDHLTARGIQVYIWVLNEEHEYKRAFDLGATGVMTDYPTKLKEFLN 310          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q8N9F7|GDPD1_HUMAN (Lysophospholipase D GDPD1 OS=Homo sapiens OX=9606 GN=GDPD1 PE=1 SV=2)

HSP 1 Score: 280.411 bits (716), Expect = 3.477e-91
Identity = 154/305 (50.49%), Postives = 214/305 (70.16%), Query Frame = 2
Query:  107 IVGLLGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLN 1021
            ++  LG Y++TS +LLK P +LH+++K+ F + HISHRGGAGE LENT  AFQ AV + TDMLELDCH+  +  VV+SHD +L R TGV  +IS      LPP L  L ++F   +       ++ +  LL++VFEAFP  PINIDIK+N++ LI++V+E+V ++NREH+T+WGN ++EI  KC+K N++I  LFS +R++ IL LF+TGLLPF PI E  FEIPM  I+L+       S+S++++IW  D LLMR +L  HL  RGI  Y+WV N +Q+++ AF+ GA GVMTDYPT L  FL+
Sbjct:    9 LLSTLGGYLVTSFLLLKYPTLLHQRKKQRFLSKHISHRGGAGENLENTMAAFQHAVKIGTDMLELDCHITKDEQVVVSHDENLKRATGVNVNISDLKYCELPPYLGKLDVSF---QRACQCEGKDNRIPLLKEVFEAFPNTPINIDIKVNNNVLIKKVSELVKRYNREHLTVWGNANYEIVEKCYKENSDIPILFSLQRVLLILGLFFTGLLPFVPIREQFFEIPMPSIILKLKEPHTMSRSQKFLIWLSDLLLMRKALFDHLTARGIQVYIWVLNEEQEYKRAFDLGATGVMTDYPTKLRDFLH 310          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q9CRY7|GDPD1_MOUSE (Lysophospholipase D GDPD1 OS=Mus musculus OX=10090 GN=Gdpd1 PE=1 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 4.072e-90
Identity = 154/306 (50.33%), Postives = 210/306 (68.63%), Query Frame = 2
Query:  104 AIVGLLGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLN 1021
             ++  LG Y++TS +LLK P +LH+++K+ F + HISHRGGAGE LENT  AFQ AV++ TDMLELDCH+  +  VV+SHD++L R TGV  ++S      LPP L  L + F   +       ++ +  LL++VFEAFP  PINIDIK+N++ LI++V+E+V Q+ REH+T+WGN + EI  KC+K N++I  LFS +R++ IL LF+TGLLPF PI E  FEIPM  I+L+       SK  +++IW  D LLMR +L  HL  RGI  YVWV N + +++ AF+ GA GVMTDYPT L  FLN
Sbjct:    8 CLLSTLGGYLVTSFLLLKYPALLHQRKKQRFLSRHISHRGGAGENLENTMAAFQHAVTIGTDMLELDCHITKDEQVVVSHDANLKRSTGVNVNVSDLKYCELPPYLCKLDVPF---QRACKCEGKDTRIPLLKEVFEAFPETPINIDIKVNNNVLIKKVSELVKQYKREHLTVWGNANSEIVDKCYKENSDIPILFSLQRVLLILGLFFTGLLPFVPIREQFFEIPMPSIILKLKEPHTISKGHKFLIWLSDTLLMRKALFDHLTARGIQVYVWVLNEEYEYKRAFDLGATGVMTDYPTKLKDFLN 310          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q7L5L3|GDPD3_HUMAN (Lysophospholipase D GDPD3 OS=Homo sapiens OX=9606 GN=GDPD3 PE=2 SV=3)

HSP 1 Score: 177.948 bits (450), Expect = 2.415e-51
Identity = 107/302 (35.43%), Postives = 167/302 (55.30%), Query Frame = 2
Query:  122 GAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNEN 1027
            G+Y + S+  L++P +LH  R   F     +HRGG+GE LENT  A + +++  +D+LELDC L  +  VV+SHD +L R +G+  D+       LP   E L++ FSP  F   +   +R+   L+D+F+ FP  P++++IK  ++ LI+ +  +V +++R  ITIW +    +  KC   N  +   F+  R   +L+ +Y GLLPF PI E  F   +  I+    F    S   + +      L+MR SLIRHL +RG+    W  N +  F+ AF  GA GV+TDYPT L  +L+ +
Sbjct:   13 GSYAMLSIFFLRRPHLLHTPRAPTFRIRLGAHRGGSGELLENTMEAMENSMAQRSDLLELDCQLTRDRVVVVSHDENLCRQSGLNRDVGSLDFEDLPLYKEKLEVYFSPGHFAHGS---DRRMVRLEDLFQRFPRTPMSVEIKGKNEELIREIAGLVRRYDRNEITIWASEKSSVMKKCKAANPEMPLSFTISRGFWVLLSYYLGLLPFIPIPEKFFFCFLPNIINRTYFPFSCSCLNQLLAVVSKWLIMRKSLIRHLEERGVQVVFWCLNEESDFEAAFSVGATGVITDYPTALRHYLDNH 311          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q99LY2|GDPD3_MOUSE (Lysophospholipase D GDPD3 OS=Mus musculus OX=10090 GN=Gdpd3 PE=1 SV=2)

HSP 1 Score: 171.785 bits (434), Expect = 7.078e-49
Identity = 111/315 (35.24%), Postives = 170/315 (53.97%), Query Frame = 2
Query:  107 IVGLLGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNENPKYLHYPK 1051
            ++  LG+Y++ S+  L++P +LH  R   F     +HRGG+GERLENT  A + +++   D+LE DC L  +G VV+SHD +L+R +G+  D++      LP   E L++ FSP  F   +   +R    L+DVF+ FP  P+ +++K  ++ LI +V  +  +F+R  ITIW      +  +C   N  +   F+  R   IL+L+Y GLLPF  I E  F   +  I+    F        +        ++MR SLIRHL DRG+    W  N +  F+ AF  GA GVMTDYPT L  +L++  +    P+
Sbjct:    8 VLPTLGSYVMLSIFFLRRPHLLHTPRAPVFPIRLAAHRGGSGERLENTMEAVENSMAQRADLLEFDCQLTRDGVVVVSHDKNLSRQSGLNKDVNTLDFEELPLYKEELEIYFSPGHFAHGS---DRHMISLEDVFQKFPRTPMCLEVKERNEELIHKVANLTRRFDRNEITIWAAEKSSVMKRCRAANPEMPMAFTIWRSFWILLLYYLGLLPFVSIPEKFFFCFLPTIINRTYFPFRCGWMNQLSATITKWIIMRKSLIRHLQDRGVQVLFWCLNEESDFEVAFSLGANGVMTDYPTALRHYLDKQEEETQPPQ 319          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. TrEMBL
Match: A0A218UU81 (Glycerophosphodiester phosphodiesterase domain-containing protein 1 OS=Lonchura striata domestica OX=299123 GN=GDPD1 PE=4 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 1.331e-95
Identity = 164/308 (53.25%), Postives = 214/308 (69.48%), Query Frame = 2
Query:  107 IVGLLGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNENP 1030
            ++  LG YILTS +LLK PG+LHR +++ F   HISHRGGAGE LENT  AF  AV+L TDMLELDCHL  +  VV+SHD +L R TGV  +IS      LPP L  L +TF  +     T   + +  LLQ+VFEAFP  P+NIDIK+N+D LI++V+E+VSQ+ REH+T+WGN ++EI SKCFK N++I  +F  +R++ +L LFYTGLLPF P  E  FEIPM  I+L+       S+S+R++IW  D LLMR +L  HL  RGI  Y+WV N +Q+++ AF+ GA GVMTDYPT L +FLN  P
Sbjct:    7 VLSTLGGYILTSALLLKCPGLLHRPKRQRFRCRHISHRGGAGENLENTMAAFHHAVNLGTDMLELDCHLTKDEQVVVSHDENLKRSTGVDVNISDLKYSELPPYLCKLDVTFQKECHCEGT---DNRIPLLQEVFEAFPETPVNIDIKMNNDVLIRKVSELVSQYKREHLTVWGNVNYEIVSKCFKENSDIATIFCAQRVLLLLGLFYTGLLPFVPFKEEFFEIPMPSIILKLKEPEKMSRSQRFVIWLADTLLMRKALFDHLTARGIQVYIWVLNEEQEYKRAFDLGATGVMTDYPTKLKEFLNNYP 311          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. TrEMBL
Match: A0A401SRE6 (GP-PDE domain-containing protein OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0011387 PE=4 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 1.492e-93
Identity = 165/314 (52.55%), Postives = 214/314 (68.15%), Query Frame = 2
Query:  107 IVGLLGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNENPKYLHYP 1048
            I+  LG Y+L+S +L K PG+LH+K+K+ F + HISHRGGAGE LENT  AF+ AV L T+MLELDCH+  +G VV+SHD +L R TG+  DI+  +   LPP    L ++F  D F      E+RK  LL++V EAFP IPINIDIK+N+D LI++V+++V +FNR+ IT+WGN S  I  KC+K N NI  LFS +R++ IL LFYTGLLPFFPI E   EIPM  I+L+    +  S+  R++IW  D LLMR SL  HL  RGI  Y+WV N +Q F+ AF+ GA GVMTDYP+ L +FL       HYP
Sbjct:   46 ILSTLGGYVLSSALLFKCPGLLHKKKKQSFRSRHISHRGGAGENLENTMAAFRHAVQLGTEMLELDCHMTKDGQVVVSHDDNLKRTTGMDVDIADLTFSELPPYHCRLHVSFKKDCFCVGG--EDRKIPLLREVLEAFPKIPINIDIKVNNDALIEKVSDLVKEFNRQDITVWGNTSDNIVKKCYKTNPNIPILFSLQRVLLILGLFYTGLLPFFPIREQFLEIPMPSIMLKLKDSKKISRIYRFMIWLADTLLMRTSLFEHLKARGIQIYIWVLNDEQDFKRAFDLGATGVMTDYPSQLKKFLE------HYP 351          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. TrEMBL
Match: A0A1A8AK40 (Glycerophosphodiester phosphodiesterase domain containing 1 OS=Nothobranchius furzeri OX=105023 GN=GDPD1 PE=4 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 9.548e-92
Identity = 157/317 (49.53%), Postives = 218/317 (68.77%), Query Frame = 2
Query:   77 MSLAVVMTGAIVGLLGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNEN 1027
            M  AV +   + G    Y+LTS +LLK P +LHR+++  F + HISHRGGAGE LENT  AF+ AV L TDMLELDCHL  +  VV+SHD++L R+ GV +DIS  +   LPP L  L +TF  + F      E+++  LL+DVF+AFP  PINIDIK+N++ LI++V+E+V +++RE++T+WGN S++I  KC+K N  I  LFS  R++++L LFYTGLLPF P+ E   EIPM  I+ +       ++S+R++ W  D LLMR SL +HL  RGI  Y+WV N ++ FQ AFE GA GVMTD+PT+L +F++ N
Sbjct:    1 MCAAVYVLSTVTG----YVLTSALLLKCPNLLHRRKRETFLSRHISHRGGAGENLENTMTAFKHAVDLGTDMLELDCHLTKDEQVVVSHDTNLQRVCGVEADISSMTYAELPPYLCKLGVTFQKECFCEGG--EDKRIPLLRDVFDAFPNTPINIDIKVNNNTLIKKVSELVVKYDRENLTVWGNSSNQIVKKCYKENPQIPVLFSLPRVLQLLGLFYTGLLPFVPLKEQFLEIPMPSIITKLQDPSRLTRSQRFVAWLADTLLMRKSLFQHLTARGIQVYIWVLNDEEDFQRAFELGATGVMTDFPTMLKEFMDRN 311          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. TrEMBL
Match: A0A1A8DT58 (Glycerophosphodiester phosphodiesterase domain containing 1 OS=Nothobranchius kadleci OX=1051664 GN=GDPD1 PE=4 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 9.548e-92
Identity = 157/317 (49.53%), Postives = 218/317 (68.77%), Query Frame = 2
Query:   77 MSLAVVMTGAIVGLLGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNEN 1027
            M  AV +   + G    Y+LTS +LLK P +LHR+++  F + HISHRGGAGE LENT  AF+ AV L TDMLELDCHL  +  VV+SHD++L R+ GV +DIS  +   LPP L  L +TF  + F      E+++  LL+DVF+AFP  PINIDIK+N++ LI++V+E+V +++RE++T+WGN S++I  KC+K N  I  LFS  R++++L LFYTGLLPF P+ E   EIPM  I+ +       ++S+R++ W  D LLMR SL +HL  RGI  Y+WV N ++ FQ AFE GA GVMTD+PT+L +F++ N
Sbjct:    1 MCAAVYVLSTVTG----YVLTSALLLKCPNLLHRRKRETFLSRHISHRGGAGENLENTMTAFKHAVDLGTDMLELDCHLTKDEQVVVSHDTNLQRVCGVEADISSMTYAELPPYLCKLGVTFQKECFCEGG--EDKRIPLLRDVFDAFPNTPINIDIKVNNNTLIKKVSELVVKYDRENLTVWGNSSNQIVKKCYKENPQIPVLFSLPRVLQLLGLFYTGLLPFVPLKEQFLEIPMPSIITKLQDPSRLTRSQRFVAWLADTLLMRKSLFQHLTARGIQVYIWVLNDEEDFQRAFELGATGVMTDFPTMLKEFMDRN 311          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. TrEMBL
Match: A0A1A8RLB8 (Glycerophosphodiester phosphodiesterase domain containing 1 OS=Nothobranchius rachovii OX=451742 GN=GDPD1 PE=4 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 9.548e-92
Identity = 157/317 (49.53%), Postives = 218/317 (68.77%), Query Frame = 2
Query:   77 MSLAVVMTGAIVGLLGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNEN 1027
            M  AV +   + G    Y+LTS +LLK P +LHR+++  F + HISHRGGAGE LENT  AF+ AV L TDMLELDCHL  +  VV+SHD++L R+ GV +DIS  +   LPP L  L +TF  + F      E+++  LL+DVF+AFP  PINIDIK+N++ LI++V+E+V +++RE++T+WGN S++I  KC+K N  I  LFS  R++++L LFYTGLLPF P+ E   EIPM  I+ +       ++S+R++ W  D LLMR SL +HL  RGI  Y+WV N ++ FQ AFE GA GVMTD+PT+L +F++ N
Sbjct:    1 MCAAVYVLSTVTG----YVLTSALLLKCPNLLHRRKRETFLSRHISHRGGAGENLENTMTAFKHAVDLGTDMLELDCHLTKDEQVVVSHDTNLQRVCGVEADISSMTYAELPPYLCKLGVTFQKECFCEGG--EDKRIPLLRDVFDAFPNTPINIDIKVNNNTLIKKVSELVVKYDRENLTVWGNSSNQIVKKCYKENPQIPVLFSLPRVLQLLGLFYTGLLPFVPLKEQFLEIPMPSIITKLQDPSRLTRSQRFVAWLADTLLMRKSLFQHLTARGIQVYIWVLNDEEDFQRAFELGATGVMTDFPTMLKEFMDRN 311          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Cavefish
Match: gdpd1 (glycerophosphodiester phosphodiesterase domain containing 1 [Source:NCBI gene;Acc:103036870])

HSP 1 Score: 276.944 bits (707), Expect = 1.063e-90
Identity = 160/317 (50.47%), Postives = 211/317 (66.56%), Query Frame = 2
Query:   77 MSLAVVMTGAIVGLLGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNEN 1027
            MS AV +   + G    Y+LTS +LLK P +LHR+++  F + HISHRGGAGE LENT  AF+ AV L TDMLELDCHL  +  VV+ HDS+L R TGV ++IS  +   LPP L  L +TF  + FV     E++   LL+DVFEAFP  PINIDIK+NDD LI++V+E+V +++REH+T+WGN   ++  KC+K N  I  LFS  R++ ++ LFYTGLLPF P+ E   EIPM  I  +    R  ++ +R I W  D LLMR +L  HL  RGI  Y+WV N ++ F+ AF+ GA GVMTDYPT L +FL +N
Sbjct:    1 MSAAVYVLSTVTG----YVLTSALLLKCPSLLHRRKRETFRSKHISHRGGAGENLENTMAAFRHAVQLGTDMLELDCHLTKDEQVVVLHDSNLKRSTGVCANISDVAYADLPPYLCKLGVTFKRECFVEGG--EDKNIPLLRDVFEAFPNTPINIDIKVNDDTLIKKVSELVVKYDREHLTVWGNSRDQVVQKCYKENPQIPVLFSLPRVLILVGLFYTGLLPFIPLKEQFLEIPMPSITTKLRDPRRMTRGERIITWLADTLLMRKALFDHLTARGIQIYIWVLNDEEDFKRAFDLGATGVMTDYPTKLKEFLEKN 311          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Cavefish
Match: gdpd1 (glycerophosphodiester phosphodiesterase domain containing 1 [Source:NCBI gene;Acc:103036870])

HSP 1 Score: 255.373 bits (651), Expect = 1.650e-82
Identity = 155/317 (48.90%), Postives = 202/317 (63.72%), Query Frame = 2
Query:   77 MSLAVVMTGAIVGLLGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNEN 1027
            MS AV +   + G    Y+LTS +LLK P +LHR+++  F + HISHRGGAGE LENT  AF+ AV L TDMLELDCHL  +  VV+ HDS+L R TGV ++IS  +   LPP L  L +TF  + FV     E++   LL+DVFEAFP  PINIDIK+NDD LI++V+E+V +++REH+T+WGN   ++  KC+K N  I  LFS  R++ ++ LFYTGLLPF P+ E   EIPM  I                       LLMR +L  HL  RGI  Y+WV N ++ F+ AF+ GA GVMTDYPT L +FL +N
Sbjct:    1 MSAAVYVLSTVTG----YVLTSALLLKCPSLLHRRKRETFRSKHISHRGGAGENLENTMAAFRHAVQLGTDMLELDCHLTKDEQVVVLHDSNLKRSTGVCANISDVAYADLPPYLCKLGVTFKRECFVEGG--EDKNIPLLRDVFEAFPNTPINIDIKVNDDTLIKKVSELVVKYDREHLTVWGNSRDQVVQKCYKENPQIPVLFSLPRVLILVGLFYTGLLPFIPLKEQFLEIPMPSI--------------------TTNLLMRKALFDHLTARGIQIYIWVLNDEEDFKRAFDLGATGVMTDYPTKLKEFLEKN 291          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Cavefish
Match: gdpd3a (glycerophosphodiester phosphodiesterase domain-containing protein 3 [Source:NCBI gene;Acc:103040887])

HSP 1 Score: 214.927 bits (546), Expect = 1.192e-66
Identity = 131/300 (43.67%), Postives = 195/300 (65.00%), Query Frame = 2
Query:  119 LGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFL 1018
            LG Y LTSL LLK P ILH+K++  F  +HISHRGG+GER+E+T  AF  AV + T+MLELDCH+  +G +++SHD +L R TG    IS  +   LP   E L++TF    +   +T  +RKF LL+DVF  FP IPINI++K  +  LI++V+++V +++RE IT+W +    I  +C KVN+ +  +F++ R +++L+L+YTGLLPF P+ ES  +  + +++             + +I  ++KL +R  L +HL DRGI  +++VCN  Q  + A  AGA GVMTDYPTLL+ +L
Sbjct:   12 LGGYTLTSLYLLKNPYILHKKKQPAFRCTHISHRGGSGERIESTIEAFTHAVEVGTEMLELDCHMTRDGQLIVSHDENLLRQTGHDVSISSLNYEELPLYKERLEVTFYAGHY---STGSDRKFALLEDVFHKFPKIPINIEVKEKNRELIEKVSDLVKKYDREDITVWASVDSSIMKECRKVNSTMPYMFTEMRGLQLLLLYYTGLLPFVPLGESFLQYYLPQVINRTYIPDSAILKNKMVISLIEKLTLRKGLFQHLKDRGIQIHLFVCNEDQDIEAALAAGATGVMTDYPTLLSNYL 308          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Cavefish
Match: gdpd3b (glycerophosphodiester phosphodiesterase domain containing 3b [Source:ZFIN;Acc:ZDB-GENE-121210-2])

HSP 1 Score: 196.052 bits (497), Expect = 1.051e-59
Identity = 130/301 (43.19%), Postives = 184/301 (61.13%), Query Frame = 2
Query:  140 SLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSK----SKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNENP 1030
            SL LLK P ILH+K+K  FY+ HISHRG AGE++ENT  AF  A  + T MLELDCHL  +G V++SHD +L R TG+   IS      LP   + L++TF+    V  +T ++RK  LL+DVF+ FP +PINI++K N D LI++V  +V ++ RE IT+W      I +KC K   ++   F+  RI  +L+LFYTGLLPF P+ ES     +L+  L     +Y  +      R+++  ++ L MR SL  HL  RG+   ++VCN +     AF  GA GVM+DYP LL+++L  +P
Sbjct:    2 SLYLLKNPLILHKKKKLDFYSRHISHRG-AGEKIENTMEAFT-AEEVGTQMLELDCHLTQDGYVMVSHDKNLKRQTGLDVAISSLKRKDLPLYKDHLEVTFN----VHYSTGKDRKMALLEDVFKKFPKMPINIEVKENKDELIEKVASLVKKYKRESITVWATDDSVIMAKCKKQCPSMPYSFTMGRIFFLLVLFYTGLLPFVPLEES-----LLQFYLPSVINKYIPEESILKNRFVVSLIE-LTMRKSLFDHLVKRGMQ--LFVCNEESDMDAAFSVGATGVMSDYPALLSEYLKNHP 288          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Cavefish
Match: gdpd3b (glycerophosphodiester phosphodiesterase domain containing 3b [Source:ZFIN;Acc:ZDB-GENE-121210-2])

HSP 1 Score: 160.614 bits (405), Expect = 3.168e-46
Identity = 110/314 (35.03%), Postives = 169/314 (53.82%), Query Frame = 2
Query:   89 VVMTGAIVGLLGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNENP 1030
            +++   I+  L  +I  SL LLK P ILH+K+K  FY+ HISHRGGAGE++ENT  AF  A  + T MLELDCHL  +G V++SHD +L R TG+   IS      LP   + L++TF+   +   +T ++RK  LL+DVF+ FP +PI                         +I +  N+  E+  KC     ++   F+  RI  +L+LFYTGLLPF P+ ES  +  +  ++           +++YI    ++ +++   +  +   G+    +VCN +     AF  GA GVM+DYP LL+++L  +P
Sbjct:    4 MLVIALIILFLDLFIPCSLYLLKNPLILHKKKKLDFYSRHISHRGGAGEKIENTMEAFTHAEEVGTQMLELDCHLTQDGYVMVSHDKNLKRQTGLDVAISSLKRKDLPLYKDHLEVTFNVGHY---STGKDRKMALLEDVFKKFPKMPI-------------------------NIEVKENKD-ELIEKC----PSMPYSFTMGRIFFLLVLFYTGLLPFVPLEESLLQFYLPSVI-----------NRKYI---PEESILKNRFVSAVGQLGL----FVCNEESDMDAAFSVGATGVMSDYPALLSEYLKNHP 266          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: gdpd1 (glycerophosphodiester phosphodiesterase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-040822-22])

HSP 1 Score: 140.969 bits (354), Expect = 2.223e-40
Identity = 84/180 (46.67%), Postives = 123/180 (68.33%), Query Frame = 2
Query:  497 LQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNENPKY 1036
            L++VFEAFP   IN+DIK++DD+LI +V+E++   +RE +T+WGN S  +  KC K N ++G LFS +R++ +L+LFYTGLLPF P+ E   EIPM  ++L    E+  SK  R+++   D++LM  +L +HL  RGI  Y+WV N  +  + AF  GA GVMTD+PT L  FL ++P+Y
Sbjct:   15 LREVFEAFPDTVINVDIKVDDDKLIDKVSELIRTHSRESLTVWGNASDVVIRKCHKANPDVGILFSMKRVVVLLLLFYTGLLPFVPLSEGFLEIPMPSMVLRIADEKSTSKLYRWVLRLADRILMSKTLFKHLERRGIQVYLWVLNDDEDIERAFRLGATGVMTDFPTKLKHFLEQHPEY 194          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Yeast
Match: PGC1 (Phosphatidylglycerol phospholipase C; regulates phosphatidylglycerol (PG) accumulation via a phospholipase C-type degradation mechanism; PG levels affect mitochondrial function; contains glycerophosphodiester phosphodiesterase motifs [Source:SGD;Acc:S000006127])

HSP 1 Score: 45.4394 bits (106), Expect = 6.721e-6
Identity = 19/52 (36.54%), Postives = 31/52 (59.62%), Query Frame = 2
Query:  209 ISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRL 364
            + HR       ENT  AF++A +   D++E D  + ++G VV++HDSD  R+
Sbjct:    5 VGHRAFKARYPENTLLAFEKAYAAGADVIETDLQMTSDGMVVVNHDSDTGRM 56          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO30362 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T109])

HSP 1 Score: 211.075 bits (536), Expect = 1.513e-65
Identity = 137/308 (44.48%), Postives = 197/308 (63.96%), Query Frame = 2
Query:  107 IVGLLGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEA-GAEGVMTDYPTLLTQFLNEN 1027
            ++ L+G YI+TS+VLL  P +LHRK++  F+  HISHRGGA E LENT  A++ AV   T MLE+D  L A+  VV+ HD+DL R+ GV   +S+     LPPL+  + + F P     A    +R   LL+ V   FP +PINIDIK N D LI++ NE++ ++ REH+ +WGN + +++ +C+  N NI  LFS +R   +L+LFYTGLLPF P+ ES  EI + K +L   FE    ++ R I + VD L++RP+L +HL  RGI T++WV N   +F+ AFE     GVMTDYP+ L+++L + 
Sbjct:    9 VLSLIGGYIVTSVVLLHFPTLLHRKKEIKFHCKHISHRGGAAENLENTMTAYKHAVHTGTQMLEIDLQLTADKQVVVCHDNDLLRVAGVKQYVSELEYKDLPPLMGRIPVQFHPGVVCEAKN-NDRCIPLLETVLSEFPDMPINIDIKFNSDELIEKTNELILKYKREHLCVWGNFNADVTQRCYSHNPNIPLLFSLKRCATLLLLFYTGLLPFVPLKESFLEIMLPKTMLR-RFE--VPRTMRAICYIVDWLMIRPTLFQHLAKRGIQTFLWVLNEDDEFELAFEKLKVAGVMTDYPSKLSEYLEKQ 312          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO29567 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T398])

HSP 1 Score: 162.54 bits (410), Expect = 1.853e-47
Identity = 111/270 (41.11%), Postives = 161/270 (59.63%), Query Frame = 2
Query:  224 GAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLE-PDFERY-FSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEA-GAEGVMTDYPTLLTQFLNE 1024
            GA E LENT  A++ AV   T MLE+D  L A+  VV+ HD+DL R+ GV   +S+      P               V      +R   LL+ V   FP +PINIDIK N D LI++ NE++ ++ REH+ +WGN + +++ +C+  N NI  LFS +R   +L+LFYTGLLPF P+ ES  EI + K +L   + ER+   ++ R I + VD L++RP+L +HL  RGI T++WV N   +F+ AFE     GVMTDYP+ L+++L +
Sbjct:    1 GAAENLENTMTAYKHAVHTGTQMLEIDLQLTADKQVVVCHDNDLLRVAGVKQYVSELEYKVCPC-------------VVCEAKNNDRCIPLLETVLSEFPDMPINIDIKFNSDELIEKTNELILKYKREHLCVWGNFNADVTQRCYNHNPNIPLLFSLKRCATLLLLFYTGLLPFVPLKESFLEIMLPKTMLRYSNIERFEVPRTMRAICYIVDWLMIRPTLFQHLAKRGIQTFLWVLNEDDEFELAFEKLKVAGVMTDYPSKLSEYLEK 257          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO30363 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T110])

HSP 1 Score: 156.762 bits (395), Expect = 3.586e-45
Identity = 107/253 (42.29%), Postives = 152/253 (60.08%), Query Frame = 2
Query:  284 TDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSK--RYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEA-GAEGVMTDYPTLLTQFLNENPK 1033
            T+ML++D  + A+G VV+ HD+DLTRLTGV   +S+     LPPLL+ L++   P  FV A   +  +  LL  VF  F  IPI I +K + D LI++ NE++ +F R+  TIWG+ S +IS+KC K N  I   FS      ++IL Y+G+LPF  + ES   +   K++L     R F  S+  +   +  D LL+ P LIRHL  RGI TY+WV N + +F  AFE  GA GVMTDYPT L+ ++ ++ K
Sbjct:   29 TEMLQIDVRMTADGQVVVCHDNDLTRLTGVNQKLSELKYEELPPLLDKLEVFHDPGVFVEARR-KSNEIPLLSTVFTQFHKIPICIQVKEDSDELIEKTNELIVRFKRKDYTIWGSASAKISNKCHKQNAAIPLYFSVAHCFGLIILLYSGMLPFVKLKESFLLVAFPKVML-----RRFPSSRIMKVFTYAADWLLLSPILIRHLRKRGIQTYIWVLNKKDEFTLAFEKLGAAGVMTDYPTELSDYVEQSVK 275          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO29566 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T397])

HSP 1 Score: 75.0998 bits (183), Expect = 7.275e-17
Identity = 43/102 (42.16%), Postives = 60/102 (58.82%), Query Frame = 2
Query:  737 LLPFFPIYESHFEIPMLKILLEPDFERYFSKSK--RYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEA-GAEGVMTDYPTLLTQFLNENPK 1033
            +LPF  + ES   +   K++L     R F  S+  +   +  D LL+ P LIRHL  RGI TY+WV N + +F  AFE  GA GVMTDYPT L+ ++ ++ K
Sbjct:    1 MLPFVKLKESFLLVAFPKVML-----RRFPSSRIMKVFTYAADWLLLSPILIRHLRKRGIQTYIWVLNKKDEFTLAFEKLGAAGVMTDYPTELSDYVEQSVK 97          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Medaka
Match: gdpd1 (glycerophosphodiester phosphodiesterase domain containing 1 [Source:NCBI gene;Acc:101174208])

HSP 1 Score: 283.108 bits (723), Expect = 3.415e-92
Identity = 154/317 (48.58%), Postives = 215/317 (67.82%), Query Frame = 2
Query:   77 MSLAVVMTGAIVGLLGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNEN 1027
            M  AV +   + G    Y+LTS +LLK P +LHRK+   F   HISHRGGAGE LENT  AF+ AV++ TDMLELDCHL  +  VV+SHDS+L R+ GV ++I+  +   LPP L  L +TF  D        E+++  LL+D+F+AFP  P+N+DIK+N+D+LIQ+V+E++ ++NR+H+T+WGN S+++  KC+K N  I  LFS  R++++L LFY+GLLPF PI E   EIPM  I+ +       + S+R+IIW  D LLMR +L +HL  RGI  Y+WV N ++ FQ AF+ GA GVMTD+PT L  F++ N
Sbjct:   68 MCAAVYVLSTVTG----YVLTSALLLKCPTLLHRKKHGTFLCKHISHRGGAGENLENTMAAFRHAVNVGTDMLELDCHLTRDEQVVVSHDSNLQRVCGVNAEIANVAYAELPPYLCKLGVTFQKDCVCEGG--EDKRIPLLRDIFDAFPNTPVNVDIKVNNDKLIQKVSELIVKYNRQHLTVWGNSSNQVVKKCYKENPQIPVLFSLPRVLQLLALFYSGLLPFVPIKEQFLEIPMPSIITKLKGPNSLTGSQRFIIWLADTLLMRKALFQHLTARGIQVYIWVLNDEEDFQRAFDLGATGVMTDFPTKLKDFMDRN 378          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Medaka
Match: gdpd1 (glycerophosphodiester phosphodiesterase domain containing 1 [Source:NCBI gene;Acc:101174208])

HSP 1 Score: 259.225 bits (661), Expect = 5.199e-84
Identity = 148/317 (46.69%), Postives = 205/317 (64.67%), Query Frame = 2
Query:   77 MSLAVVMTGAIVGLLGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNEN 1027
            M  AV +   + G    Y+LTS +LLK P +LHRK+   F   HISHRGGAGE LENT  AF+ AV++ TDMLELDCHL  +  VV+SHDS+L R+ GV ++I+  +   LPP L  L +TF  D        E+++  LL+D+F+AFP  P+N+DIK+N+D+LIQ+V+E++ ++NR+H+T+WGN S+++  KC+K N  I  LFS  R++++L LFY+GLLPF PI E   EIPM  I                    +  LLMR +L +HL  RGI  Y+WV N ++ FQ AF+ GA GVMTD+PT L  F++ N
Sbjct:    1 MCAAVYVLSTVTG----YVLTSALLLKCPTLLHRKKHGTFLCKHISHRGGAGENLENTMAAFRHAVNVGTDMLELDCHLTRDEQVVVSHDSNLQRVCGVNAEIANVAYAELPPYLCKLGVTFQKDCVCEGG--EDKRIPLLRDIFDAFPNTPVNVDIKVNNDKLIQKVSELIVKYNRQHLTVWGNSSNQVVKKCYKENPQIPVLFSLPRVLQLLALFYSGLLPFVPIKEQFLEIPMPSI--------------------ITNLLMRKALFQHLTARGIQVYIWVLNDEEDFQRAFDLGATGVMTDFPTKLKDFMDRN 291          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Medaka
Match: gdpd3a (glycerophosphodiester phosphodiesterase domain containing 3a [Source:ZFIN;Acc:ZDB-GENE-040426-2279])

HSP 1 Score: 205.682 bits (522), Expect = 6.694e-63
Identity = 129/303 (42.57%), Postives = 195/303 (64.36%), Query Frame = 2
Query:  107 IVGLLGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQF 1015
            ++ + G Y LTSL LLK P ILH+K++  FY  HISHRGG GER+E+T  AF+ AV   T+MLE+DCHL  +  VV+SHD +L R TG   +IS   +  LP   E +++ F   ++   +T  +RK  LL+DVF  FP +P++I+IK N+ RL+Q+V+++V  +NRE IT+W +  + I ++C + N ++   FS  R + +L+LFYTGLLPF P+ ES  +  + +I+    F      +K   +  ++K+ MR SL +HL  RGI  +++VCN ++  + A E GA GVMTDYP+LL+ +
Sbjct:   18 LLPVFGGYTLTSLYLLKNPHILHKKKRTAFYCMHISHRGGCGERIESTMEAFENAVKHGTEMLEMDCHLTRDEYVVVSHDENLLRQTGQDVNISSLDLQDLPLYKERMEVLFYEGRY---STGADRKIALLEDVFRKFPELPVSIEIKENNKRLMQKVSDLVRSYNREGITVWASVDNTIMTECRRTNGSMPYSFSMTRGMLLLLLFYTGLLPFVPLGESLLQFYLPRIMNRTYFPGGILANK-LAVSLLEKVTMRRSLFQHLAARGIQVHLFVCNEEEDIKAAMEVGATGVMTDYPSLLSTY 316          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Medaka
Match: gdpd3a (glycerophosphodiester phosphodiesterase domain containing 3a [Source:ZFIN;Acc:ZDB-GENE-040426-2279])

HSP 1 Score: 159.844 bits (403), Expect = 6.877e-46
Identity = 116/304 (38.16%), Postives = 168/304 (55.26%), Query Frame = 2
Query:  107 IVGLLGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGGAGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVPSDISKFSVHXXXXXXXXXXXXFSPDKFVSATTPEERKFTLLQDVFEAFPGXXXXXXXXXXXXXXXQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLL-MRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQF 1015
            ++ + G Y LTSL LLK P ILH+K++  FY  HISHRGG GER+E+T  AF+ AV   T+MLE+DCHL  +  VV+SHD +L R TG   +IS   +  LP   E +++ F   ++   +T  +RK  LL+DVF  FP +P++                         I I  N     + +  + N ++   FS  R + +L+LFYTGLLPF P+ ES  +  + +I+     E      K  + W    +L MR SL +HL  RGI  +++VCN ++  + A E GA GVMTDYP+LL+ +
Sbjct:    7 LLPVFGGYTLTSLYLLKNPHILHKKKRTAFYCMHISHRGGCGERIESTMEAFENAVKHGTEMLEMDCHLTRDEYVVVSHDENLLRQTGQDVNISSLDLQDLPLYKERMEVLFYEGRY---STGADRKIALLEDVFRKFPELPVS-------------------------IEIKEN-----NKRLMQKNGSMPYSFSMTRGMLLLLLFYTGLLPFVPLGESLLQFYLPRIMNRCVCEHLSLDIK--MEWNGTSILTMRRSLFQHLAARGIQVHLFVCNEEEDIKAAMEVGATGVMTDYPSLLSTY 275          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000031141.1 (SMESG000031141.1)

HSP 1 Score: 360.147 bits (923), Expect = 9.800e-126
Identity = 170/170 (100.00%), Postives = 170/170 (100.00%), Query Frame = 2
Query:  587 MVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNENPKYLHYPKENDMLISNRGDLPPP 1096
            MVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNENPKYLHYPKENDMLISNRGDLPPP
Sbjct:    1 MVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNENPKYLHYPKENDMLISNRGDLPPP 170          
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000044810.1 (SMESG000044810.1)

HSP 1 Score: 356.295 bits (913), Expect = 3.378e-124
Identity = 168/170 (98.82%), Postives = 169/170 (99.41%), Query Frame = 2
Query:  587 MVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDYPTLLTQFLNENPKYLHYPKENDMLISNRGDLPPP 1096
            MVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTD+PTLL QFLNENPKYLHYPKENDMLISNRGDLPPP
Sbjct:    1 MVSQFNREHITIWGNRSHEISSKCFKVNNNIGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFSKSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAEGVMTDFPTLLRQFLNENPKYLHYPKENDMLISNRGDLPPP 170          
The following BLAST results are available for this feature:
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GDPD17.241e-9250.49glycerophosphodiester phosphodiesterase domain con... [more]
GDPD12.461e-7549.45glycerophosphodiester phosphodiesterase domain con... [more]
GDPD12.821e-7249.62glycerophosphodiester phosphodiesterase domain con... [more]
GDPD35.029e-5235.43glycerophosphodiester phosphodiesterase domain con... [more]
GDPD11.810e-4650.00glycerophosphodiester phosphodiesterase domain con... [more]
back to top
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
T22G5.14.327e-629.03pep chromosome:WBcel235:V:13876837:13877949:1 gene... [more]
back to top
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gdpd14.209e-8849.53glycerophosphodiester phosphodiesterase domain con... [more]
gdpd14.209e-8849.53glycerophosphodiester phosphodiesterase domain con... [more]
gdpd3a4.317e-7045.21glycerophosphodiester phosphodiesterase domain con... [more]
gdpd3b1.831e-6642.52glycerophosphodiester phosphodiesterase domain con... [more]
gdpd3b3.459e-6540.86glycerophosphodiester phosphodiesterase domain con... [more]
back to top
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ddc1.213e-8747.71dopa decarboxylase [Source:Xenbase;Acc:XB-GENE-983... [more]
ddc1.213e-8747.71dopa decarboxylase [Source:Xenbase;Acc:XB-GENE-983... [more]
ddc1.213e-8747.71dopa decarboxylase [Source:Xenbase;Acc:XB-GENE-983... [more]
ddc2.770e-7744.77dopa decarboxylase [Source:Xenbase;Acc:XB-GENE-983... [more]
back to top
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Gdpd15.821e-9150.33glycerophosphodiester phosphodiesterase domain con... [more]
Gdpd31.012e-4935.24glycerophosphodiester phosphodiesterase domain con... [more]
back to top
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0VGK4|GDPD1_RAT6.989e-9250.98Lysophospholipase D GDPD1 OS=Rattus norvegicus OX=... [more]
sp|Q8N9F7|GDPD1_HUMAN3.477e-9150.49Lysophospholipase D GDPD1 OS=Homo sapiens OX=9606 ... [more]
sp|Q9CRY7|GDPD1_MOUSE4.072e-9050.33Lysophospholipase D GDPD1 OS=Mus musculus OX=10090... [more]
sp|Q7L5L3|GDPD3_HUMAN2.415e-5135.43Lysophospholipase D GDPD3 OS=Homo sapiens OX=9606 ... [more]
sp|Q99LY2|GDPD3_MOUSE7.078e-4935.24Lysophospholipase D GDPD3 OS=Mus musculus OX=10090... [more]
back to top
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A218UU811.331e-9553.25Glycerophosphodiester phosphodiesterase domain-con... [more]
A0A401SRE61.492e-9352.55GP-PDE domain-containing protein OS=Chiloscyllium ... [more]
A0A1A8AK409.548e-9249.53Glycerophosphodiester phosphodiesterase domain con... [more]
A0A1A8DT589.548e-9249.53Glycerophosphodiester phosphodiesterase domain con... [more]
A0A1A8RLB89.548e-9249.53Glycerophosphodiester phosphodiesterase domain con... [more]
back to top
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gdpd11.063e-9050.47glycerophosphodiester phosphodiesterase domain con... [more]
gdpd11.650e-8248.90glycerophosphodiester phosphodiesterase domain con... [more]
gdpd3a1.192e-6643.67glycerophosphodiester phosphodiesterase domain-con... [more]
gdpd3b1.051e-5943.19glycerophosphodiester phosphodiesterase domain con... [more]
gdpd3b3.168e-4635.03glycerophosphodiester phosphodiesterase domain con... [more]
back to top
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gdpd12.223e-4046.67glycerophosphodiester phosphodiesterase domain con... [more]
back to top
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PGC16.721e-636.54Phosphatidylglycerol phospholipase C; regulates ph... [more]
back to top
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO303621.513e-6544.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO295671.853e-4741.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303633.586e-4542.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO295667.275e-1742.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gdpd13.415e-9248.58glycerophosphodiester phosphodiesterase domain con... [more]
gdpd15.199e-8446.69glycerophosphodiester phosphodiesterase domain con... [more]
gdpd3a6.694e-6342.57glycerophosphodiester phosphodiesterase domain con... [more]
gdpd3a6.877e-4638.16glycerophosphodiester phosphodiesterase domain con... [more]
back to top
BLAST of Glycerophosphodiester phosphodiesterase domain-containing protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000031141.19.800e-126100.00SMESG000031141.1[more]
SMESG000044810.13.378e-12498.82SMESG000044810.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020320 ID=SMED30020320|Name=Glycerophosphodiester phosphodiesterase domain-containing protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1197bp
TTGTAACATCAAATTTGGTTATTTTTTGATAATTTTGGTTAATATTTTAA
ATATATAAAATGAACTTTATACCATTATGAGTCTCGCCGTGGTTATGACT
GGGGCAATCGTTGGGTTACTCGGAGCATATATTTTAACATCATTAGTGCT
ATTAAAAAAGCCAGGAATTCTCCACAGAAAACGAAAACGATATTTTTACG
CATCTCATATTAGTCATCGAGGAGGAGCTGGCGAAAGACTTGAAAACACT
TTTCCAGCTTTTCAACGAGCAGTAAGCTTATCTACTGATATGCTAGAACT
TGATTGTCATTTATTGGCAAACGGTGACGTTGTTATCAGTCATGATTCTG
ACCTTACTCGATTGACAGGCGTGCCATCTGACATATCCAAATTTTCTGTT
CATACTCTACCTCCTCTTCTAGAAACATTGCAATTGACATTTTCACCCGA
CAAATTTGTGTCAGCAACTACTCCCGAAGAACGAAAATTTACTCTGCTAC
AAGATGTGTTCGAAGCTTTTCCCGGTATTCCTATCAATATCGATATTAAA
ATTAATGACGACAGACTCATTCAAAGGGTAAATGAAATGGTTTCTCAATT
CAATCGGGAACACATCACGATATGGGGAAATCGAAGCCATGAAATAAGTA
GCAAGTGCTTCAAAGTAAATAACAATATCGGGGCGTTGTTTTCTCAAAGA
CGAATTATTGAGATCTTAATATTATTTTATACCGGCCTTCTTCCATTTTT
TCCGATTTATGAATCACATTTTGAAATACCAATGTTAAAAATATTATTAG
AACCAGATTTTGAACGATATTTTTCGAAATCTAAAAGATATATTATTTGG
TTTGTTGACAAATTGTTAATGAGACCATCGCTAATAAGACATTTGCACGA
TCGTGGAATTCCAACTTACGTGTGGGTTTGTAATACTCAGCAGCAGTTCC
AAGATGCGTTTGAAGCAGGAGCTGAAGGTGTCATGACAGATTATCCTACT
TTATTAACGCAATTCCTCAATGAAAATCCAAAATATTTACATTATCCAAA
AGAAAATGATATGCTCATATCAAACCGTGGAGATCTGCCTCCCCCTTGAG
GAATTTTATCAGTTTTTAGGAATATTTAAGTTTAAATGCAAAAAATAAAT
TTTTAAAAAATTTATTTTTTATTTAATTTGCAATTTTACTTTTTGTG
back to top

protein sequence of SMED30020320-orf-1

>SMED30020320-orf-1 ID=SMED30020320-orf-1|Name=SMED30020320-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=341bp
MSLAVVMTGAIVGLLGAYILTSLVLLKKPGILHRKRKRYFYASHISHRGG
AGERLENTFPAFQRAVSLSTDMLELDCHLLANGDVVISHDSDLTRLTGVP
SDISKFSVHTLPPLLETLQLTFSPDKFVSATTPEERKFTLLQDVFEAFPG
IPINIDIKINDDRLIQRVNEMVSQFNREHITIWGNRSHEISSKCFKVNNN
IGALFSQRRIIEILILFYTGLLPFFPIYESHFEIPMLKILLEPDFERYFS
KSKRYIIWFVDKLLMRPSLIRHLHDRGIPTYVWVCNTQQQFQDAFEAGAE
GVMTDYPTLLTQFLNENPKYLHYPKENDMLISNRGDLPPP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004622lysophospholipase activity
GO:0008081phosphoric diester hydrolase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006644phospholipid metabolic process
GO:0070291N-acylethanolamine metabolic process
GO:0006629lipid metabolic process
Vocabulary: cellular component
TermDefinition
GO:0048471perinuclear region of cytoplasm
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR017946PLC-like_Pdiesterase_TIM-brl
IPR030395GP_PDE_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR030395Glycerophosphodiester phosphodiesterase domainPFAMPF03009GDPDcoord: 47..308
e-value: 1.2E-25
score: 90.8
IPR030395Glycerophosphodiester phosphodiesterase domainPROSITEPS51704GP_PDEcoord: 42..314
score: 33.932
IPR017946PLC-like phosphodiesterase, TIM beta/alpha-barrel domain superfamilyGENE3DG3DSA:3.20.20.190coord: 42..235
e-value: 2.2E-29
score: 105.0
IPR017946PLC-like phosphodiesterase, TIM beta/alpha-barrel domain superfamilyGENE3DG3DSA:3.20.20.190coord: 244..319
e-value: 1.2E-8
score: 37.2
IPR017946PLC-like phosphodiesterase, TIM beta/alpha-barrel domain superfamilySUPERFAMILYSSF51695PLC-like phosphodiesterasescoord: 44..315
NoneNo IPR availablePANTHERPTHR42758FAMILY NOT NAMEDcoord: 13..317
NoneNo IPR availablePANTHERPTHR42758:SF1LYSOPHOSPHOLIPASE D GDPD1coord: 13..317
NoneNo IPR availableCDDcd08612GDPD_GDE4coord: 16..316
e-value: 5.71846E-142
score: 401.593
NoneNo IPR availableTMHMMTMhelixcoord: 210..232
NoneNo IPR availableTMHMMTMhelixcoord: 4..26