WD repeat-containing protein 49

Overview
NameWD repeat-containing protein 49
Smed IDSMED30020318
Length (bp)3978
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020318

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30020318h1SMcG0015878 SmedASXL_015119SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30020318h1SMcG0015878 dd_Smed_v4_13248_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30020318h1SMcG0015878 dd_Smed_v4_13248_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30020318h1SMcG0015878 dd_Smed_v4_13248_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020318h1SMcG0015878 dd_Smed_v4_13248_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020318h1SMcG0015878 dd_Smed_v4_13248_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30020318h1SMcG0015878 dd_Smed_v4_13248_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30020318h1SMcG0015878 dd_Smed_v4_13248_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30020318h1SMcG0015878 dd_Smed_v6_13248_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30020318h1SMcG0015878 dd_Smed_v4_13248_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD repeat-containing protein 49 vs. Ensembl Human
Match: WDR49 (WD repeat domain 49 [Source:HGNC Symbol;Acc:HGNC:26587])

HSP 1 Score: 714.916 bits (1844), Expect = 0.000e+0
Identity = 412/1080 (38.15%), Postives = 606/1080 (56.11%), Query Frame = 3
Query:  132 LELKLNIKDLETLQEAFFMDGSHNRSQHFNGEEFVEALSLVLCKGTREEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTXXXXXXXXXXXXXKTCTYFSHKAHQ-DWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKL-RLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANAELKRAASNSIQQETDDKLDFIKAEIQNSIANRQXXXXXXXXXXXXXXXXXXXXDTVSDMQVQYKKMDVMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEGWLIGEFVAHENASNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKLGSXXXXXXXXXXXXHEDEVVKQEEDKYKVDPNWYPDPEAIQNP-----SGYRINTWKDTNLGKDYQELRVRKRERIQPSSIPDLPYLYGEKIGRPTFGPFYSLNISSFEEIEDIEQPEFMEYPEKFF-NETEEFLTKTARVPLLNETLKAVFDERSLLPEYILEFEHKFRNRFQRHLSEAK 3347
            LE +L++ D   +Q+AF       +    + E+F + ++ ++  GT+EEY +LFDK+D+ ++G+++W+K  S +LLE YE+D+R K++ +PQWK+L+ L   HKD IQ+++ ++N + YLTISKEG + +WG   KLQ+     +++ + + LWVT    L NVNK+AV+FTSKE+ FYD+  K EF CQ KL+ L   PICMDYW+ P +  E+I+++GD  G +  I ++    SLFER +S   D  E T+ I+  +++ G  K C    HK HQ DWVR+V+Y  +L+  +S  T+   S+V+ W EK                S+     + F + QGI++F Y+  LNLIATAG+N +VCLWNPYV+SKP G+L GH ASV  VQF   R  L SFSKDK+LR+WD+Q Q+ IQR A  FPK Q+          +  +F+ +E   RLFI+FN  L +L MK +   ++ SHEK +   LYNS+  QV+++  G  +  WM+DTGQ++K  T  C   AE++ +  D+ +TRL TG+TDG VKIWDFNG+C++TL V     VDISQI+ILK+ +LV G+ ++IT F   +F    + P  WKG   H DDIL  A +PP  + TGSYDGEI++WN ++E A   +    Q  +K       Q + +    + +   +    T  +   I  E +N++                                            RL +L++RK     GGANL+SCGG+G VRFW+  +  L+ EF+AH    +IIM+TD  N+YL TGD+DG++++W+I  YC   S+N KI   PTLI  +Q H D IS +  C    + LII+SSAD S  +  +    +  FGQ   W + + +  P        E E+ K+     K +    P   ++ N      S Y +   +D NL   Y+E     +E  +P         YGE I + +F  F SLNI + EE+ ++ +P F+  PEK+F  E EE   +    P L +TLKAVFDE++L P+ IL  E K +   Q    E K
Sbjct:   38 LENQLSVGDFVKIQKAF-ESPQPRKIICMSREDFTQKMTEIVGWGTKEEYGELFDKVDVAQDGFINWDKLTSFILLELYEQDERAKATVVPQWKDLEFLPVKHKDTIQKVIFLKNSSHYLTISKEGLLAIWGEHLKLQETFPITSDATKLKHLWVTSLVSLENVNKIAVAFTSKEVCFYDLLSKEEFACQYKLQGLKGTPICMDYWYDPLDANESILSFGDITGKVQAIAFTAALISLFERPASACED-GEATMTINWAELLSGCHKCCHILEHKLHQGDWVRQVTYNASLDAIISSTTSNTNSVVMAWREK----------------SKKRLNMTSFNIAQGIHAFDYHSRLNLIATAGINNKVCLWNPYVVSKPVGVLWGHSASVIAVQFFVERKQLFSFSKDKVLRLWDIQHQLSIQRIACSFPKSQD----------FRCLFHFDEAHGRLFISFNNQLALLAMKSEASKRVKSHEKAVTCVLYNSILKQVISSDTGSTVSFWMIDTGQKIKQFTG-CHGNAEISTMALDANETRLLTGSTDGTVKIWDFNGYCHHTLNVGQDGAVDISQILILKKKILVTGWERAITVFRPQNFNQFFIQPEEWKGGIQHHDDILCAAFLPPQTLVTGSYDGEIVLWNNSTENAHHVLHPDYQRLLKSKLDTKPQKLLSAGRSQPSHPMADHSTTGVRNFEIDTEGKNAVM-------------------------------------------RLCFLKARKNTAVTGGANLVSCGGSGYVRFWDIYKKQLLAEFLAHSGVGSIIMSTDKMNRYLTTGDLDGWLKIWNIEEYCLNSSKN-KITKAPTLIRSFQPHEDRISSLEMCEPGGQLLIISSSADCSICVTGVCNAPVWIFGQAKHWHIENCLFLPKRDTNLV-ESEIQKEISLFSKEESCLDPTEHSLLNKKNKDDSTYNVRPSEDINLDIKYKERSTCMKETQKP--------YYGEVI-KKSFSTFRSLNIGALEELPEVNKPAFLLDPEKYFRKEPEEERPQILEAPSLFKTLKAVFDEKNLFPKEILHHERKAKQLCQEKSCEVK 1034          
BLAST of WD repeat-containing protein 49 vs. Ensembl Human
Match: WDR49 (WD repeat domain 49 [Source:HGNC Symbol;Acc:HGNC:26587])

HSP 1 Score: 479.945 bits (1234), Expect = 4.111e-153
Identity = 286/758 (37.73%), Postives = 408/758 (53.83%), Query Frame = 3
Query: 1095 MAGIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKL-RLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANAELKRAASNSIQQETDDKLDFIKAEIQNSIANRQXXXXXXXXXXXXXXXXXXXXDTVSDMQVQYKKMDVMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEGWLIGEFVAHENASNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKLGSXXXXXXXXXXXXHEDEVVKQEEDKYKVDPNWYPDPEAIQNP-----SGYRINTWKDTNLGKDYQELRVRKRERIQPSSIPDLPYLYGEKIGRPTFGPFYSLNISSFEEIEDIEQPEFMEYPEKFF-NETEEFLTKTARVPLLNETLKAVFDERSLLPEYILEFEHKFRNRFQRHLSEAK 3347
            MA   +S+     + F + QGI++F Y+  LNLIATAG+N +VCLWNPYV+SKP G+L GH ASV  VQF   R  L SFSKDK+LR+WD+Q Q+ IQR A  FPK Q+          +  +F+ +E   RLFI+FN  L +L MK +   ++ SHEK +   LYNS+  QV+++  G  +  WM+DTGQ++K  T  C   AE++ +  D+ +TRL TG+TDG VKIWDFNG+C++TL V     VDISQI+ILK+ +LV G+ ++IT F   +F    + P  WKG   H DDIL  A +PP  + TGSYDGEI++WN ++E A   +    Q  +K       Q + +    + +   +    T  +   I  E +N++                                            RL +L++RK     GGANL+SCGG+G VRFW+  +  L+ EF+AH    +IIM+TD  N+YL TGD+DG++++W+I  YC   S+N KI   PTLI  +Q H D IS +  C    + LII+SSAD S  +  +    +  FGQ   W + + +  P        E E+ K+     K +    P   ++ N      S Y +   +D NL   Y+E     +E  +P         YGE I + +F  F SLNI + EE+ ++ +P F+  PEK+F  E EE   +    P L +TLKAVFDE++L P+ IL  E K +   Q    E K
Sbjct:    1 MAWREKSKKRLNMTSFNIAQGIHAFDYHSRLNLIATAGINNKVCLWNPYVVSKPVGVLWGHSASVIAVQFFVERKQLFSFSKDKVLRLWDIQHQLSIQRIACSFPKSQD----------FRCLFHFDEAHGRLFISFNNQLALLAMKSEASKRVKSHEKAVTCVLYNSILKQVISSDTGSTVSFWMIDTGQKIKQFTG-CHGNAEISTMALDANETRLLTGSTDGTVKIWDFNGYCHHTLNVGQDGAVDISQILILKKKILVTGWERAITVFRPQNFNQFFIQPEEWKGGIQHHDDILCAAFLPPQTLVTGSYDGEIVLWNNSTENAHHVLHPDYQRLLKSKLDTKPQKLLSAGRSQPSHPMADHSTTGVRNFEIDTEGKNAVM-------------------------------------------RLCFLKARKNTAVTGGANLVSCGGSGYVRFWDIYKKQLLAEFLAHSGVGSIIMSTDKMNRYLTTGDLDGWLKIWNIEEYCLNSSKN-KITKAPTLIRSFQPHEDRISSLEMCEPGGQLLIISSSADCSICVTGVCNAPVWIFGQAKHWHIENCLFLPKRDTNLV-ESEIQKEISLFSKEESCLDPTEHSLLNKKNKDDSTYNVRPSEDINLDIKYKERSTCMKETQKP--------YYGEVI-KKSFSTFRSLNIGALEELPEVNKPAFLLDPEKYFRKEPEEERPQILEAPSLFKTLKAVFDEKNLFPKEILHHERKAKQLCQEKSCEVK 693          
BLAST of WD repeat-containing protein 49 vs. Ensembl Human
Match: WDR49 (WD repeat domain 49 [Source:HGNC Symbol;Acc:HGNC:26587])

HSP 1 Score: 468.003 bits (1203), Expect = 5.068e-148
Identity = 263/670 (39.25%), Postives = 376/670 (56.12%), Query Frame = 3
Query:  630 VAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTXXXXXXXXXXXXXKTCTYFSHKAHQ-DWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKL-RLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGNPVDISQIVILKRCVLVFGF-----------SKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANAELKRAASNSIQQETDDKLDFIKAEIQNSIANRQXXXXXXXXXXXXXXXXXXXXDTVSDMQVQYKKMDVMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEGWLIGEFVAHENASNIIMNTDVSNQYLVTGDMDGYIRVWDI 2600
            +AV+FTSKE+ FYD+  K EF CQ KL+ L   PICMDYW+ P +  E+I+++GD  G +  I ++    SLFER +S   D  E T+ I+  +++ G  K C    HK HQ DWVR+V+Y  +L+  +S  T+   S+V+ W EK                S+     + F + QGI++F Y+  LNLIATAG+N +VCLWNPYV+SKP G+L GH ASV  VQF   R  L SFSKDK+LR+WD+Q Q+ IQR A  FPK Q+          +  +F+ +E   RLFI+FN  L +L MK +   ++ SHEK +   LYNS+  QV+++  G  +  WM+DTGQ++K  T  C   AE++ +  D+ +TRL TG+TDG VKIWDFNG+C++TL V     VDISQI+ILK+ +LV G+            ++IT F   +F    + P  WKG   H DDIL  A +PP  + TGSYDGEI++WN ++E A   +    Q  +K       Q + +    + +   +    T  +   I  E +N++                                            RL +L++RK     GGANL+SCGG+G VRFW+  +  L+ EF+AH    +IIM+TD  N+YL TGD+DG++++W+I
Sbjct:    1 IAVAFTSKEVCFYDLLSKEEFACQYKLQGLKGTPICMDYWYDPLDANESILSFGDITGKVQAIAFTAALISLFERPASACED-GEATMTINWAELLSGCHKCCHILEHKLHQGDWVRQVTYNASLDAIISSTTSNTNSVVMAWREK----------------SKKRLNMTSFNIAQGIHAFDYHSRLNLIATAGINNKVCLWNPYVVSKPVGVLWGHSASVIAVQFFVERKQLFSFSKDKVLRLWDIQHQLSIQRIACSFPKSQD----------FRCLFHFDEAHGRLFISFNNQLALLAMKSEASKRVKSHEKAVTCVLYNSILKQVISSDTGSTVSFWMIDTGQKIKQFTG-CHGNAEISTMALDANETRLLTGSTDGTVKIWDFNGYCHHTLNVGQDGAVDISQILILKKKILVTGWERYDYASWKTIGRAITVFRPQNFNQFFIQPEEWKGGIQHHDDILCAAFLPPQTLVTGSYDGEIVLWNNSTENAHHVLHPDYQRLLKSKLDTKPQKLLSAGRSQPSHPMADHSTTGVRNFEIDTEGKNAVM-------------------------------------------RLCFLKARKNTAVTGGANLVSCGGSGYVRFWDIYKKQLLAEFLAHSGVGSIIMSTDKMNRYLTTGDLDGWLKIWNI 599          

HSP 2 Score: 76.2554 bits (186), Expect = 3.288e-13
Identity = 49/136 (36.03%), Postives = 71/136 (52.21%), Query Frame = 3
Query: 2943 QNPSGYRINTWKDTNLGKDYQELRVRKRERIQPSSIPDLPYLYGEKIGRPTFGPFYSLNISSFEEIEDIEQPEFMEYPEKFF-NETEEFLTKTARVPLLNETLKAVFDERSLLPEYILEFEHKFRNRFQRHLSEAK 3347
            ++ S Y +   +D NL   Y+E     +E  +P         YGE I + +F  F SLNI + EE+ ++ +P F+  PEK+F  E EE   +    P L +TLKAVFDE++L P+ IL  E K +   Q    E K
Sbjct:  618 KDDSTYNVRPSEDINLDIKYKERSTCMKETQKP--------YYGEVI-KKSFSTFRSLNIGALEELPEVNKPAFLLDPEKYFRKEPEEERPQILEAPSLFKTLKAVFDEKNLFPKEILHHERKAKQLCQEKSCEVK 744          
BLAST of WD repeat-containing protein 49 vs. Ensembl Human
Match: WDR49 (WD repeat domain 49 [Source:HGNC Symbol;Acc:HGNC:26587])

HSP 1 Score: 390.963 bits (1003), Expect = 4.342e-122
Identity = 208/494 (42.11%), Postives = 307/494 (62.15%), Query Frame = 3
Query:  132 LELKLNIKDLETLQEAFFMDGSHNRSQHFNGEEFVEALSLVLCKGTREEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTXXXXXXXXXXXXXKTCTYFSHKAHQ-DWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKL-RLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQ 1607
            LE +L++ D   +Q+AF       +    + E+F + ++ ++  GT+EEY +LFDK+D+ ++G+++W+K  S +LLE YE+D+R K++ +PQWK+L+ L   HKD IQ+++ ++N + YLTISKEG + +WG   KLQ+     +++ + + LWVT    L NVNK+AV+FTSKE+ FYD+  K EF CQ KL+ L   PICMDYW+ P +  E+I+++GD  G +  I ++    SLFER +S   D  E T+ I+  +++ G  K C    HK HQ DWVR+V+Y  +L+  +S  T+   S+V+ W EK                S+     + F + QGI++F Y+  LNLIATAG+N +VCLWNPYV+SKP G+L GH ASV  VQF   R  L SFSKDK+LR+WD+Q Q+ IQR A  FPK Q+          +  +F+ +E   RLFI+FN  L +L MK +   ++ SHEK +   LYNS+  Q
Sbjct:   38 LENQLSVGDFVKIQKAF-ESPQPRKIICMSREDFTQKMTEIVGWGTKEEYGELFDKVDVAQDGFINWDKLTSFILLELYEQDERAKATVVPQWKDLEFLPVKHKDTIQKVIFLKNSSHYLTISKEGLLAIWGEHLKLQETFPITSDATKLKHLWVTSLVSLENVNKIAVAFTSKEVCFYDLLSKEEFACQYKLQGLKGTPICMDYWYDPLDANESILSFGDITGKVQAIAFTAALISLFERPASACED-GEATMTINWAELLSGCHKCCHILEHKLHQGDWVRQVTYNASLDAIISSTTSNTNSVVMAWREK----------------SKKRLNMTSFNIAQGIHAFDYHSRLNLIATAGINNKVCLWNPYVVSKPVGVLWGHSASVIAVQFFVERKQLFSFSKDKVLRLWDIQHQLSIQRIACSFPKSQD----------FRCLFHFDEAHGRLFISFNNQLALLAMKSEASKRVKSHEKAVTCVLYNSILKQ 503          
BLAST of WD repeat-containing protein 49 vs. Ensembl Human
Match: EFCAB8 (EF-hand calcium binding domain 8 [Source:HGNC Symbol;Acc:HGNC:34532])

HSP 1 Score: 286.96 bits (733), Expect = 7.978e-79
Identity = 251/971 (25.85%), Postives = 433/971 (44.59%), Query Frame = 3
Query:  201 NRSQHFNGEEFVEALSLVLCKGTREEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRTKSS-SLPQWKELKTLSGPHK-DVIQRIVLVRNLNR---YLTISKEGNVGLWGSDCKLQKVAK-THTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNC--QVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLF-ERVSSKASDKDENTXXXXXXXXXXXXXKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFN-KARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLT--MLEMKPDVK-DKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFN-GHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPS----PWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNIN-------------------------------SEQASRTMTQRSQDEMKEVKKLAEQT--MAANAELKR---AASNSIQQETDDKLDFIKAEIQNSIAN--RQXXXXXXXXXXXXXXXXXXXXDTVSDMQVQYKKMDVMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAE-GWLIGEFVAHENASNII---MNTDVSNQYLVTGDMDGYIRVWDILSYCQT------ESENQKIMS--------------------------------------PPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFG 2801
            N +     + F++A+  VL   + E   +LF K+D   EG+V W+K+  +M+ EF  K+D  KS   L  +  +  +   H  +V++ + L+    +   +LT++K+G +  W     L    +   T+   ++ +WV D   L N+N VAV+ T ++I F+D++   +  C       +L    + MDYW    +    +  +GD  G + V    N++S LF  R+  +AS  D    +     +   S    +Y     H +W  +V +IP +   VSC+    +S+V+  +    P+ ++              R S   + +GI  F Y  + N + T G +  + LWNP+V  +P  L++GH  SVT +  + +    LIS SKDK +R+WD+   +C+Q + G F      AL N  I   S  F+ ++   +  T++ G+    LE +  +K  K ++H  PL   LY+ ++ QVV+ C  G +  W V TG++        G   E+T +  D ++  L TG  DG +K+W++N G C   L   +   ++IS I+ + +   V G+SK IT F       HK  P      W+    H +DILS A      + T SY G+I+ WN                                 S + SR   +R +   K  +KL+  +    AN  L+R   +A   ++   D + D    + + S A+   +    I +  S  +   +   +   +M VQ        ++ ++I+L++R ++ H   A L+S   +G +  W+  E G L+G+F    +  +++   M TD ++  L+TGD  GYI++WDI  YC        +S   K++S                                      PPTL+  W+ H + ++ I +   F   L+I++  D+    W+L+G  IG FG
Sbjct:   66 NSTGALGMDAFIKAMKKVLSSVSDEMLKELFLKVDSDCEGFVTWQKYVDYMMREFQGKEDMRKSQYRLHFYLPMTVVPLNHGCEVVKVVFLIHRFKKIGCFLTVTKDGILQFWSESFSLMSSFRLNQTQQLYNQPMWVIDMVCLHNMNLVAVASTRQKIDFFDIS---DHKCVRAFTFVDLDSCALVMDYW---SDYHRGVFCYGDAKGNVIVFTSENMTSGLFNPRILPRASKWDHWIKVSLQKLLNEKSALHRSYRLKALHPNWCEQVKFIPQMNVVVSCSAIEKSSLVLTIL----PAKASKKP-----------RLSVLRLRKGILCFDYCPDRNFLVTGGYDAFIRLWNPFVSKRPVWLMKGHQTSVTHILVDSRNNSILISVSKDKNIRVWDMLDYICLQSFCGKF-----FALGNCPIT--SAYFFEKDNTLICSTYSIGILKGYLEAQGLIKARKRTTHCSPLCAVLYSKIFKQVVSGCLRGTVSVWEVVTGRKTMEFAVSGGQHVEMTAMALDESERCLLTGLRDGTMKMWNYNIGKCL--LTFPSPEQLEISGIIHMNKVFYVTGWSKRITHFLF-----HKTKPVLLCYHWQTY--HTEDILSMAKYRNQFLGTSSYSGDILFWNTGTLKPIFNFNASRSPSPLQPKRVQDVNNCLAESHRPSRPYVEREKWTYKTSRKLSSLSPESVANTNLRRSLVSAPPVMRCPRDKEPDRPVPQQKPSSASGTSRQSSKIHSKQSIYKEDETRKGEWQKNMLVQSSA-----SVEKIIFLQTRPRLPH--TAALLSSCMDGYIYAWSLHENGGLLGKFPVDLDNGDVVVGAMATDKNDWILITGDCKGYIKIWDIKDYCALIDKQPFQSSGAKVVSEAHNKFRLLIPQQLGTNFPHYIPLEDKEVVAGHTISLVPPTLLMTWKGHLNSVADILYVDNFQ--LVISAGQDRDVKAWKLSGDAIGTFG 990          
BLAST of WD repeat-containing protein 49 vs. Ensembl Celegans
Match: snrp-40.2 (Small Nuclear RibonucleoProtein homolog [Source:UniProtKB/TrEMBL;Acc:O02097])

HSP 1 Score: 58.9214 bits (141), Expect = 9.049e-9
Identity = 31/109 (28.44%), Postives = 60/109 (55.05%), Query Frame = 3
Query: 1077 NSTSSEMAGIPE--SRGFSRTSCFTVHQG-INSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRY 1394
            N  +S+   +P+  S   + T     H G I +  ++ + + +A+AG + Q+ LWN +   +   +L+GH  ++ +V+FN    HL+S   DK +R+WD++   CI+ +
Sbjct:    9 NQMASQFLELPKRTSSLMAPTMVLQGHGGEIYTSQFSSDGSFLASAGYDQQIFLWNVFGECENFAVLKGHKGAIMEVKFNADSSHLVSAGTDKTVRVWDMETGSCIRNF 117          
BLAST of WD repeat-containing protein 49 vs. Ensembl Celegans
Match: wdr-5.1 (WD repeat-containing protein wdr-5.1 [Source:UniProtKB/Swiss-Prot;Acc:Q17963])

HSP 1 Score: 58.5362 bits (140), Expect = 1.718e-8
Identity = 61/299 (20.40%), Postives = 125/299 (41.81%), Query Frame = 3
Query: 1266 LRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDK-ISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWD-FNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHA-VATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANA 2153
            L GH  S++  +F+    +L + S DK ++IW++   +C            E  L   ++ +    +  + +  +  + +  L + E+      K +  H   +  C +N   + VV+      +  W V TG  +KT+     P   ++ ++ +   + + +G+ DG V+IWD  NG C  TL+     PV   +     + +L      ++  +  S  K  K     + G +  K  I +  S+     + +GS D +I IWN+ + +  + +   +Q  +       +  +A+ A
Sbjct:   83 LEGHTKSISSAKFSPCGKYLGTSSADKTVKIWNMDHMIC------------ERTLTGHKLGVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDP---VSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDENPPVAFVKFSPNGKYILASNLDSTLKLWDFSKGKTLKQ----YTGHENSKYCIFANFSVTGGKWIISGSEDCKIYIWNLQTREIVQCLEGHTQPVLASDCHPVQNIIASGA 362          
BLAST of WD repeat-containing protein 49 vs. Ensembl Celegans
Match: wdr-5.1 (WD repeat-containing protein wdr-5.1 [Source:UniProtKB/Swiss-Prot;Acc:Q17963])

HSP 1 Score: 58.5362 bits (140), Expect = 1.718e-8
Identity = 61/299 (20.40%), Postives = 125/299 (41.81%), Query Frame = 3
Query: 1266 LRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDK-ISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWD-FNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHA-VATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANA 2153
            L GH  S++  +F+    +L + S DK ++IW++   +C            E  L   ++ +    +  + +  +  + +  L + E+      K +  H   +  C +N   + VV+      +  W V TG  +KT+     P   ++ ++ +   + + +G+ DG V+IWD  NG C  TL+     PV   +     + +L      ++  +  S  K  K     + G +  K  I +  S+     + +GS D +I IWN+ + +  + +   +Q  +       +  +A+ A
Sbjct:   83 LEGHTKSISSAKFSPCGKYLGTSSADKTVKIWNMDHMIC------------ERTLTGHKLGVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDP---VSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDENPPVAFVKFSPNGKYILASNLDSTLKLWDFSKGKTLKQ----YTGHENSKYCIFANFSVTGGKWIISGSEDCKIYIWNLQTREIVQCLEGHTQPVLASDCHPVQNIIASGA 362          
BLAST of WD repeat-containing protein 49 vs. Ensembl Celegans
Match: snrp-40.1 (Small Nuclear RibonucleoProtein homolog [Source:UniProtKB/TrEMBL;Acc:Q19211])

HSP 1 Score: 52.7582 bits (125), Expect = 9.933e-7
Identity = 24/83 (28.92%), Postives = 47/83 (56.63%), Query Frame = 3
Query: 1149 HQG-INSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRY 1394
            H+G I + A++ +   +AT+G + ++  WN Y   +    ++GH  +V D++F      L+S   DK +R+WD++   C +R+
Sbjct:   37 HEGEIYTGAFSPDGTCLATSGYDQKIFFWNVYGECENFSTIKGHSGAVMDLKFTTDSSSLVSCGTDKSVRVWDMETGTCARRF 119          
BLAST of WD repeat-containing protein 49 vs. Ensembl Fly
Match: WDY (gene:FBgn0267449 transcript:FBtr0347028)

HSP 1 Score: 159.458 bits (402), Expect = 4.539e-39
Identity = 146/628 (23.25%), Postives = 260/628 (41.40%), Query Frame = 3
Query: 1122 FSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSK---MFYHEEKLRLFITFNFGLTMLEMKPDVKDKIS---SHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQA--------ELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGNPV---DISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASR-------------TMTQRSQDEMKEVKKLAEQ-TMAANAELK--RAASNSIQQETDDKLDFIKAEIQNSIANRQXXXXXXXXXXXXXXXXXXXXDTVSDMQVQYKKMDVMFNISRLIYLESR-KKIKHGGGANLISCGGNGIVRFWNSAEGWLIGEFVA-HENASNII-MNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSP---------------------------PTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRW 2816
            +   S F +  G+++F   E+ N++ T G +  V +W+ Y+ ++P+ +L GH   +  V        + S    KI+++WD+     +Q Y  +            R+I +S+    +Y+   LR  +     L  ++  P V+  ++   +H  P+   LYN L+  +V+      I  W   TG+R K I + C  +         E+T    D  +  L TGA DG++KIW++N    N ++V N + +   +++ ++ +   +L  G+ + +T F     +++   P  W   + H DDI          V T +Y GEII W + + Q  R              +T   +  +++ K+LA + T + N  L+  RA  +++    +D  D+                                              D+  ++  +++L++R + +KH  G+  IS     I  + +   G  I EF+A H+    ++ M TD  N+YL TG   GYI+VW I+++C  ESE   +  P                           P L+S ++ H   I+ I+F       +I T S D S  LW   G  +G  G    W
Sbjct:  315 YDERSNFRIPLGVSTFFVAESHNIVVTGGPDTFVRIWDVYIPTEPSAILTGHNGGIVLVFVQPEENKVYSVDYQKIIKVWDLHEHTLLQTYGDLV-----------RLIHHSETDLTYYYHSHLRELVVAGRKLISIKCCPRVRVDLTDGNTHAAPVSVVLYNRLFRNIVSCGLDSYIIVWDPWTGRR-KIIMKSCHTKMIYGEIIDIEITAACFDPLEQFLLTGARDGSLKIWNYN----NAVVVRNMSIMPDQEVTAVIWVVDRILAMGWDRQVTEFNDVVGREYG-DPKKWP--KFHTDDITCADVKLGEGVVTATYSGEIIFWKLETGQPYRRYSVMDPTRFIELKLTAEEEKFIRQSKRLASRLTHSGNHSLQTGRAGRSTVLNRPEDNRDY--------------------------------------------GTDIPISVQAVLFLQTRPQTLKH--GSVFISLDTGFIQVYSHHQRGGYIVEFLAVHKTGDCVLTMCTDRKNRYLYTGTAFGYIKVWYIVNFCVPESEKTHVCMPKLRLEFIFLRKELFMTRAKRAVRNQAEPLLVSSYKGHLKAINSIAFINL--PKIIFTGSHDYSCRLWTQGGRYLGTLGTVLPW 875          
BLAST of WD repeat-containing protein 49 vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0308566)

HSP 1 Score: 53.1434 bits (126), Expect = 1.098e-6
Identity = 66/308 (21.43%), Postives = 128/308 (41.56%), Query Frame = 3
Query: 1251 KPNGLLR----GHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDK-ISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWD-FNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHA-VATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANA 2153
            KPN  L+    GH  +V+ V+F+     L S S DK+++IW          Y G F    E  +   ++ +    +  + +L +  + +  L + E+      K +  H   +  C +N   N +V+      +  W V TG+ +KT+     P   ++ +  +   + + + + DG  +IWD  +G C  TLI  +  PV   +     + +L      ++  +  S  K  K     + G +  K  I +  S+     + +GS D  + IWN+ S++  + +   +   +       E  +A+ A
Sbjct:   59 KPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGA--------YDGKF----EKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDP---VSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKT----YTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAA 347          
BLAST of WD repeat-containing protein 49 vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0070438)

HSP 1 Score: 53.1434 bits (126), Expect = 1.098e-6
Identity = 66/308 (21.43%), Postives = 128/308 (41.56%), Query Frame = 3
Query: 1251 KPNGLLR----GHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDK-ISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWD-FNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHA-VATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANA 2153
            KPN  L+    GH  +V+ V+F+     L S S DK+++IW          Y G F    E  +   ++ +    +  + +L +  + +  L + E+      K +  H   +  C +N   N +V+      +  W V TG+ +KT+     P   ++ +  +   + + + + DG  +IWD  +G C  TLI  +  PV   +     + +L      ++  +  S  K  K     + G +  K  I +  S+     + +GS D  + IWN+ S++  + +   +   +       E  +A+ A
Sbjct:   59 KPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGA--------YDGKF----EKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDP---VSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKT----YTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAA 347          
BLAST of WD repeat-containing protein 49 vs. Ensembl Fly
Match: CG3071 (gene:FBgn0023527 transcript:FBtr0070398)

HSP 1 Score: 50.8322 bits (120), Expect = 8.492e-6
Identity = 48/178 (26.97%), Postives = 78/178 (43.82%), Query Frame = 3
Query: 1263 LLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFY---HEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGI-IYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWD 1784
            L +GH A V    F   +  L SF  DK +R+WDV  +  +Q Y         +  M+P+      MF    ++ K++L+ T     T ++   D       H  P+   L+  L N  +    GG  +  W + +G R+  +T +      +TC+   S   RL +G  D +VKI+D
Sbjct:  118 LFKGHTAPVHRTFFTADKLQLASFGDDKSVRLWDVANEKVVQTYEDTHTDYVRAGAMHPQA---GHMFVSGGYDGKIKLYDT--RAETAVQRTLD-------HGAPVESMLF--LPNGSIFVSAGGSQVRVWDLISGCRL--LTMMSQHHKTVTCLRLGSDGRRLLSGGLDRHVKIYD 279          
BLAST of WD repeat-containing protein 49 vs. Ensembl Zebrafish
Match: wdr95 (WD40 repeat domain 95 [Source:ZFIN;Acc:ZDB-GENE-131127-243])

HSP 1 Score: 237.269 bits (604), Expect = 7.217e-64
Identity = 205/683 (30.01%), Postives = 327/683 (47.88%), Query Frame = 3
Query:  144 LNIKDLETLQEAF--FMDGSHNRSQHFNGEEFVEAL-SLVLCKGTREEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDD---RTKSSS--LPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHTE-SCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWH-HPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTXXXXXXXXXXXXXKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGIPE------SRGFSRTSC----FTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFN-FGLTMLEMKPDVKD-KISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDF-NGHCYNTLIVANGNP--VDISQIVILKRC-VLVFGFSKSITAFWTSSFKDHKVS-PSP-WKG--VQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQ-ASRTMTQRSQ 2099
            ++I DL+ +++AF  F     +   +   +  + +  SL   K T+ ++  LF KID T +G ++W +  +++ LE  +K++   R+K ++  LP   +      P    + RI    N    +T+ ++G V  W     L+       E S   R  W TDF  +   NK+ ++  S+E+ FY+ +  LE  CQ  L  L  +P+ +DY    PD   E ++ +GDT G +N++L  +I   L     S   D   N  I    +         T+   K HQDWV KV Y  ++   VS + +  T++VI      +PS     +M G  E      ++   R +C    F V +G+ +F   +NLNL+ T G++  V +W PYV   P G+L+GH A V  V      GH+ S S D   +IW ++ Q C+      F     S+ +   +   S   Y      L+I  +   L  L+ KP  K  +I SH++P++ C Y+  + QVV+  +G +I  W V+TG  +       G  A +TC+T D++  RL TG  DG +K+W+F NG C   L      P   D S + +     V+  G+S+ I  +  S  +   +  P+P W+      HK+DIL  A   PH +ATGS+DGEII+WN+ S +   R  T +SQ
Sbjct:    2 VSINDLKHIKQAFDEFAKAGIDMLDYAEFQTVMRSCPSLKTVKDTQIQH--LFMKIDYTGDGKIEWHEICTYIFLENKKKEETVHRSKMAAFVLPAIVKFLNCGEP----LLRIHFPPN-GTVVTLREDGLVSFWTPKLHLKSKKNLFPERSITRRPNWATDFVLMPEYNKLIIATGSRELQFYEFS-SLEPCCQ--LSALETVPLNLDYCSTRPD---ECVIVYGDTEGCVNILLMKSIREKLRLWKRSPQVDNIPNISIDHAVES-----PEVTFIRWKVHQDWVSKVKYFESISSIVSSSAHEETALVI---GSIHPSTYKQEQMRGTAEVSDERSTKVTQRATCNQTIFIVPKGVTTFDLCKNLNLLVTGGMDKVVRMWIPYVPRNPTGILKGHSAPVAYVCVTSENGHIYSVSTDNTAKIWHIKDQTCL------FTAHPNSSQIKGEL---SACIYSSAAKGLYIASDSIALLSLKTKPQPKGIQIVSHKEPVLCCGYSEQFRQVVSCSEGSVIKIWDVETGALIFEFGCAHGDSA-ITCMTFDTSGRRLMTGGRDGLIKLWNFNNGQCVKILSREGKCPEICDCSYLTLHGNTFVISVGWSRRIDIYLDSKEETQFIQRPTPSWQDDMRNGHKEDILCIAHCTPHLLATGSFDGEIIVWNVVSGRIQCRFQTPQSQ 653          

HSP 2 Score: 74.7146 bits (182), Expect = 6.065e-13
Identity = 50/159 (31.45%), Postives = 79/159 (49.69%), Query Frame = 3
Query: 2364 NISRLIYLESRKKIKH-GGGANLISCGGNGIVRFWNSAEGWLIGEFVAHENASNI-----IMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKL 2822
            ++  LI+L++R  +      A L+S G  G V FW+   G   G+FVA   AS++      +     +  L T D  G+I V+++  Y     +N     PP  I+ W++H   I+G+    K     ++TSS D S  LW ++G  IG FGQE  W++
Sbjct:  664 SVLSLIFLKTRAFVPELASSAWLVSSGSRGYVNFWSVLNG---GKFVASFQASHLQQQITKLALTQDDSMLFTADHVGFIYVYNVKQYAMGPEQN-----PPEKINFWRAHIRSITGLKIVDK--DQFLLTSSMDCSVRLWNIHGDYIGTFGQEEDWRI 812          
BLAST of WD repeat-containing protein 49 vs. Ensembl Zebrafish
Match: si:dkey-202c14.3 (si:dkey-202c14.3 [Source:ZFIN;Acc:ZDB-GENE-121214-357])

HSP 1 Score: 140.198 bits (352), Expect = 4.750e-33
Identity = 104/344 (30.23%), Postives = 163/344 (47.38%), Query Frame = 3
Query: 1146 VHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPS-PWKGVQTHKDDILSGASIPPHA-VATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANAELKRAA 2171
            + +G+  F ++ +L L+ TAGV   V LWN YV S+P  +LR H  +V DV  ++A G + S+SKD +L+IWD+  Q C++     FP  Q  A ++P    +  +        L +T    + +L++    K +  S        LYN    QV  AC    +  W V TG R   I    G + E++C+  D  Q RL T AT+G +K+W+         +    N      I      +L  G+S+ IT +  +   D  +  +  WK    H +DIL+    P    +ATGSYDGEIIIW +  +   +  T+     +   + L  Q+ A  + L++AA
Sbjct:  368 IEKGVKCFDFSCSLGLLVTAGVGPAVRLWNRYVTSRPTAVLRSHQTTVVDVVIHQALGKIFSYSKDAVLKIWDIPSQQCVKTLHLNFPNIQ--AGVSPEQGSFPLLLNLSSDPVLLVTCREYVALLQLD---KTETRSRSDLYTCALYNPHLQQV--ACADSTLTVWDVKTGIRRMEIRNAHGNE-EVSCMALDVHQRRLITAATNGTIKVWNLLNGLNLHNLEPVSNKEVTGIICHHDDQLLATGWSRLITQYSIAFSSDIYIKANLSWKSGCQHSEDILAMDHCPVLGLLATGSYDGEIIIWALALQ---KPFTRVQTVHLPVHRLLFLQSRAQQSHLRKAA 700          

HSP 2 Score: 80.1073 bits (196), Expect = 1.496e-14
Identity = 50/159 (31.45%), Postives = 73/159 (45.91%), Query Frame = 3
Query: 2355 VMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWN-SAEGWLIGEF-VAHENASNII-MNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKL 2822
            V   + RL++L+SR +  H   A ++     G V  W+        G+F V  ++  N+   +TD  N  LVTGD  G I+VWDI  Y     + +     P L+  W  H   I         SR  I++ S D+ A LW   G  +G FG+E +W L
Sbjct:  677 VHLPVHRLLFLQSRAQQSHLRKAAVLLSSQAGFVCCWSVCGPRHNHGQFYVPDKSGENVTGFSTDPENNLLVTGDTTGCIKVWDIAQYALNNGDMESAAGFPPLLHSWSGHERAIVSSEVLLYESRFFILSVSMDRRACLWTHEGSCVGCFGEEQQWDL 835          

HSP 3 Score: 74.7146 bits (182), Expect = 6.700e-13
Identity = 66/255 (25.88%), Postives = 114/255 (44.71%), Query Frame = 3
Query:  129 KLELKLNIKDLETLQEAFFMDGSHNRSQHFNGEEFVEALSL-------VLCKGTREEYS-----DLFDKIDITREGYVDWEKFASHMLLEF-YEKDDRTKSSSLPQWKEL--KTLSGPHKDVIQRIVLVRNLN-RYLTISKEGNVGLWGSDCKLQKVAKTHTESCRSRDL------WVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGE-AIMAWGDTGGYINVILW 824
            +L   L    L    E+FF   S + S+     E V A S+        L + T ++Y      D F+++ I+ +G V+W+ F + ML  + +         +LP    L  K      + +++ + L R+   RY+++SK G +  W       K  +   E+   R        WVTD  ++ NV+K+AV+  ++ I F+D+     F  Q+ L  L      + YW+  +  GE  ++ WGD  G +N +LW
Sbjct:   31 RLLESLQSNHLSLFMESFFRQRS-DPSRRVRASERVSANSMSFEDYFCCLKEATGQDYQRSDVEDFFNEMSISCDGRVEWQTFQTFMLQHYKHITQSMQPCQNLPISHPLIRKCTYNKQEAIVRVLALTRSPPMRYVSVSKRGTLIAWNRHLNHLKPLEMWGEAFNKRHHRKRFQGWVTDAVYMANVHKIAVATLNRGIHFFDVTTASGFE-QIHLYGLTHFASALCYWYETEAPGEKCVLMWGDEKGSVN-LLW 282          
BLAST of WD repeat-containing protein 49 vs. Ensembl Zebrafish
Match: wdr5 (WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2082])

HSP 1 Score: 53.5286 bits (127), Expect = 1.082e-6
Identity = 45/221 (20.36%), Postives = 97/221 (43.89%), Query Frame = 3
Query: 1152 QGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDK-ISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFN-GHCYNT 1808
            + ++S  ++ +   +A++  +  + +W  Y   K    + GH   ++DV ++     L+S S DK L+IWDV    C++       KG  +        ++   F  +  L +  +F+  + + ++K     K + +H  P+    +N   + +V++   G+   W   +GQ +KT+ +   P       + +     +     D  +K+WD++ G C  T
Sbjct:   46 KAVSSVKFSPSGEWLASSSADKLIKIWGAY-DGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTL-----KGHSN-------YVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNG--KYILAATLDNTLKLWDYSKGKCLKT 251          
BLAST of WD repeat-containing protein 49 vs. Ensembl Xenopus
Match: wdr49 (WD repeat domain 49 [Source:NCBI gene;Acc:549615])

HSP 1 Score: 583.948 bits (1504), Expect = 0.000e+0
Identity = 292/652 (44.79%), Postives = 420/652 (64.42%), Query Frame = 3
Query:  132 LELKLNIKDLETLQEAFFMDGSHNRSQHFNGEEFVEALSLVLCKGTREEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTXXXXXXXXXXXXXKTCTYFSHKAH-QDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTM 2084
            +E +L+IKD   +Q   F     N+S+  + EEF+E     +  G +EEY +LFDKID++REG++DW+K  S MLLE  EKD+R KSS +PQWK++++    H + IQ+IV ++ L RY+T+SK+G +G+WG + KLQ+  +  T++ + +DLW T   FL NVNK+AVSFTSKEI FYD+N K +  CQ KL  L   PICMDYW++PD+  +A++ +GD  G +  + ++    SLFER ++   D+ + T+ I+ N++I G  K+C    HK H  +WVR+V+Y  +LE F+SC T+ N ++++ W EK                 +   R +   + +GIN F Y+  LN+IATAG++ ++CLWNPYVISKP G+L+G+MASV  VQF   R  L SFSKDK+LRIWDV  QVCIQR AG+FPK  E          +  +++ E   RLF++FN  L +LEMK +   KI+SHEKP+   LYNS + QV+++  G  I  WM+DTGQ++K  +  C   +E++ +  D ++TRL TG+TDG VKIWDFNGHC++ L        +ISQI++LKR +LV G+ + IT F  +    + + PS WKG   H DDIL  A   P ++ TGSYDG+I+IWN N+E ASR +
Sbjct:   36 IENRLSIKDFGQIQR-LFQSPELNQSECMSREEFMERTYAAVGHGIKEEYGELFDKIDVSREGFIDWDKLTSFMLLELNEKDERVKSSVIPQWKDIRSFPLIHTENIQKIVYLKGLGRYVTLSKDGLLGVWGENLKLQRSLQICTDTVKLKDLWATSLVFLANVNKIAVSFTSKEICFYDLNSKQDLFCQYKLHGLPGTPICMDYWYNPDDGNDAVLTFGDVNGQVQAVCFTTAMISLFERPANSTEDQ-QTTLYITWNELISGYHKSCFIAKHKLHGNNWVRQVTYSSHLEAFLSCTTSDNNTVILAWREK----------------GKTHLRATSLNIAKGINGFDYHAGLNMIATAGIDNKICLWNPYVISKPTGILQGNMASVITVQFFTGRKQLFSFSKDKVLRIWDVHHQVCIQRVAGIFPKSLE---------FHFTLYFCEPHGRLFVSFNNQLKLLEMKKESGSKITSHEKPITCVLYNSTFKQVISSDTGSTITFWMIDTGQKIKQFSG-CHGTSEISTMALDVSETRLLTGSTDGTVKIWDFNGHCHHKLNAGRDQAAEISQILVLKRTILVVGWERIITVFRFNLLTQYLIQPSEWKGGVQHHDDILCAAFYLPQSLVTGSYDGQIVIWNNNTENASRKL 659          

HSP 2 Score: 193.356 bits (490), Expect = 2.120e-49
Identity = 112/327 (34.25%), Postives = 175/327 (53.52%), Query Frame = 3
Query: 2364 NISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEGWLIGEFVAHENASNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKLGSXXXXXXXXXXXXHEDEVVKQEEDKYKVDPNWYPDPEAIQNPS-------------GYRINTWKDTNLGKDYQELRVRKRERIQPSSIPDLPYLYGEKIGRPTFGPFYSLNISSFEEIEDIEQPEFMEYPEKFF-NETEEFLTKTARVPLLNETLKAVFDERSLLPEYILEFE 3302
            +++RL +L +RK     GG+ L+SCGG+G VRFWN     L+ EFVAHE A +IIM  D +NQY++TGD+DG+++VWDI  YC   SE +K   PP L+  +Q HSD ++ +  C      LI+++SAD +  + ++ G  +G FGQE  W +   +       +  + +       +K  V    Y D       +              ++I+ W++T LGK Y++   +++          L     E   + + G F  LNI    ++ D+ +P+F+  PEK+F ++T+E  TK    P L++TLK+VFDE SL P  ILE E
Sbjct:  707 SVTRLFFLGARKNTSATGGSILVSCGGSGYVRFWNIFRNHLMAEFVAHEGAGSIIMTVDKTNQYIITGDLDGWLKVWDIQDYCIDYSE-KKTTDPPQLVKSFQPHSDCVTHLETCAYSQSLLILSASADCTIHVSDVFGTPVGIFGQEEHWSIEKCLHENERNHVSENSEGDTSHTNNKESVTSTTYCDETTELGDTLSSSLLTEDKEELPFKISPWENTILGKKYKDFGTKEK----------LHSNRREDSVQTSVGTFMLLNIEPLLDVADVTKPDFVINPEKYFEDKTDEKSTKEFTTPPLSDTLKSVFDEGSLFPREILERE 1022          
BLAST of WD repeat-containing protein 49 vs. Ensembl Xenopus
Match: ENSXETT00000013976.1 (EF-hand calcium binding domain 8 [Source:NCBI gene;Acc:100494912])

HSP 1 Score: 220.32 bits (560), Expect = 1.257e-58
Identity = 179/704 (25.43%), Postives = 316/704 (44.89%), Query Frame = 3
Query:  129 KLELKLNIKDLETLQEAFFMDGSHNRSQHFN--------------------GEEFVEALSLVLCKGTREEYSD-----LFDKIDITREGYVDWEKFASHMLLEFYEKDDRT--KSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNR--YLTISKEGNVGLWGSDCKLQK---VAKTHTESC---RSRDLWVTDFAFLGNVNKVAVSFTSKEISFYD---MNVKLEFNCQVKLENLFRIPICMDYWHHPDN-NGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTXXXXXXXXXXXXXKTCTY-FSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDF-NGHCYNTLIVANGNPVDISQIVIL----KRCVLVFGFSKSITAFWTSSFKDHKVSPS-PWKGVQTHKDDILSGASIPPHA-VATGSYDGEIIIWNINSEQASRTMTQRSQ 2099
            +LE K  + DL  LQEAF    S  +  +                      G   ++    VLC     E  D     LF+++D + +GYVDW +F +++LL++ ++D R   + + L Q   ++  +   ++   RI+ + +      L++SK G +  W      QK   VA  + +S    R    WVTD   L N NK+A++ TS++I F+D   MN+  EF+    L  L  +P    YW++  +    +++ WG   G +NV+      + +FE+  S+     +          +    K  +Y      H + + K+ Y P  +  ++ + +  +S++I  + +                     +   + +++G+  F Y   LNL+ T G + +V LWN YV  +P  +L  H  ++ DV   +  G + SFSKD +L++WD+  Q C+      FP  Q   +       +  +  +  +L +  +   G+  L      +    +H  P+   LY+S  + +VT  +   +  W V+TG +   +    G Q E+TC+  D  Q RL TGA +G +KIW+  NGH  + L      PV+ ++I  +    +   L  G+++ I  +      +  V  +  WKG Q H++DIL+    P    +AT S+DGEII+WN  +++    + Q  Q
Sbjct:   29 RLEEKFRLDDLRLLQEAFAKHNSDGKETNCKEESDDLRATRRRAKQEARPAGNMTLDEFRRVLCDLFGSECFDDDMELLFNEVDTSCDGYVDWGEFCTYLLLQYRKRDYRMIGRVTFLGQ-PVIRLCTRNKQEPTSRILAISSPPPMWLLSVSKTGVLTTWDLALHPQKSYEVAAEYPDSQAGKRRFKCWVTDAVHLPNANKIAIATTSRDIHFFDVSTMNLFEEFH----LFALNHVPTTFSYWYNKQSPESRSLLLWGGDNGAVNVLWLLQPQTGVFEKPFSQHPGPTK-----IYMQELKDHSKLLSYQVIPDVHPEAITKLIYCPEKQLIITSSGSAQSSLLIMDINQKG-------------------KVYTWKINKGVQCFDYCRALNLLVTGGFDHKVRLWNQYVTCRPIAVLPEHSMAILDVMIYQPLGQIFSFSKDSVLKVWDIPSQTCLHTLVLKFPCIQPGRIQEQGSFPFLLVPTNPSRLLVCYSDYIGILRLARAEPTEGTFFTHRAPVTCLLYSSFCHLIVTGSEDSTVAVWDVETGAKSLLLGNAHG-QEEVTCMALDKAQRRLITGARNGTIKIWNIQNGHNLHQL-----EPVEDAEITCIVASQENVFLTVGWNRKIVTYDIPKTNEVYVPANHSWKGGQLHQEDILTADFCPSLGLLATASFDGEIILWNAETQRLYLYLRQCPQ 697          

HSP 2 Score: 78.1814 bits (191), Expect = 8.118e-14
Identity = 47/157 (29.94%), Postives = 78/157 (49.68%), Query Frame = 3
Query: 2367 ISRLIYLESRKKIKHGGGANLISCGGNGIVRFW---NSAEGWLIGEFVAHENA--SNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKL 2822
            + +L +L+ R   +    A ++     G +R+W   N  + W  G F A + A  S + + +D +N+ LV+GD  G ++VWDI +Y    +       PP L S W +H   +  +      S   I + S+D++A LW ++G  +G FGQ   WKL
Sbjct:  704 VDKLFFLQKRSAKRE---AAILVSSEAGTLRWWRVTNGGQEW--GSFYAQDEADCSVLGLASDKANRVLVSGDTLGLVQVWDISAYGLQAAAQTYTCRPPLLYS-WGAHDSAVVSVEHFLYDSEPFIASGSSDKTAKLWTVDGKQVGTFGQSKCWKL 854          
BLAST of WD repeat-containing protein 49 vs. Ensembl Xenopus
Match: ENSXETT00000029824.1 (EF-hand calcium binding domain 8 [Source:NCBI gene;Acc:100494912])

HSP 1 Score: 220.32 bits (560), Expect = 1.707e-58
Identity = 179/704 (25.43%), Postives = 316/704 (44.89%), Query Frame = 3
Query:  129 KLELKLNIKDLETLQEAFFMDGSHNRSQHFN--------------------GEEFVEALSLVLCKGTREEYSD-----LFDKIDITREGYVDWEKFASHMLLEFYEKDDRT--KSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNR--YLTISKEGNVGLWGSDCKLQK---VAKTHTESC---RSRDLWVTDFAFLGNVNKVAVSFTSKEISFYD---MNVKLEFNCQVKLENLFRIPICMDYWHHPDN-NGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTXXXXXXXXXXXXXKTCTY-FSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDF-NGHCYNTLIVANGNPVDISQIVIL----KRCVLVFGFSKSITAFWTSSFKDHKVSPS-PWKGVQTHKDDILSGASIPPHA-VATGSYDGEIIIWNINSEQASRTMTQRSQ 2099
            +LE K  + DL  LQEAF    S  +  +                      G   ++    VLC     E  D     LF+++D + +GYVDW +F +++LL++ ++D R   + + L Q   ++  +   ++   RI+ + +      L++SK G +  W      QK   VA  + +S    R    WVTD   L N NK+A++ TS++I F+D   MN+  EF+    L  L  +P    YW++  +    +++ WG   G +NV+      + +FE+  S+     +          +    K  +Y      H + + K+ Y P  +  ++ + +  +S++I  + +                     +   + +++G+  F Y   LNL+ T G + +V LWN YV  +P  +L  H  ++ DV   +  G + SFSKD +L++WD+  Q C+      FP  Q   +       +  +  +  +L +  +   G+  L      +    +H  P+   LY+S  + +VT  +   +  W V+TG +   +    G Q E+TC+  D  Q RL TGA +G +KIW+  NGH  + L      PV+ ++I  +    +   L  G+++ I  +      +  V  +  WKG Q H++DIL+    P    +AT S+DGEII+WN  +++    + Q  Q
Sbjct:   62 RLEEKFRLDDLRLLQEAFAKHNSDGKETNCKEESDDLRATRRRAKQEARPAGNMTLDEFRRVLCDLFGSECFDDDMELLFNEVDTSCDGYVDWGEFCTYLLLQYRKRDYRMIGRVTFLGQ-PVIRLCTRNKQEPTSRILAISSPPPMWLLSVSKTGVLTTWDLALHPQKSYEVAAEYPDSQAGKRRFKCWVTDAVHLPNANKIAIATTSRDIHFFDVSTMNLFEEFH----LFALNHVPTTFSYWYNKQSPESRSLLLWGGDNGAVNVLWLLQPQTGVFEKPFSQHPGPTK-----IYMQELKDHSKLLSYQVIPDVHPEAITKLIYCPEKQLIITSSGSAQSSLLIMDINQKG-------------------KVYTWKINKGVQCFDYCRALNLLVTGGFDHKVRLWNQYVTCRPIAVLPEHSMAILDVMIYQPLGQIFSFSKDSVLKVWDIPSQTCLHTLVLKFPCIQPGRIQEQGSFPFLLVPTNPSRLLVCYSDYIGILRLARAEPTEGTFFTHRAPVTCLLYSSFCHLIVTGSEDSTVAVWDVETGAKSLLLGNAHG-QEEVTCMALDKAQRRLITGARNGTIKIWNIQNGHNLHQL-----EPVEDAEITCIVASQENVFLTVGWNRKIVTYDIPKTNEVYVPANHSWKGGQLHQEDILTADFCPSLGLLATASFDGEIILWNAETQRLYLYLRQCPQ 730          

HSP 2 Score: 78.1814 bits (191), Expect = 7.889e-14
Identity = 47/157 (29.94%), Postives = 78/157 (49.68%), Query Frame = 3
Query: 2367 ISRLIYLESRKKIKHGGGANLISCGGNGIVRFW---NSAEGWLIGEFVAHENA--SNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKL 2822
            + +L +L+ R   +    A ++     G +R+W   N  + W  G F A + A  S + + +D +N+ LV+GD  G ++VWDI +Y    +       PP L S W +H   +  +      S   I + S+D++A LW ++G  +G FGQ   WKL
Sbjct:  737 VDKLFFLQKRSAKRE---AAILVSSEAGTLRWWRVTNGGQEW--GSFYAQDEADCSVLGLASDKANRVLVSGDTLGLVQVWDISAYGLQAAAQTYTCRPPLLYS-WGAHDSAVVSVEHFLYDSEPFIASGSSDKTAKLWTVDGKQVGTFGQSKCWKL 887          
BLAST of WD repeat-containing protein 49 vs. Ensembl Xenopus
Match: ENSXETT00000025824.1 (WD repeat-containing protein 64-like [Source:NCBI gene;Acc:100498290])

HSP 1 Score: 194.897 bits (494), Expect = 2.500e-50
Identity = 160/594 (26.94%), Postives = 283/594 (47.64%), Query Frame = 3
Query:  435 PHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQK---VAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTXXXXXXXXXXXXXKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWME-------------KYNPSNSTSSEMAG-IPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMK-----PDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFNG---HCYNTLIVANGNPVDISQIVIL------KRCVLVFGFSKSITAF---WTSSFKDHKVSPSPWKG--VQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEM 2108
            PH++ + +I  + + N  L + ++G + +W SD KL+K   +   + +  R    W+ D   +   NK+ V    +E+ FY+++   E  CQ+    L  +P+ + Y     +  E ++ +GD  G INVIL S+++ ++  R  +K    D+   +        G +K   +   K H DWV ++ Y+  ++  +S + +  T++VI  +E               + + S  S ++G +P  R  S  S F V +G+ +F + +  N++ T G++  V +WNPYV   P G LRGH + +T +Q       + S S D  + +WD++   C+     V  K  +   +   I   +  F+  +   L+I  +   +ML+++     PDV     SH++P+  C YN    QVV+  +G +I  W + TG+ V  +    G  A +TC+  D+T +R+++ A DG++K WD +     C  TL  A  + +   Q          KR ++  G  K IT F     S+  +++     W       HK +IL  AS PP+ VA+ S DGEI IW++ S     ++    Q+E+
Sbjct:   32 PHREPLIQISPMPD-NSLLVVGQDGLISVWTSDLKLKKNRFILDENKQQNRKMK-WIADLTLMPQYNKLIVGTCDRELRFYELS-NFEPYCQII--GLETLPLHLGY--STRDTDEGVLYFGDEQGCINVILISSVAETI--RSWTKCQIIDDIPSVSMDIIESAGHVKLIRW---KVHNDWVTQIRYVNAIDSIISSSNDDYTALVIGCVEGTKNMQKRLKDLMDSSSTRSKRSMLSGNVPPKRNISDESLFKVKRGVKAFDFCKENNILVTGGLDRIVRIWNPYVPGWPTGSLRGHSSPITFLQIADENSKIYSVSTDCTVMVWDIEEHTCL---INVISKASQ---IKGEI---ATCFFSSQFRALYIATD-SFSMLQLQHSITHPDVPS--VSHKEPVTCCQYNQYLEQVVSCSEGSVIKIWDLLTGKLVSEVRGAHG-SAAITCLALDNTGSRMFSVAKDGSLKQWDLSSTSVSCLTTLKEAVADSLTDGQYDCTYAWLHNKRFMISAGCGKQITIFPDQQDSAVVENQYPNHTWISNMRNKHKGEILCVASCPPNLVASSSSDGEIFIWDVTSGNMMCSLGIPKQEEL 600          

HSP 2 Score: 64.6994 bits (156), Expect = 1.139e-9
Identity = 47/153 (30.72%), Postives = 71/153 (46.41%), Query Frame = 3
Query: 2367 ISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEGW-LIGEF-VAHENASNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWK 2819
            I +LI+L SR        A L + G NG + FW+  +G  + G F  +H   +   M     +  L   D   Y+ +W+I  Y     E      PP LI  W++H  +I+ +    K+   L++TSS D +  LW + G  IG FGQ   W+
Sbjct:  611 IQKLIFLSSRDWKNEC--AVLAASGPNGQITFWHIFDGGKVFGSFPSSHYQTAVRDMAISEDDSTLCAADQLFYVYIWNISQYALHGPEAH----PPPLIHCWRAHQCDITRVVPVSKYK--LVVTSSVDCTVRLWSMKGEPIGTFGQSELWE 755          
BLAST of WD repeat-containing protein 49 vs. Ensembl Xenopus
Match: ENSXETT00000013991.1 (EF-hand calcium binding domain 8 [Source:NCBI gene;Acc:100494912])

HSP 1 Score: 191.045 bits (484), Expect = 7.396e-50
Identity = 145/555 (26.13%), Postives = 253/555 (45.59%), Query Frame = 3
Query:  489 LTISKEGNVGLWGSDCKLQK---VAKTHTESC---RSRDLWVTDFAFLGNVNKVAVSFTSKEISFYD---MNVKLEFNCQVKLENLFRIPICMDYWHHPDN-NGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTXXXXXXXXXXXXXKTCTY-FSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDF-NGHCYNTLIVANGNPVDISQIVIL----KRCVLVFGFSKSITAFWTSSFKDHKVSPS-PWKGVQTHKDDILSGASIPPHA-VATGSYDGEIIIWNINSEQASRTMTQRSQ 2099
            L++SK G +  W      QK   VA  + +S    R    WVTD   L N NK+A++ TS++I F+D   MN+  EF+    L  L  +P    YW++  +    +++ WG   G +NV+      + +FE+  S+     +          +    K  +Y      H + + K+ Y P  +  ++ + +  +S++I  + +                     +   + +++G+  F Y   LNL+ T G + +V LWN YV  +P  +L  H  ++ DV   +  G + SFSKD +L++WD+  Q C+      FP  Q   +       +  +  +  +L +  +   G+  L      +    +H  P+   LY+S  + +VT  +   +  W V+TG +   +    G Q E+TC+  D  Q RL TGA +G +KIW+  NGH  + L      PV+ ++I  +    +   L  G+++ I  +      +  V  +  WKG Q H++DIL+    P    +AT S+DGEII+WN  +++    + Q  Q
Sbjct:    4 LSVSKTGVLTTWDLALHPQKSYEVAAEYPDSQAGKRRFKCWVTDAVHLPNANKIAIATTSRDIHFFDVSTMNLFEEFH----LFALNHVPTTFSYWYNKQSPESRSLLLWGGDNGAVNVLWLLQPQTGVFEKPFSQHPGPTK-----IYMQELKDHSKLLSYQVIPDVHPEAITKLIYCPEKQLIITSSGSAQSSLLIMDINQKG-------------------KVYTWKINKGVQCFDYCRALNLLVTGGFDHKVRLWNQYVTCRPIAVLPEHSMAILDVMIYQPLGQIFSFSKDSVLKVWDIPSQTCLHTLVLKFPCIQPGRIQEQGSFPFLLVPTNPSRLLVCYSDYIGILRLARAEPTEGTFFTHRAPVTCLLYSSFCHLIVTGSEDSTVAVWDVETGAKSLLLGNAHG-QEEVTCMALDKAQRRLITGARNGTIKIWNIQNGHNLHQL-----EPVEDAEITCIVASQENVFLTVGWNRKIVTYDIPKTNEVYVPANHSWKGGQLHQEDILTADFCPSLGLLATASFDGEIILWNAETQRLYLYLRQCPQ 524          

HSP 2 Score: 77.411 bits (189), Expect = 1.064e-13
Identity = 47/157 (29.94%), Postives = 78/157 (49.68%), Query Frame = 3
Query: 2367 ISRLIYLESRKKIKHGGGANLISCGGNGIVRFW---NSAEGWLIGEFVAHENA--SNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKL 2822
            + +L +L+ R   +    A ++     G +R+W   N  + W  G F A + A  S + + +D +N+ LV+GD  G ++VWDI +Y    +       PP L S W +H   +  +      S   I + S+D++A LW ++G  +G FGQ   WKL
Sbjct:  531 VDKLFFLQKRSAKRE---AAILVSSEAGTLRWWRVTNGGQEW--GSFYAQDEADCSVLGLASDKANRVLVSGDTLGLVQVWDISAYGLQAAAQTYTCRPPLLYS-WGAHDSAVVSVEHFLYDSEPFIASGSSDKTAKLWTVDGKQVGTFGQSKCWKL 681          
BLAST of WD repeat-containing protein 49 vs. Ensembl Mouse
Match: Wdr49 (WD repeat domain 49 [Source:MGI Symbol;Acc:MGI:3645287])

HSP 1 Score: 463.381 bits (1191), Expect = 6.305e-147
Identity = 275/758 (36.28%), Postives = 411/758 (54.22%), Query Frame = 3
Query: 1110 ESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMF-YHEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAA--NAELKRAASNSIQQETDDKLDFIKAEIQNSIANRQXXXXXXXXXXXXXXXXXXXXDTVSDMQVQYKKMDVMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEGWLIGEFVAHENASNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKLGSXXXXXXXXXXXXHEDEVVKQEEDKYKVDPNWYPDPEAIQNPSGYRINTWKD----TNLGKDYQELRVRKRERIQPSSIPDLPY--LYGEKIGRPTFGPFYSLNISSFEEIEDIEQPEFMEYPEKFFNE-TEEFLTKTARVPLLNETLKAVFDERSLLPEYILEFEHKFRNRFQRHLSEAKVK 3353
            +S+   + + F + QGI++F Y+  LNLIATAG+N +VCLWNPYV+SKP G+L GH ASV  VQF   R  L SFS+DK+LR+WD+Q Q+ IQR    FPK Q+          +  +F + E   RLFI+FN  L +L +K +   ++ SH K +   LYNSL  QV+++  G  +  WM++TGQ++K     C   AE++ +  D+ +TRL TG+TDG VK+WDFNG+C+ TL V     VDISQI++LK+ +LV G+ +++  F   +F    +    WKG   H+DDIL  A  PP  + TGSYDGEI++WN N+E A   +    Q ++  +  +  Q + +  + E    A  + Q   + K+D    E  N++                                            RL +LE+RK     GGANL+SCG +G VRFW++ +  L+ EF+AH    +IIM+TD  NQYL TGD DG++++W+I  YC T S   KI  PP L+   Q H D IS +  C    R LII+SSAD S  +  L+      FGQ   W + +    P             K +E++ KV+P  +   E   + + + + T +D    T+L  +     ++ + R   +S+    Y   YGE I   T   F SL + + +E+ ++++P F+  P+K+F E  EE +++   +PLL+ETLKAVFDE+SL P+ +L  E + ++  Q    E K+K
Sbjct:   14 KSKKLLKMTSFNIAQGIHAFDYHSRLNLIATAGINNKVCLWNPYVLSKPVGVLWGHSASVIAVQFFAERKQLFSFSRDKVLRLWDIQHQLSIQRITCSFPKSQD----------FRCLFQFDETHGRLFISFNNQLALLAIKNEASKRVKSHLKAVSCVLYNSLLKQVISSDVGSTVSFWMIETGQKIKQFAG-CHGNAEISTMALDANKTRLLTGSTDGTVKVWDFNGYCHYTLNVGQDGVVDISQILVLKKTILVVGWERALIVFRPQNFNQFFIQSEEWKGGVHHQDDILCAAFSPPQTLVTGSYDGEIVLWNNNTENAHHALHPGYQRQLTSMVDVEAQKLNSRRSCESHGVADQATQAARNVKID---TEGNNAVM-------------------------------------------RLCFLEARKTKAATGGANLVSCGASGYVRFWDTFKKVLLAEFLAHAGVGSIIMSTDKLNQYLATGDSDGWLKIWNIEEYC-TNSTESKITQPPPLLRSSQPHEDRISSLEMCESCGRLLIISSSADCSVCVTGLSSAPALIFGQASHWNIENHFSLPERDTNLIES----KNQEERMKVNP-LFSKEELCLDSTEHSLLTEEDEDNSTHLSTEEMNFSLKYKRR---NSLKKKAYKPCYGEIIQTST-STFGSLCLRTLKELPEVKKPAFLLDPDKYFKEGPEEDVSQIPELPLLSETLKAVFDEKSLFPKELLYRERQDKSLCQETNGEMKIK 704          
BLAST of WD repeat-containing protein 49 vs. Ensembl Mouse
Match: Wdr49 (WD repeat domain 49 [Source:MGI Symbol;Acc:MGI:3645287])

HSP 1 Score: 391.349 bits (1004), Expect = 1.489e-122
Identity = 211/508 (41.54%), Postives = 313/508 (61.61%), Query Frame = 3
Query:   96 SKESHTPLTENKLELKLNIKDLETLQEAFFMDGSHNRSQH--FNGEEFVEALSLVLCKGTREEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTXXXXXXXXXXXXXKTCTYFSHKAHQ-DWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMF-YHEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQ 1607
            S++  T L ENKL    +++D   +Q+ F    S + SQ      EEFV+ ++  +  GT+EEY +LFDK+D+ R+G++DW+K  S +LL  YE+D+R K++ +PQWK+L+ L G HKD IQ++V +++ +RYLT+SKEG +G+WG + KLQ+     +++ + + LWVT    L NVNK+AV+FTS+EI FYD+  K EF CQ KL+ L   PICMDYW+ P +  ++I+++GD  G +  + ++    SLFER  + A D +E T+ I   +++ G  K C    H  H  DWVR+V+Y  +L+ F+S   +   ++V+ W EK                S+   + + F + QGI++F Y+  LNLIATAG+N +VCLWNPYV+SKP G+L GH ASV  VQF   R  L SFS+DK+LR+WD+Q Q+ IQR    FPK Q+          +  +F + E   RLFI+FN  L +L +K +   ++ SH K +   LYNSL  Q
Sbjct:   38 SEDYGTDLFENKL----SVEDFVKIQQVF---ESQDPSQTICMPREEFVQKMAETVGWGTKEEYGELFDKVDVARDGFIDWDKLTSFILLLLYERDERAKATVVPQWKDLEFLPGKHKDTIQKVVFLKSSSRYLTVSKEGLLGIWGENLKLQESLPITSDAIKLKHLWVTSLVSLENVNKIAVAFTSREICFYDLLSKEEFPCQYKLQGLQGAPICMDYWYDPIDPKDSILSFGDITGKVQAVAFTAAMISLFER-PANACDNEEATMTIDWAELVSGCHKCCHVLQHTLHHGDWVRQVTYNASLDAFISSTMSGINTVVLAWREK----------------SKKLLKMTSFNIAQGIHAFDYHSRLNLIATAGINNKVCLWNPYVLSKPVGVLWGHSASVIAVQFFAERKQLFSFSRDKVLRLWDIQHQLSIQRITCSFPKSQD----------FRCLFQFDETHGRLFISFNNQLALLAIKNEASKRVKSHLKAVSCVLYNSLLKQ 511          
BLAST of WD repeat-containing protein 49 vs. Ensembl Mouse
Match: Wdr49 (WD repeat domain 49 [Source:MGI Symbol;Acc:MGI:3645287])

HSP 1 Score: 385.185 bits (988), Expect = 4.282e-121
Identity = 198/463 (42.76%), Postives = 292/463 (63.07%), Query Frame = 3
Query:  225 EEFVEALSLVLCKGTREEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTXXXXXXXXXXXXXKTCTYFSHKAHQ-DWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMF-YHEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQ 1607
            EEFV+ ++  +  GT+EEY +LFDK+D+ R+G++DW+K  S +LL  YE+D+R K++ +PQWK+L+ L G HKD IQ++V +++ +RYLT+SKEG +G+WG + KLQ+     +++ + + LWVT    L NVNK+AV+FTS+EI FYD+  K EF CQ KL+ L   PICMDYW+ P +  ++I+++GD  G +  + ++    SLFER  + A D +E T+ I   +++ G  K C    H  H  DWVR+V+Y  +L+ F+S   +   ++V+ W EK                S+   + + F + QGI++F Y+  LNLIATAG+N +VCLWNPYV+SKP G+L GH ASV  VQF   R  L SFS+DK+LR+WD+Q Q+ IQR    FPK Q+          +  +F + E   RLFI+FN  L +L +K +   ++ SH K +   LYNSL  Q
Sbjct:   13 EEFVQKMAETVGWGTKEEYGELFDKVDVARDGFIDWDKLTSFILLLLYERDERAKATVVPQWKDLEFLPGKHKDTIQKVVFLKSSSRYLTVSKEGLLGIWGENLKLQESLPITSDAIKLKHLWVTSLVSLENVNKIAVAFTSREICFYDLLSKEEFPCQYKLQGLQGAPICMDYWYDPIDPKDSILSFGDITGKVQAVAFTAAMISLFER-PANACDNEEATMTIDWAELVSGCHKCCHVLQHTLHHGDWVRQVTYNASLDAFISSTMSGINTVVLAWREK----------------SKKLLKMTSFNIAQGIHAFDYHSRLNLIATAGINNKVCLWNPYVLSKPVGVLWGHSASVIAVQFFAERKQLFSFSRDKVLRLWDIQHQLSIQRITCSFPKSQD----------FRCLFQFDETHGRLFISFNNQLALLAIKNEASKRVKSHLKAVSCVLYNSLLKQ 448          
BLAST of WD repeat-containing protein 49 vs. Ensembl Mouse
Match: Efcab8 (EF-hand calcium binding domain 8 [Source:MGI Symbol;Acc:MGI:3644206])

HSP 1 Score: 285.804 bits (730), Expect = 2.089e-78
Identity = 248/983 (25.23%), Postives = 440/983 (44.76%), Query Frame = 3
Query:  126 NKLELKLNIKDLETLQEAFFMDGSHNRSQHFNGEEFVEALSLVLCKGTREEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPH--KDVIQRIVLVR---NLNRYLTISKEGNVGLWGSD-CKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPIC---MDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLF-ERVSSKASDKDENTXXXXXXXXXXXXXKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGH-LISFSKDKILRIWDVQLQVCIQRYAG-VFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLT--MLEMKPDVK-DKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFN-GHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMA---------------ANAELKRAASNS---IQQETDDKLDFIKAEIQNSIANRQXXXXXXXXXXXXXXXXXXXXDTVSDMQVQYKKMDV--------MFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWN-SAEGWLIGEF-VAHENASNII--MNTDVSNQYLVTGDMDGYIRVWDILSYC---------------QTESENQ------------------------------KIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFG 2801
            N+ + + +   L  LQ+ F  +   N +     E F+  +  VL   + E    LF K+D    G+V W+K+  +M+ EF  K++  KS    ++    T+   H   +V++   L +    + R+LT++K+G +  W      L+    + ++    + +WV D A+L N++ +AV+ T  +I F+D+     + C ++   +  +  C   MDYW    +  +A+  +GDT G   + +  N++  LF  ++  +AS  D    +     +   +    ++     H +W ++V YIP L    SC+    +S+V+  +    P                  R S   + +GI  F Y  + N +AT G +  + LWNP V  KP  L++GH  SVT +  N      LIS S+DK +R+WD+Q  VC+Q + G +FP G           + S  FY    L +  T+N G+    LE +  +K  ++++H  PL   LY+ ++ QVV+ C  G++  W + TG++   I      ++ELT +  D ++  L TG  DG +++W++N G C  T    N + V+IS IV + +     G+SK IT F   +F+    + S +     H +DILS        + T SY+G+I+ WN+++ +   +          E KK+ ++ +                A+   K A S     +         +  AE Q ++A ++          S+     S      D   Q +K D+          ++ ++++L++R ++ H   A L+S   +G +  W+    G L+G+F V +E   +++  M TD ++  L+TGD  G I++WDI  YC                 ++EN+                               ++ PP LI+ W SH D ++ I +   F   L++++  D+    W L+G  IG FG
Sbjct:  102 NQRDQQFSDMHLADLQKVFEKEADENGA--LKKEGFIRIMKGVLSSMSEEMLELLFLKVDSDCNGFVTWQKYVDYMMREFQGKEEMRKSQYRLRFHLPMTVIPLHHGSEVVKVACLTKRFKKMGRFLTVTKDGILQFWSETFSMLESFHLSQSKQYGHQQMWVIDVAYLHNMSLIAVASTELKIEFFDIG---GYKC-IRAFTVIDLDSCVMVMDYW---TDCHKAVFCYGDTKGNATIFISDNVAGGLFNPQILPRASKWDHWFTVSLKKLLNEKAPLYRSFRMKGLHPNWCQQVKYIPQLNVVASCSAVEKSSLVLIILPGKEPEKP---------------RLSSLNLRKGILCFDYCPDRNFLATGGYDPHIRLWNPLVSKKPVWLMKGHQTSVTHLLVNSRNASILISISRDKNIRVWDLQDYVCLQSFCGKLFPLGN--------CPITSTYFYRSSTL-ICSTYNIGILRGYLESQGPLKTGRMTTHNTPLCAVLYSKIFKQVVSGCLQGLVSVWDISTGKKRMEIPVSGIQESELTAMALDQSERCLLTGLRDGTMQMWNYNTGECLMTF--PNPDRVEISGIVHMNKVFYTTGWSKRITNF---TFQKITQALSCYHWQSFHTEDILSMDKYQNQFLGTSSYNGDIVFWNVSTSKPILSFNASKSPLPLEPKKVRDKEICIPKTSIRLDYEDQKWAHRPWKSAISTGKRRLMSAPPVMKHWKDAEQQRNMA-QEKHFRSHKPGLSKMLVNKSGNKLAFDKDTQKRKGDLWRKLLLQSSVSVEKILFLQTRPRLPH--TAALLSSSIDGFIYAWSIHGNGGLLGKFSVDNEVGESVVGAMATDENDWILLTGDSKGNIKIWDIKDYCYFIDQQPLQSSGNSLSVDTENKFRLLIPKQLQVCSEHHLPQEEKEVVEGQTFSLVPPPLLIT-WNSHLDSVTDILYVNSFQ--LVVSAGQDRDVKAWRLSGDAIGTFG 1040          
BLAST of WD repeat-containing protein 49 vs. Ensembl Mouse
Match: Wdr95 (WD40 repeat domain 95 [Source:MGI Symbol;Acc:MGI:1923042])

HSP 1 Score: 175.252 bits (443), Expect = 1.914e-44
Identity = 124/448 (27.68%), Postives = 214/448 (47.77%), Query Frame = 3
Query:  942 YFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWM-----------------EKYNPSNST--------SSEMAGIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCI----QRYAGVFPKGQESA---LMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDF-NGHCYNTLIVANGNPVDISQIVILK----RCVLVFGFSKSITAFWTSSFKDHKV-SPSP-WKGV--QTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANAELK 2162
            Y   K H D+V +++Y  +++  +S + +  T++VI  +                 EK N   +         SS    +P+ +     + F VH+G+ +F++    NL+ T G++  + +WNPY+  KP G+LRGH A V  V        + S S D  +++WD++   C      + +G+  KG+ +A   L  PR +  +             T  F    +   P+    + SH++P++ C YN  +  VV+ C+  ++  W  +TG++V       G  A +TC+T DS+  RL TG  DG +KIW + NGHC +TL   + N  ++     ++    RCV+  G+ + I  ++      H    P P W+      HK+DIL  A  PP  +AT SYDGEII+WN+ S      +   S  + ++ ++  +++++  A LK
Sbjct:   48 YVRWKVHGDFVSQLNYYESMKAVISSSNHEPTALVIGSLLNRLEHGGFTVGATDIKEKLNEIRNVGKNVKMGNSSACLALPQRQAECNRTVFRVHKGVKAFSFCRRKNLLVTGGLDRIIRVWNPYLPGKPTGVLRGHRAPVMYVHVAFEENKVFSMSADNTVKVWDLETHGCCCTISSKASGI--KGELTACLYLPGPRALCVATG-----------TLAFLHLKVGSVPE-SHLVRSHQEPVVCCRYNPAFRHVVSCCEASVVKVWDFETGRQVSEFIGTHG-NAGITCLTFDSSGRRLVTGGRDGCLKIWSYNNGHCLHTL-QHDENQSEVCDCTYMEVNRNRCVIAVGWDRRINVYFDIPRDFHHFRKPQPHWQDDLNHGHKEDILCVAQCPPFLLATSSYDGEIIVWNVISGHMYCKLNTPSPMDGQDHREGPDRSVSQLAFLK 479          

HSP 2 Score: 68.5514 bits (166), Expect = 4.718e-11
Identity = 52/174 (29.89%), Postives = 83/174 (47.70%), Query Frame = 3
Query: 2313 DTVSDMQVQYKKMDVMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEG-WLIGEFV-AHENA--SNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKL 2822
            +T S M  Q  +     ++S+L +L++R        A LIS G  G V FW    G  L+  F  + E A  S I++ +  +  YL   D  G+I V+DI  Y    +E Q     P  ++ W++H   ++ +      S  ++++SS D +  LW  +G  IG FGQ H W +
Sbjct:  454 NTPSPMDGQDHREGPDRSVSQLAFLKTRLTKLDSASAALISNGPGGSVCFWKLFSGSGLVANFTPSREKAQVSGIVVTSGDTLAYLA--DQHGFIHVYDIQEYGLQGTELQA----PNTVTSWRAHVSMVTSLELIEGGS--IVLSSSLDCTVRLWSQDGAYIGTFGQNHPWDV 619          
BLAST of WD repeat-containing protein 49 vs. UniProt/SwissProt
Match: sp|Q8IV35|WDR49_HUMAN (WD repeat-containing protein 49 OS=Homo sapiens OX=9606 GN=WDR49 PE=2 SV=1)

HSP 1 Score: 479.945 bits (1234), Expect = 1.974e-152
Identity = 286/758 (37.73%), Postives = 408/758 (53.83%), Query Frame = 3
Query: 1095 MAGIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKL-RLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANAELKRAASNSIQQETDDKLDFIKAEIQNSIANRQXXXXXXXXXXXXXXXXXXXXDTVSDMQVQYKKMDVMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEGWLIGEFVAHENASNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKLGSXXXXXXXXXXXXHEDEVVKQEEDKYKVDPNWYPDPEAIQNP-----SGYRINTWKDTNLGKDYQELRVRKRERIQPSSIPDLPYLYGEKIGRPTFGPFYSLNISSFEEIEDIEQPEFMEYPEKFF-NETEEFLTKTARVPLLNETLKAVFDERSLLPEYILEFEHKFRNRFQRHLSEAK 3347
            MA   +S+     + F + QGI++F Y+  LNLIATAG+N +VCLWNPYV+SKP G+L GH ASV  VQF   R  L SFSKDK+LR+WD+Q Q+ IQR A  FPK Q+          +  +F+ +E   RLFI+FN  L +L MK +   ++ SHEK +   LYNS+  QV+++  G  +  WM+DTGQ++K  T  C   AE++ +  D+ +TRL TG+TDG VKIWDFNG+C++TL V     VDISQI+ILK+ +LV G+ ++IT F   +F    + P  WKG   H DDIL  A +PP  + TGSYDGEI++WN ++E A   +    Q  +K       Q + +    + +   +    T  +   I  E +N++                                            RL +L++RK     GGANL+SCGG+G VRFW+  +  L+ EF+AH    +IIM+TD  N+YL TGD+DG++++W+I  YC   S+N KI   PTLI  +Q H D IS +  C    + LII+SSAD S  +  +    +  FGQ   W + + +  P        E E+ K+     K +    P   ++ N      S Y +   +D NL   Y+E     +E  +P         YGE I + +F  F SLNI + EE+ ++ +P F+  PEK+F  E EE   +    P L +TLKAVFDE++L P+ IL  E K +   Q    E K
Sbjct:    1 MAWREKSKKRLNMTSFNIAQGIHAFDYHSRLNLIATAGINNKVCLWNPYVVSKPVGVLWGHSASVIAVQFFVERKQLFSFSKDKVLRLWDIQHQLSIQRIACSFPKSQD----------FRCLFHFDEAHGRLFISFNNQLALLAMKSEASKRVKSHEKAVTCVLYNSILKQVISSDTGSTVSFWMIDTGQKIKQFTG-CHGNAEISTMALDANETRLLTGSTDGTVKIWDFNGYCHHTLNVGQDGAVDISQILILKKKILVTGWERAITVFRPQNFNQFFIQPEEWKGGIQHHDDILCAAFLPPQTLVTGSYDGEIVLWNNSTENAHHVLHPDYQRLLKSKLDTKPQKLLSAGRSQPSHPMADHSTTGVRNFEIDTEGKNAVM-------------------------------------------RLCFLKARKNTAVTGGANLVSCGGSGYVRFWDIYKKQLLAEFLAHSGVGSIIMSTDKMNRYLTTGDLDGWLKIWNIEEYCLNSSKN-KITKAPTLIRSFQPHEDRISSLEMCEPGGQLLIISSSADCSICVTGVCNAPVWIFGQAKHWHIENCLFLPKRDTNLV-ESEIQKEISLFSKEESCLDPTEHSLLNKKNKDDSTYNVRPSEDINLDIKYKERSTCMKETQKP--------YYGEVI-KKSFSTFRSLNIGALEELPEVNKPAFLLDPEKYFRKEPEEERPQILEAPSLFKTLKAVFDEKNLFPKEILHHERKAKQLCQEKSCEVK 693          
BLAST of WD repeat-containing protein 49 vs. UniProt/SwissProt
Match: sp|Q17I16|WDY_AEDAE (WD repeat-containing protein on Y chromosome OS=Aedes aegypti OX=7159 GN=WDY PE=4 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 6.556e-44
Identity = 219/952 (23.00%), Postives = 392/952 (41.18%), Query Frame = 3
Query:  132 LELKLNIKDLETLQEAFFMDGSHNRSQHFNGEEFVEALSLVLCKGTREEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRT--KSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNR----------YLTISKEGNVGLWGSDCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMD--YWHH-PDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTXXXXXXXXXXXXXKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDKIS---SHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTI-----TEICG---PQAELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGA--SIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANAELKRAASNSIQQETDDKLDFIKAEIQNSIANRQXXXXXXXXXXXXXXXXXXXXDTVSDMQVQYKKMDVMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEGWLIGEFVAHENASN--IIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKI---------------MSP------------PTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRW 2816
            L   L+  D+E L   F     + R Q    E   E   L   +   EE+  LF KI+  ++ Y  W++  S+++L F   D     +S  LP  +++    G     + +I     ++           ++T ++E  +  W  D K  K  K  +   +     V D A L + N   V+    E+ FYD+ +   F  +  +    RIP  ++  Y+H  PD   + I+  GD  G++ +I +   +   F+  ++ A  +    +             TC  +  +   D VR+V +I +   FV+C+ N         +  ++  N     +  I  +R   R + F V +G+  FA++   + + T G + Q+ LW+     KP  +L GH ++V  +        L S  + KI++IWDV  +  IQ Y+      Q S+ M   +   +  +Y E    L +  N  L+ +   P +  +++   SH +P+   L+N L+  +V+      I  W   TG R  TI     TE+      + ++T    D     + TGA +G +KIW+FN     + + + G+  +++ +   +  +L  G++  I  F   S      S   W+  + H DDIL  +     P A+A+ SY GEII+W + + QA +       D  K       Q +  N + KR     I Q T  +      + Q     R+               T       +++  Q         I  L++LE+R       G  L S     I+ F +  +G  +G F A   A +  I+M TD  N++L TG   GYI++W + +Y     +  K+               + P            P L+S +Q+H   ++ +   +  +  L++++S+D++  +W ++G  +G  G   +W
Sbjct:   15 LHRYLSQNDVEHLYRIF-----NKRKQLLPEELRTELTDLTGVEFQDEEFQTLFMKINANKDEYCQWDELVSYLILGFQNDDPLAVQESLDLPISQDMGMKLGRQTYPVTKIQYAPLVSYDGTVNWSQGFWVTSTREAVINFWKRDWKHLKTGKAFSVDLKRIKTMVLDTAILPDQNYFCVACLECELRFYDI-IASGFTLKTIIN---RIPNAINSLYYHFSPDTRSKMIL--GDYVGHVRMIEFFPENKEPFKFDAATAITR----MAFCDLVGGLCPQMTCVDYG-RLLPDIVRQVEFIESRNSFVACSENDP-------LVPHHMRNKLQVSLV-IQHTRKLDRRTKFKVFKGVTCFAFDSIKDFLVTGGPDGQLRLWDSRRSDKPTEILAGHNSAVVFMFLQDESLKLYSMDQKKIVKIWDVPNRTLIQTYS------QFSSSMFKTVP--ACAYYSELNRELVVGANKVLS-VSCCPKIALEVTDGESHTQPISVLLHNPLFKVIVSCGLDSFIIVWDY-TGNRKLTIIQDAHTEVIHGILEKVQITAACFDPKLQLMVTGARNGELKIWNFNSGSLMSCM-SIGSECEVTAVFWERTGILAMGWNHVIVEFPVGSTGIDFPSGVEWQ--KLHSDDILCASINRTEPKALASCSYSGEIILWMLETGQAYKRF-----DAAK-----PRQKIPVNFKKKR-----IPQPTRRQTRLSIFQPQEHWRQRR--------------LTRIVMPATAELLRQ-------LTIHNLLFLEAR-PFHPDYGTLLASLDTGRILVFSHHPDGGYMGAFSAVHMAGDRVIMMTTDSDNRFLFTGTYLGYIKIWLLENYFVPSGKQPKVNRAALRLQFPFLMDDVVPGRAKRSVANQPMPMLLSSYQAHRTCVTDL--VYMHASQLLVSASSDRTIRIWTISGRYVGLLGSPVKW 890          
BLAST of WD repeat-containing protein 49 vs. UniProt/SwissProt
Match: sp|B7FF09|WDY_DROWI (WD repeat-containing protein on Y chromosome OS=Drosophila willistoni OX=7260 GN=WDY PE=4 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 2.721e-38
Identity = 143/612 (23.37%), Postives = 255/612 (41.67%), Query Frame = 3
Query: 1122 FSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSK---MFYHEEKLRLFITFNFGLTMLEMKPDVKDKIS---SHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQA--------ELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGN---PVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVK-KLAEQTMAANAELKRAASNSIQQETDDKLDFIKAEIQNSIANRQXXXXXXXXXXXXXXXXXXXXDTVSDMQVQYKKMDVMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEGWLIGEFVA-HENASNII-MNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSP---------------------------PTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRW 2816
            +   S F +  G+ +F   E+ N++ T G +  V +W+ Y+ ++P+ +L GH   +  V        + S    KI+++W++Q    +Q Y  +            R+I +++    +Y+   LR  I     L  ++  P V+  ++   +H  P+   LYN L+  +VT      I  W   TG+R K I + C  +         E+T    D  +  L TGA DG++KIW++N    N +++ N +     +++ ++ +   +L  G+ + +T F     +++   P  W   + H DDI  G       V T +Y GEII W + + Q  R  +        E+K    E+ M  +      A +S           + + +     +R    +I                     +++   ++V  ++  +++L++R +  H G    IS     I  + +   G  + EF+A H+    ++ M TD  N++L TG   GYI+VW I++YC  E+E   +  P                           P L+S ++ H   I+ ISF       +IIT S D S  LW   G  +G  G    W
Sbjct:  322 YGDKSNFRIPLGVTTFFVAESHNIVVTGGPDTFVRIWDVYIPTEPSAILTGHNGGIVMVFVQPEENKVYSVDYQKIIKVWNLQEHTLLQTYGDLV-----------RLIHHTETDLTYYYHSHLRELIVAGRKLISIKCCPRVRVDLTDGNTHAAPVSVVLYNRLFRNIVTCGLDSYIIVWDPWTGRR-KIIMKSCHTKMIYGETIDIEITAACFDPLEQFLLTGARDGSLKIWNYN----NAVVIRNMSIQPDQEVTAVIWVVERILAMGWDRQVTEFNDVEGREYG-DPKKWP--KFHTDDITCGDVKLGEGVVTATYSGEIIFWKLETGQPYRRYSVMEPKRFIELKLSDEEKQMKRSKRWASRAPHSGSHMMSHTGSHMGSNVDQMSGSRSRGLAILQ----------------GQEEIREYGVNVPISVQAVLFLQNRPQTLHHGSV-FISLDTGIIQVYSHHQRGGYMNEFLAVHKTGDCVLTMATDRKNRFLFTGTAFGYIKVWYIVNYCIPEAEKIHVCMPRLRLDFIFLRKETFLTRAKRVVRNQAEPLLVSSYKGHLKAINSISFINL--PKIIITGSHDYSCRLWTQGGRYLGTLGSVLPW 895          
BLAST of WD repeat-containing protein 49 vs. UniProt/SwissProt
Match: sp|B4F7L9|WDY_DROME (WD repeat-containing protein on Y chromosome OS=Drosophila melanogaster OX=7227 GN=WDY PE=2 SV=2)

HSP 1 Score: 159.458 bits (402), Expect = 4.550e-38
Identity = 146/628 (23.25%), Postives = 260/628 (41.40%), Query Frame = 3
Query: 1122 FSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSK---MFYHEEKLRLFITFNFGLTMLEMKPDVKDKIS---SHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQA--------ELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGNPV---DISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASR-------------TMTQRSQDEMKEVKKLAEQ-TMAANAELK--RAASNSIQQETDDKLDFIKAEIQNSIANRQXXXXXXXXXXXXXXXXXXXXDTVSDMQVQYKKMDVMFNISRLIYLESR-KKIKHGGGANLISCGGNGIVRFWNSAEGWLIGEFVA-HENASNII-MNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSP---------------------------PTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRW 2816
            +   S F +  G+++F   E+ N++ T G +  V +W+ Y+ ++P+ +L GH   +  V        + S    KI+++WD+     +Q Y  +            R+I +S+    +Y+   LR  +     L  ++  P V+  ++   +H  P+   LYN L+  +V+      I  W   TG+R K I + C  +         E+T    D  +  L TGA DG++KIW++N    N ++V N + +   +++ ++ +   +L  G+ + +T F     +++   P  W   + H DDI          V T +Y GEII W + + Q  R              +T   +  +++ K+LA + T + N  L+  RA  +++    +D  D+                                              D+  ++  +++L++R + +KH  G+  IS     I  + +   G  I EF+A H+    ++ M TD  N+YL TG   GYI+VW I+++C  ESE   +  P                           P L+S ++ H   I+ I+F       +I T S D S  LW   G  +G  G    W
Sbjct:  315 YDERSNFRIPLGVSTFFVAESHNIVVTGGPDTFVRIWDVYIPTEPSAILTGHNGGIVLVFVQPEENKVYSVDYQKIIKVWDLHEHTLLQTYGDLV-----------RLIHHSETDLTYYYHSHLRELVVAGRKLISIKCCPRVRVDLTDGNTHAAPVSVVLYNRLFRNIVSCGLDSYIIVWDPWTGRR-KIIMKSCHTKMIYGEIIDIEITAACFDPLEQFLLTGARDGSLKIWNYN----NAVVVRNMSIMPDQEVTAVIWVVDRILAMGWDRQVTEFNDVVGREYG-DPKKWP--KFHTDDITCADVKLGEGVVTATYSGEIIFWKLETGQPYRRYSVMDPTRFIELKLTAEEEKFIRQSKRLASRLTHSGNHSLQTGRAGRSTVLNRPEDNRDY--------------------------------------------GTDIPISVQAVLFLQTRPQTLKH--GSVFISLDTGFIQVYSHHQRGGYIVEFLAVHKTGDCVLTMCTDRKNRYLYTGTAFGYIKVWYIVNFCVPESEKTHVCMPKLRLEFIFLRKELFMTRAKRAVRNQAEPLLVSSYKGHLKAINSIAFINL--PKIIFTGSHDYSCRLWTQGGRYLGTLGTVLPW 875          
BLAST of WD repeat-containing protein 49 vs. UniProt/SwissProt
Match: sp|B7FF07|WDY_DROMO (WD repeat-containing protein on Y chromosome OS=Drosophila mojavensis OX=7230 GN=WDY PE=4 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 4.552e-38
Identity = 141/605 (23.31%), Postives = 247/605 (40.83%), Query Frame = 3
Query: 1140 FTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKM---FYHEEKLRLFITFNFGLTMLEMKPDVKDKIS---SHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQA--------ELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGN---PVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANAELKRAASNSIQQETDDKLDFIKAEIQNSIANRQXXXXXXXXXXXXXXXXXXXXDTVSDMQVQYKKMDVMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEGWLIGEFVAHENASNII--MNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSP---------------------------PTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRW 2816
            F +  G++ F  +E  N++ T G +  V +W+ Y+ S+P+ +L GH   +  V        + S    KI+++WD+Q    +Q Y  +            RII +S+M   +Y+   LR  +     L  ++  P V+  ++   +H  P+   LYN L+  +VT      I  W   TG+R K I + C  +         E+T    D  +  L TGA DG++KIW++N    N+++V N +     +++ ++ +   +L  G+ + +T F     +++     P K  + H DDI          V T +Y GEII W + + Q  R        +  E+K  AE+   +    + ++     + +   L     EI++  AN                                    +  ++  +++L+ R   K  G    IS     I  + +   G  I EF+A     + +  M TD  N++L TG   GYI++W I++YC  E+E   +  P                           P L+S ++ H   I+ I F     + ++ + S D S  LW  +G  +G  G    W
Sbjct:  322 FRIPLGVSVFYVSEVKNILVTGGPDTFVRIWDVYISSEPSAILTGHNGGIVAVFVQPEENKVYSVDYHKIIKVWDLQEHTLLQTYGELV-----------RIIHHSEMDIKYYYHSHLRELMVAGRKLIQVKCCPRVRVDLTDGNTHAAPVSVVLYNRLFRNIVTCGLDSYIIVWDPWTGRR-KIIMKNCHTKMIYGETIDIEITAACFDPLEQFLLTGARDGSLKIWNYN----NSVVVRNMSIQMDQEVTAVIWVVDRILAMGWDRQVTEFNDVEGREYG---DPKKWAKFHTDDITCADVKLGEGVVTATYSGEIIFWKLETGQPYRRYNVMDPSQFIELKLTAEEEKLSRRSKRISSLLGANRRSASMLAIKPDEIKDYGAN------------------------------------IPVSVQAVLFLQKRPMTKDHGSV-FISLDTGIIQVYSHHQHGGHIKEFIAVHKVGDCVLTMATDRKNRFLYTGTAFGYIKIWHIVNYCIPEAEKTHVCMPKLRLDFIFLRKELFLTRAKRMVRNQPEPMLVSSYKGHLKAINSIGF-INLPK-ILFSGSHDYSCRLWTQSGRYLGTLGTVLPW 868          
BLAST of WD repeat-containing protein 49 vs. TrEMBL
Match: A0A1S3JWS0 (WD repeat-containing protein 49-like OS=Lingula unguis OX=7574 GN=LOC106176568 PE=4 SV=2)

HSP 1 Score: 1004.59 bits (2596), Expect = 0.000e+0
Identity = 513/1129 (45.44%), Postives = 719/1129 (63.68%), Query Frame = 3
Query:  117 LTENKLELKLNIKDLETLQEAFFMDG-SHNRSQHFNGEEFVEALSLVLCKGTREEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNV-KLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTX-------XXXXXXXXXXXXKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANAELKRAASNSIQQETDDKLDFIKAEIQNSIANRQXXXXXXXXXXXXXXXXXXXXDTVSDMQVQYKKMDVMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSA--EGWLIGEFVAHENASNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKLGSXXXXXXXXXXXXHEDEVVKQEED-KYKVDPNWYPDPEAIQNPSGYRINTWKDTNLGKDYQELRVRKRERIQPSSIPDLPYLYGEKIGRPTFGPFYSLNISSFEEIEDIEQPEFMEYPEKFFNETEEFLTKTARVPLLNETLKAVFDERSLL--PEYILEFEHKFRNRFQRHLSEAKVKLSLDDSNSFQEQLPRK---------AKTVRLKPIQE 3434
            + + K+E +LNI+DLE +Q+ F  DG  ++     N E+F EALS +L KG+R++Y++LFDKID+T+EG VDW+KFASHMLLEFYEKDDR KS+ +PQWK+LKTL  PHK+ IQ+I  ++N+NRY+ ISKEG V +W    KLQ+  KT TESCR RDLW++ F  L N+NK+A++FTSKEI+FYDM+  KLEFNCQ K++ L   P+C+DYW +P N  EA++ WGD GG +N +L+S  + +LFER ++ A +K E T+         +I++      K   Y  H  H +WVR+V Y PNL+ F+S +T+   ++VI W+EK               +S    +T+ F + QG+N   Y+E LNLIATAGVN QVCLWNPYV+SKPNG+LRGHMASV  VQFN  RG LISFSKDK+LRIWDVQLQVCIQR AG+FPKG E         +YS ++  E + RLFITFN+ LT++EMK +VK++I SHEKP+   +YNSLYNQV+++CQ G +  WM+DTGQ+VK  T   G   E+T +  D ++TRLYTG+TDG VKIWDFNGHCY+TL  + G+P DI QI++LKR VLV G+++ IT F  ++ KD  V PS WKG Q H+DDIL+    PP+  AT SYDGEI+IWN+NSE AS+ + QR++    + ++       A+ EL R  +      T +      A    +        +  +  S + T +  S   +S+ Q  Y+     + ++R+++LE+RK     G ANL+SCGGNG VRFWN++   G L+GEFV+H  A+++IM TD  NQYLVTGD+DG ++VW+I  YC  ++++     PP + + WQ H D I+ +  C +  R L++++S D S  LW++ G LIG FGQE  WK+   +    +      E+E     +  +   D +W P+  A   P  YR NTW  T LGK YQE R  KRER QP  +P+LPYL+ E+ G P  GPF +L ++  +E+  I++P+F+ +P K+F+E      ++ ++P L E+LK  FDE++L    +YIL++E + +   +  L     K  L         LP +         AK  +LKPIQ+
Sbjct:   34 MLDQKMENRLNIRDLEQVQDIFMADGDGYDNRLSLNREQFCEALSRLLTKGSRQDYAELFDKIDVTKEGQVDWDKFASHMLLEFYEKDDRVKSTQVPQWKDLKTLPSPHKETIQKIAYLKNINRYIAISKEGCVSMWDPSLKLQRTIKTGTESCRQRDLWMSHFVPLQNINKIALAFTSKEIAFYDMSSNKLEFNCQYKVQGLEHTPLCLDYWFNPKNTNEAVIVWGDVGGCVNALLFSTANIALFERPTAPAGEKQETTLNIQLKEISRTIDNREKAKYKNARYIRHHGHSEWVRQVKYAPNLDAFISVSTSNARAIVIGWIEKG--------------DSLRAMKTTAFHISQGVNGLDYHEGLNLIATAGVNHQVCLWNPYVVSKPNGVLRGHMASVIQVQFNTTRGQLISFSKDKVLRIWDVQLQVCIQRLAGMFPKGPE---------VYSVLYLDEIRNRLFITFNYQLTLMEMKAEVKNRILSHEKPICSVIYNSLYNQVISSCQAGTVVVWMIDTGQKVKQFTNTHGTN-EVTALALDQSETRLYTGSTDGTVKIWDFNGHCYHTLDCSEGHPADIGQIIVLKRNVLVVGWARHITIFRQNNLKDFHVLPSDWKGGQEHQDDILTACFSPPNRAATASYDGEIVIWNMNSEHASKHLNQRAKKVTNKNRRSTLIPSRASRELTREGTFESVSPTRNPPTPRNATTPRNAPTPGTAPTPLSRASPQRTKSRMSVAAISEDQTGYE-----YAVTRVLFLEARKTHSASGTANLVSCGGNGWVRFWNTSTSAGTLMGEFVSHPQAASVIMATDQHNQYLVTGDVDGNMKVWNISEYCIRQADDVVTNQPP-MTASWQPHVDVITSLVMCERNERLLVVSASMDCSVQLWDIYGNLIGVFGQEDHWKIEPYVPKMEVDEETKEEEEEFADTDMIEPDADSHWEPEESATDQPESYRFNTWDKTCLGKTYQETRTHKRERRQPKVMPNLPYLHWERTGDPPAGPFAALEMNELQELNKIDKPDFIAHPHKYFSERSNNEEQSVKLPALAESLKTPFDEKTLFYKAKYILDYETRMKQYHKTVLEGGGKKQKLGGGKIAIPTLPNQSQAPPSRAPAKPQKLKPIQQ 1132          
BLAST of WD repeat-containing protein 49 vs. TrEMBL
Match: A0A1S3JX59 (WD repeat-containing protein 49 OS=Lingula unguis OX=7574 GN=LOC106176875 PE=4 SV=1)

HSP 1 Score: 1004.2 bits (2595), Expect = 0.000e+0
Identity = 513/1129 (45.44%), Postives = 719/1129 (63.68%), Query Frame = 3
Query:  117 LTENKLELKLNIKDLETLQEAFFMDG-SHNRSQHFNGEEFVEALSLVLCKGTREEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNV-KLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTX-------XXXXXXXXXXXXKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANAELKRAASNSIQQETDDKLDFIKAEIQNSIANRQXXXXXXXXXXXXXXXXXXXXDTVSDMQVQYKKMDVMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSA--EGWLIGEFVAHENASNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKLGSXXXXXXXXXXXXHEDEVVKQEED-KYKVDPNWYPDPEAIQNPSGYRINTWKDTNLGKDYQELRVRKRERIQPSSIPDLPYLYGEKIGRPTFGPFYSLNISSFEEIEDIEQPEFMEYPEKFFNETEEFLTKTARVPLLNETLKAVFDERSLL--PEYILEFEHKFRNRFQRHLSEAKVKLSLDDSNSFQEQLPRK---------AKTVRLKPIQE 3434
            + + K+E +LNI+DLE +Q+ F  DG  ++     N E+F EALS +L KG+R++Y++LFDKID+T+EG VDW+KFASHMLLEFYEKDDR KS+ +PQWK+LKTL  PHK+ IQ+I  ++N+NRY+ ISKEG V +W    KLQ+  KT TESCR RDLW++ F  L N+NK+A++FTSKEI+FYDM+  KLEFNCQ K++ L   P+C+DYW +P N  EA++ WGD GG +N +L+S  + +LFER ++ A +K E T+         +I++      K   Y  H  H +WVR+V Y PNL+ F+S +T+   ++VI W+EK               +S    +T+ F + QG+N   Y+E LNLIATAGVN QVCLWNPYV+SKPNG+LRGHMASV  VQFN  RG LISFSKDK+LRIWDVQLQVCIQR AG+FPKG E         +YS ++  E + RLFITFN+ LT++EMK +VK++I SHEKP+   +YNSLYNQV+++CQ G +  WM+DTGQ+VK  T   G   E+T +  D ++TRLYTG+TDG VKIWDFNGHCY+TL  + G+P DI QI++LKR VLV G+++ IT F  ++ KD  V PS WKG Q H+DDIL+    PP+  AT SYDGEI+IWN+NSE AS+ + QR++    + ++       A+ EL R  +      T +      A    +        +  +  S + T +  S   +S+ Q  Y+     + ++R+++LE+RK     G ANL+SCGGNG VRFWN++   G L+GEFV+H  A+++IM TD  NQYLVTGD+DG ++VW+I  YC  ++++     PP + + WQ H D I+ +  C +  R L++++S D S  LW++ G LIG FGQE  WK+   +    +      E+E     +  +   D +W P+  A   P  YR NTW  T LGK YQE R  KRER QP  +P+LPYL+ E+ G P  GPF +L ++  +E+  I++P+F+ +P K+F+E      ++ ++P L E+LK  FDE++L    +YIL++E + +   +  L     K  L         LP +         AK  +LKPIQ+
Sbjct:   34 MLDQKMENRLNIRDLEQVQDIFMADGDGYDNRLSLNREQFCEALSRLLTKGSRQDYAELFDKIDVTKEGQVDWDKFASHMLLEFYEKDDRVKSTQVPQWKDLKTLPSPHKETIQKIAYLKNINRYIAISKEGCVSMWDPSLKLQRTIKTGTESCRQRDLWMSHFVPLQNINKIALAFTSKEIAFYDMSSNKLEFNCQYKVQGLEHTPLCLDYWFNPKNTNEAVIVWGDVGGCVNALLFSTANIALFERPTAPAGEKQETTLNIQLKEISRTIDNREKAKYKNARYIRHHGHSEWVRQVKYAPNLDAFISVSTSNARAIVIGWIEKG--------------DSLRAMKTTAFHISQGVNGLDYHEGLNLIATAGVNHQVCLWNPYVVSKPNGVLRGHMASVIQVQFNTTRGQLISFSKDKVLRIWDVQLQVCIQRLAGMFPKGPE---------VYSVLYLDEIRNRLFITFNYQLTLMEMKAEVKNRILSHEKPICSVIYNSLYNQVISSCQAGTVVVWMIDTGQKVKQFTNTHGTN-EVTALALDQSETRLYTGSTDGTVKIWDFNGHCYHTLDCSEGHPADIGQIIVLKRNVLVVGWARHITIFRQNNLKDFHVLPSDWKGGQEHQDDILTACFSPPNRAATASYDGEIVIWNMNSEHASKHLNQRAKKVTNKNRRSTLIPSRASRELTREGTFESVSPTRNPPTPRNATTPRNAPTPGTAPTPLSRASPQRTKSRMSVAAISEDQTGYE-----YAVTRVLFLEARKSHSASGTANLVSCGGNGWVRFWNTSTSAGTLMGEFVSHPQAASVIMATDQHNQYLVTGDVDGNMKVWNISEYCIRQADDVVTNQPP-MTASWQPHVDVITSLVMCERNERLLVVSASMDCSVQLWDIYGNLIGVFGQEDHWKIEPYVPKMEVDEETKEEEEEFADTDMIEPDADSHWEPEESATDQPETYRFNTWDKTCLGKTYQETRTHKRERRQPKVMPNLPYLHWERTGDPPAGPFAALEMNELQELNKIDKPDFIAHPHKYFSERSNNEEQSVKLPALAESLKTPFDEKTLFYKAKYILDYETRMKQYHKTVLEGGGKKQKLGGGKIAIPTLPNQSQAPPSRAPAKPQKLKPIQQ 1132          
BLAST of WD repeat-containing protein 49 vs. TrEMBL
Match: R7UEX8 (WD_REPEATS_REGION domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_229382 PE=4 SV=1)

HSP 1 Score: 991.49 bits (2562), Expect = 0.000e+0
Identity = 484/1031 (46.94%), Postives = 682/1031 (66.15%), Query Frame = 3
Query:  279 YSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTXXXXXXXXXXXXXKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSE---MAGIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKL-RLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIV-ANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAE-QTMAANAELKRAASNSIQQETDDKLDFIKAEIQNSIANRQXXXXXXXXXXXXXXXXXXXXDTVSDMQVQYKKMDVMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEGWLIGEFVAHENASNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKLGSXXXXXXXXXXXXHEDEVVKQEEDKYKVDPNWYPDPEAIQNPSGYRINTWKDTNLGKDYQELRVRKRERIQPSSIPDLPYLYGEKIGRPTFGPFYSLNISSFEEIEDIEQPEFMEYPEKFFNETEEFLTKTARVPLLNETLKAVFDERSLLPEYILEFEHKFRNRFQRHLSEAKVK 3353
            ++DLFDK+D+T+EG VDW+KFASHMLLEFYE+D+R KS+ +PQWK+L+TL  PHK++IQR+  ++N NRY++ISKEG V +WG + KLQ+  KT T++CR+RDLW+TDF  L N+NK+A++FTSKEI+ YD++ KLEFNCQ K++ +   P+ ++YW +P N  EAI+ WGDT G +N + +++ + +LFER  + + +K E  + + + D+I    K+  +  H+ H +WVR+V Y  NLECF+SCAT WN S+VI WMEK+  + +  +E    + +P+     RT+ F + QG+N F Y+E LNLIATAGVN  VCLWNPYV+SKPNG+LRGHMASV  VQFNK R  LISFSKDK+LRIWDVQLQV IQR AG+FPKG E           S + Y +E++ RLFITFN+ LT++EMK ++ D++ SHEKP++  LYN+ YNQVV+ACQGG I  WM DTGQ+VK  T+  G  +E+T + QD +QTR+YTG+TDG VKIWDFNGHCY+TL   ++G P DI QI+ LKR ++V G+++ IT F  ++F+D  + PS WKG Q H+DDIL+ A   P+ +A+GSYDGEI+ WN NSEQAS+ + QR +  M   K  +  + M+++   +  ++ +++     +                                     T S +  + +  +  F I+ L +L  RK     GGANL+SCGGNG VRFWN+    L+ EF AH    +++M  D  + ++ TGD+DG I+VWDI  YC  +SE+  I +PP L SQ+  H D +S +    +  RTLI+++SAD S  LW++ G  IG FGQE  WK+    E   +   + H +E   + E +   +  W PD  A + P  YRINTW+ T+LGKDYQELRVRKRER QP  I DLPYL+ EK G+P  GPF +LN +   ++  + QP+FM +P ++F+E     ++  R+P L ETL A FDE+SL P+YI++FE+K ++   R L+EA+ +
Sbjct:    6 FADLFDKVDVTKEGTVDWDKFASHMLLEFYERDNRVKSTQVPQWKDLRTLPSPHKEIIQRLAYLKNSNRYISISKEGCVSMWGQNLKLQRNLKTGTDTCRARDLWMTDFIPLQNINKIALAFTSKEIAIYDLSAKLEFNCQFKVQGMEHTPLSLEYWSNPMNVNEAILTWGDTSGAVNALHFNSANIALFERPPAPSGEKQETCLNVHLKDVIKKKYKSARFTKHQGHSEWVRQVKYSANLECFISCATTWNNSLVIGWMEKHQSNQNMKTEDNNCSILPKE--VVRTTTFQLPQGVNGFDYHEQLNLIATAGVNHHVCLWNPYVVSKPNGVLRGHMASVIQVQFNKCRNQLISFSKDKVLRIWDVQLQVAIQRLAGMFPKGPE----------VSSILYFDERMNRLFITFNYQLTVMEMKVEITDRVMSHEKPVVAALYNATYNQVVSACQGGTIIMWMADTGQKVKQFTQAHG-NSEVTTLAQDHSQTRIYTGSTDGTVKIWDFNGHCYHTLHCGSDGQPADIGQILSLKRSLIVVGWARYITVFRDANFRDFHIEPSDWKGGQEHQDDILALAFSGPNTLASGSYDGEIVTWNNNSEQASKHLNQRGRKLMTRQKTFSTLRDMSSDLGFESCSNTNMRGRPKSR-------------------------------------TASRLSTEEEANEYGFAITCLAFLTGRKGSSAKGGANLVSCGGNGWVRFWNTNNNKLLAEFTAHSQVGSLVMVVDEHSHWMATGDVDGLIKVWDISQYCMYDSEDSIITTPPPLKSQFIPHIDALSTLEIFVRNERTLILSASADCSVQLWDIYGNQIGVFGQEGHWKVEPYNEQDEVENEDRHNEEDEIRAEVEADHESEWEPDELATERPEDYRINTWEKTHLGKDYQELRVRKRERRQPEIIKDLPYLHWEKTGQPPAGPFAALNTTELSDVGTLNQPDFMHHPHRYFSERPSTASQNKRLPSLAETLNAAFDEKSLFPKYIMDFENKMKHHHTRTLAEAQKR 986          
BLAST of WD repeat-containing protein 49 vs. TrEMBL
Match: A0A2T7PSF0 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_03331 PE=4 SV=1)

HSP 1 Score: 968.763 bits (2503), Expect = 0.000e+0
Identity = 503/1022 (49.22%), Postives = 685/1022 (67.03%), Query Frame = 3
Query:   99 KESHTPL-TENKLELKLNIKDLETLQEAFFMDG-SHNRSQHFNGEEFVEALSLVLCKGTREEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTXXXXXXXXXXXXXKTCTYFSHKAHQ-----DWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGIPESR--GFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKL-------RLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANAELKRAASNSIQQETDDKLDFIKAEIQNSIANRQXXXXXXXXXXXXXXXXXXXXDTVSDMQVQYKKMDVMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEGWLIGEFVAHENASNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKLGSXXXXXXXXXXXXHEDE---VVKQEEDKYKVDPNWYPDPEAIQNPSGYRINTWKDTNLGKDYQELRVRKRERIQPSSIPDLPYLYGEKIGRPTFGPF 3107
            +E   PL  + KLE +L +KDLE L+ +F ++G  ++     N ++F EALSL+L KG+REEY +LFDKID+TREG VDW+KFASHMLLEFYE+DDR KS+ +PQWK+LK+L  PHK++IQR+  ++N +RY+ ISKEG V +WG D K+Q++ +T T+SCR+RDLWVT F  L N+NK+A+SFTSKEI+ YD++ KLEFNCQ K+ +L   P+C+DYW +PDN  EA++ WGD GG++N++ +++ + +LFER  + A +K E  + + ++DI+ G  K   Y S++AH+     +WVR+V Y   LECF+SCAT    ++VI WMEK++  N + +   G   SR  G  R S F + QG+NSF Y++ LNLIATAG N  VCLWNPYV+SKPNG+LRGHMASV  VQF K RG LISFSKDK+LRIWDVQLQVCIQR AG+FPKG E         + S +F+ E K        RLFITFN+ +T+L+MK +VKD+I SHEKP+I  LYN++YNQ+V+ CQ G +  WM DTGQ+VK  ++I G  +E+TC++QD +Q+RL+TG+TDG VK+WDFNGHCY+ L  A G P D+ QI+ LK  +LV G++K IT F  SS ++  V P+ WKG Q H +DILS   I P  +A+GSYDGEIIIWN NSE ASR M QRS    +   +   ++ A + E  + +  +  +E             N+ + ++I      ++S    + S  +   ++ Q ++      + + +LI+LE+R+    GGGANL+SCGGNG VRFWNS+   L+ EF+AH+ + +IIM TD  NQYLVT DMDG I+VWDIL Y  T   ++ I+  P L SQ+Q H D I+ ++   +  R LI ++S+D S ALW++ G  IG FGQE  W++   +    +      E E    VK        D  W PD  AI NP  YRINTW+ T LGKDYQELRV+KRER QPS+IPDLPYL+ E+ G P  GP+
Sbjct:   24 REERKPLGLDQKLENRLTMKDLERLKSSFMVEGEGYDNRLSLNRDQFCEALSLLLKKGSREEYGELFDKIDVTREGIVDWDKFASHMLLEFYERDDRVKSTQVPQWKDLKSLPSPHKEIIQRMTFLKNTSRYIAISKEGCVSMWGIDLKMQRMLRTGTDSCRARDLWVTHFIPLQNINKIALSFTSKEIAIYDLSSKLEFNCQYKIADLLYTPLCLDYWSNPDNANEAVLVWGDLGGFVNILFFNSANIALFERPPAPAGEKQEPCLNVHLHDIVIGKYKNAAYTSYEAHKENGKGEWVREVRYSHYLECFISCATTSPNAVVIGWMEKHSSVNQSVTLSKGGESSRKKGIQRKSEFQISQGVNSFDYHDGLNLIATAGANCHVCLWNPYVVSKPNGVLRGHMASVIQVQFVKNRGQLISFSKDKVLRIWDVQLQVCIQRLAGMFPKGPE---------VSSVLFFDEAKDRSGLDRNRLFITFNYQITVLDMKIEVKDRIMSHEKPIIAVLYNTVYNQLVSLCQAGTLVMWMPDTGQKVKQFSQIHG-NSEVTCMSQDQSQSRLFTGSTDGTVKVWDFNGHCYHLLECAGGQPADVCQILSLKHSILVVGWTKCITVFRNSSLREFHVQPADWKGGQEHVEDILSVDFIGPSTLASGSYDGEIIIWNTNSEHASRHMMQRS----RRGLRSRSKSFALSREPTQVSQTTSYEER-----------MNTFSEKEISSLSKVTSSRRSRAMSKVSLDSNEEQNEFG-----WAVVKLIFLEARRGNSAGGGANLVSCGGNGWVRFWNSSHNSLLAEFLAHQQSGSIIMATDKMNQYLVTADMDGLIKVWDILEYA-TCHVDETIVELPPLKSQFQPHQDMINSLAVFERSDRYLIASASSDCSVALWDIYGNRIGIFGQEEHWRIEPYMPPLQLDENVDFEREREVTVKDLMMDSDEDSQWEPDEAAINNPETYRINTWEKTVLGKDYQELRVQKRERRQPSTIPDLPYLHWERTGAPPAGPY 1014          
BLAST of WD repeat-containing protein 49 vs. TrEMBL
Match: A0A210PY34 (WD repeat-containing protein 49 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT23138 PE=4 SV=1)

HSP 1 Score: 950.273 bits (2455), Expect = 0.000e+0
Identity = 502/1101 (45.59%), Postives = 702/1101 (63.76%), Query Frame = 3
Query:   99 KESHTPLTENKLELKLNIKDLETLQEAFFMDG-SHNRSQHFNGEEFVEALSLVLCKGTREEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTXXXXXXXXXXXXX-KTCTYFSHKAH-QDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHE-------EKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKD-----HKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEM--KEVKKLAEQTMAANAELKRAASNSIQQETDDKLDFIKAEIQNSIANRQXXXXXXXXXXXXXXXXXXXXDTVSDMQVQYKKMDVMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEGWLIGEFVAHENASNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKLGS---XXXXXXXXXXXXHEDEVVKQEEDKYKVDPNWYPDPEAIQNPSGYRINTWKDTNLGKDYQELRVRKRERIQPSSIPDLPYLYGEKIGRPTFGPFYSLNISSFEEIEDIEQPEFMEYPEKFFNETEEFLTKTARVPLLNETLKAVFDERSLLPEYILEFEHKFRNRFQRHLSE 3341
            K+   PL + KLE +L +KDL  LQ AF  +G  ++       ++F EALS++L KGTREEY +LFDK+D+ REG VDW+KFASHMLLEFYEKDDR KS+ +PQWK+LK+L  PHKDVIQ++V ++N N+Y+ +SKEG + +W  D K  +  KT T++C+ RDLW+T F  L N+NK+A++FTSKEIS YDM+ KL+FNCQ K++ L   P+ +DYW +P+N  EA++ WGD GG++NVI +++ + +LFER  + A +K E  + + + D+I     K   Y  H+AH ++WVR+V Y   LECF+SC+T    SMVI WMEK+  ++ T S+   I  S+   R S F + QGIN+F YN+ LNLIATAGVN  VCLWNPYV+SKPNG+LRGHMASV  V F K+R  LISFSKDK+LRIWDVQLQVCIQR AG+FPKG E         +YS +++ E       EK RL ITFN+ LTM+EMK +++D+I SH+KP+I  +YN+ YNQVV+ CQ G +  WM+DTGQ+VK  +   G  AE+TC++QD T T+L+TG+TDG VK+WDFNGH  ++L  A G P D+ Q++ LKR ++V G+++ +T F  S+ +D      +V+PS WKG Q H +DIL  A   P+ + TGSYDGEI++WN NSEQASR ++QRS+ +M     K +   T   N ++ R +    +     + +                               S   + ++   + ++ +  F +SRLI+LESRK    GG ANL+SCGG+G+VRFWN++   L  EF AH N S IIM TD  NQ+LVTGD DG I+VW+I  YC     +  + S P +  Q+Q+H+D I+ I  C +  R+LIIT+S+D S A++++ G  IG FGQE  WK+ +     E          E E  ++EE + +V+  W PD  AI  P  +RINTW  T LGK+YQE RVRKRER QP +IP+LPYL  EK G+   GP+ +L      + +   +P+ +        +T        ++P L +TLK    E+ + P+YIL+FE K ++  +  L++
Sbjct:   32 KQEKKPLMD-KLENRLTMKDLNKLQRAFMTEGDGYDNKLALYRDQFCEALSILLEKGTREEYGELFDKVDVAREGSVDWDKFASHMLLEFYEKDDRVKSTQVPQWKDLKSLPSPHKDVIQKVVFLKNTNKYIAVSKEGTISIWPQDMKQSRSFKTGTDTCKGRDLWITHFCALQNINKLALAFTSKEISIYDMSTKLDFNCQYKIQGLPYTPLTLDYWSNPNNPNEALLVWGDVGGFVNVIFFNSANIALFERPPAPAGEKQEPCLSVQLQDVIGEQTYKNAKYTVHEAHKKEWVRQVRYSQYLECFISCSTTNINSMVIGWMEKH--TSVTPSKNQQI--SKEILRKSEFHIPQGINAFDYNQTLNLIATAGVNHHVCLWNPYVVSKPNGVLRGHMASVIQVHFMKSRAQLISFSKDKVLRIWDVQLQVCIQRLAGMFPKGPE---------VYSCLYFDEQRERSGLEKNRLLITFNYQLTMMEMKAEIRDRIMSHDKPVISAIYNTTYNQVVSVCQSGTLIIWMIDTGQKVKQFSSAHG-NAEVTCLSQDPTGTKLFTGSTDGTVKMWDFNGHNSHSLECAGGQPADVGQVLNLKRSIVVVGWARYVTIFRDSALRDTGALFAQVTPSEWKGGQEHPEDILCCAFTAPNTMVTGSYDGEIVVWNTNSEQASRHLSQRSRRKMLKSRTKSIVSTT---NRDVARVSETDAESRPRSRPN-------------------------------SRPKSTTNGGTKEEQKEFGFAVSRLIFLESRKTNSGGGSANLMSCGGSGMVRFWNTSTSSLAAEFQAHTNGS-IIMATDKLNQWLVTGDADGLIKVWEITEYCMHSQTDVILKSSPPMKCQYQAHTDMINSIDMCERNERSLIITASSDCSVAVFDVRGNKIGVFGQEEHWKIETYDPAEELEDEEGNSEEEPEDEEEEELEVEVESVWEPDERAITEPGTHRINTWDSTCLGKNYQETRVRKRERKQPGTIPNLPYLTWEKTGQAPAGPYSALETQVLLDFDPPSKPDVVS-----MTQTASHPINIPKLPALVDTLKQPVPEKEIFPKYILDFEAKMKSYHKMQLNQ 1077          
BLAST of WD repeat-containing protein 49 vs. Ensembl Cavefish
Match: wdr95 (WD repeat-containing protein on Y chromosome-like [Source:NCBI gene;Acc:103021898])

HSP 1 Score: 259.996 bits (663), Expect = 7.411e-71
Identity = 202/690 (29.28%), Postives = 350/690 (50.72%), Query Frame = 3
Query:  117 LTENKLELKLNIKDLETLQEAFFMDGSHNRSQHFNGEEFVEALSLVLCKGTRE----EYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDD---RTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKT-HTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDY-WHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTXXXXXXXXXXXXXKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVI-CWMEKYNPSNSTSSEMAGIPES--------RGFS------RTSC----FTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCI--QRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDK---ISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDF-NGHCYNTLIVANGNP--VDISQIVILKRC-VLVFGFSKSITAFWTSSFKDHKVS-PSP-WKG--VQTHKDDILSGASIPPHAVATGSYDGEIIIWNINS 2063
            L++ K+E ++++++L  L+ AF  D     ++  +   F + +    C G R+    +  +LF KID + +G V+W++F ++M LE+ EK++   R+K  +      +K LS  H + I +I  + +    +T+ ++G V  W S  +L+K     H      +  W TD   +   NK+ +    +EI  Y+++  LE +CQ+   +L  +P+ +DY +  PD   E  + +GD  G +++IL +++  +L  R+  K   K EN   ISI+  +       TY   K H+DWV KV Y  ++   VS + +  +++VI C +    PS +   +M  I E+         GF       R +C    F++++G+ +F +    NL+ T G++  + +WNPYV   P G+L+GH A +  +      G + S S D   RIWD+Q Q C+        F +G+ +A +           Y      L+I+ +  L +L +K   + +    +SH++ ++ C Y++ + QVV+  +G +I  W VDTG  +       G  A +TC+T D    RL TG  DG ++IW+F NGHC  TL   +G P   D   + + +   V+  G+++ I  +  S+     V  P P W+   ++ H++D+L  A  PP+ +ATGSYDGEII+WN+ S
Sbjct:  131 LSKLKIEQRVSLENLTKLKLAF-EDYEKAGTRSLDLPRFRQTIRR--CLGLRDITDAQIRELFMKIDYSGQGSVEWDEFCTYMQLEYTEKEELVVRSKQVAFALPATMKPLS--HGEPILKIHQISD-GMIVTLKEDGAVSYWSSTLQLRKSKSVFHERPIGRKAKWATDLVTMPQYNKLIIGTGDREIQLYELS-SLEPHCQIN--SLETVPLKLDYCYTGPD---ECAVVYGDAQGCVSIILMTSVGETL--RLWKKLP-KVENVPSISIDHAVQS--PNITYIRWKVHEDWVTKVKYFQSIPAVVSTSNHEASALVIGCIL----PSTNIEQQMREIKEACREGKGKKAGFGVSSPQQRVACDQTVFSIYKGVKTFDFCTTRNLLITGGMDRLIRMWNPYVPGSPTGILKGHSAPIFYLHIATEDGRVFSVSTDNSARIWDIQDQSCLFAAHPKASFLRGELTACL-----------YSPAVRGLYISTD-SLALLSLKTKAEPQGSYTTSHKEAVLCCGYSAGFRQVVSCSEGSVIKVWDVDTGNEMFEFGGAHGLSA-VTCMTFDPKGRRLVTGGRDGCLRIWNFNNGHCLKTLSREDGAPEICDCCYLQVHRNTFVMSVGWARRIDVYLDSAEDTRHVQRPKPAWEDDLMKGHREDVLCVAQCPPYLLATGSYDGEIIMWNLVS 786          

HSP 2 Score: 67.3958 bits (163), Expect = 1.048e-10
Identity = 43/131 (32.82%), Postives = 62/131 (47.33%), Query Frame = 3
Query: 2445 NGIVRFWNSAEGWLIGEFVAHENASNI-----IMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKL 2822
             G V FWN   G   G+FV   NAS +      +     ++ L  GD  GY+ V+DI  +C           PP  ++ W++H   I+G+      S  +++TSS D +  LW + G  IG FGQ  RW L
Sbjct:  838 QGQVHFWNVQNG---GKFVQSFNASRLQQQIRKLAVTADDRLLFAGDDVGYVCVYDI-QHCALALRQ----DPPPTVNFWRAHISSITGLHLIE--SEQVLLTSSTDCTVRLWSITGEFIGTFGQRERWSL 958          
BLAST of WD repeat-containing protein 49 vs. Ensembl Cavefish
Match: ENSAMXT00000043902.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002257.1:21799:28727:-1 gene:ENSAMXG00000036864.1 transcript:ENSAMXT00000043902.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 204.142 bits (518), Expect = 4.071e-58
Identity = 110/293 (37.54%), Postives = 171/293 (58.36%), Query Frame = 3
Query:  129 KLELKLNIKDLETLQEAFFMDGSHNRSQHFNGEEFVEALSLVLCKGTREEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGS-DCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTXXXXXXXXXXXXXKTCTYFSHKAHQ-DWVRKVSYIPNL 1001
            +LE +L+ +DL  +Q  F    S +        EFVE    V+ +G++EEY  LFD +D++REG+V+WE+  S+ LL   EKD+  K++++ +W+  +TL  PH+D +  I  + N  RYLT+SK+G + +W   +  L +  +   ++ R +DLW T    L NV K+AVSFTSKEI FYD+  K +FN Q KL  L   PI + YW+HPD   +A++++GD GG ++ + + +  SSLFER+S        + I IS  ++  G  + C   +H AH   WVR     P++
Sbjct:    8 QLESRLSTEDLMKMQNLFLPSDSSDLPVSMQRAEFVEQAWSVIGRGSQEEYGHLFDSVDVSREGWVNWERLTSYFLLGLSEKDEHIKTTAVLRWRPARTLPVPHRDRLHSITHLPNAGRYLTLSKDGTLTVWEEKNLTLLRSHRLTNDTVRPKDLWATGLVLLPNVQKIAVSFTSKEICFYDLMSK-DFNLQYKLHGLHYTPISLHYWYHPDRPDQAVLSFGDAGGQVSGVCFRSALSSLFERLS--VGGMQGSAISISWAELQQGRHRCCYTLTHTAHMGQWVRTGQSHPSI 297          
BLAST of WD repeat-containing protein 49 vs. Ensembl Cavefish
Match: si:dkey-202c14.3 (si:dkey-202c14.3 [Source:ZFIN;Acc:ZDB-GENE-121214-357])

HSP 1 Score: 161.77 bits (408), Expect = 8.140e-40
Identity = 155/639 (24.26%), Postives = 274/639 (42.88%), Query Frame = 3
Query:  222 GEEFVEALSLVLCKGTREE-----YSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRT--KSSSLPQWKELKTLSGPHKDVIQRIVLVRNLN--RYLTISKEGNVGLWGSDCKLQKVAKTHTESC----------RSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTXXXXXXXXXXXXXKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGC-LYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDF-NGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPS-PWKGVQTHKDDILSGASIP-PHAVATGSYDGEIIIWNINSEQ 2069
            G   +E L   L     EE       +L +++D++ EG   WEK  +++L +    +D +  K S +     ++      ++ + RIV V      RY+TISK G + +W S   LQ +     E C          R    W+TD  ++ N++KVAV+  S++I   D++       +  L  L  +   + YW++ +          D  G  +++ +                                         S K H + + ++ Y P  E  ++ + + ++S+VI  M+    S                     + + +GI  F  + +L L+ TAG++  + +WN YV S+P  +L GH  +V DV  ++    + S+SKD +L++WD+  Q C++  +  FP  Q +    P    +  +        L I+    L++L +    ++  S+       C LY     QVVTAC    +  W V+TG++   +    G Q E+T +T D +Q RL T A++G +K+W   NG   + L   +   V    I +    +L  G+S+ +  +      D  V     WK  + H +DIL+         +ATGSYDGEII+W +++++
Sbjct:   67 GSSDLEQLRTALTAEVGEESWNSSLEELVNELDLSCEGGDGWEKLCTYVLQKSAHNEDLSEPKQSIISSDPLIRHCRHVKREPVTRIVEVSQPPPLRYITISKGGTLTVWNSS-SLQAIRSL--ELCGGAGETGGSGRQFRGWITDAVYMPNIHKVAVASMSRDIHLIDVSSSACIQ-ESHLYGLGHVATALCYWYNVE----------DICGQNSLVSYQQ---------------------------------------SPKLHSEPINRIRYEPEAELIITSSESESSSLVIVDMKHRRESY-------------------IWKIEKGILCFDISWSLGLLVTAGLDPALRIWNRYVTSRPAAVLHGHRTTVVDVVIHQTLDKIFSYSKDAVLKMWDICSQQCVKTLSLRFPNIQPACF--PEQGSFPLLLSLAAAPALLISCREYLSLLRL----QNPTSNCRPSTFSCTLYIPKLKQVVTACAKSSVVVWDVNTGRKCMELNNAHG-QEEITAMTADPSQRRLITAASNGTIKVWSLQNGRPLHKLEAVSDAEV-TGVICLHDDQLLAVGWSRLVARYSIGGSHDMYVKADVSWKSGRLHSEDILAADHCAGKRLLATGSYDGEIIVWTLDTQR 625          

HSP 2 Score: 62.3882 bits (150), Expect = 3.050e-9
Identity = 43/159 (27.04%), Postives = 72/159 (45.28%), Query Frame = 3
Query: 2367 ISRLIYLESRKKIKHGGGANLISCGGNGIVRFW-------NSAEGWLIGEFVAHENASNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKL 2822
            I RL++L+ R + +      L+     G + +W       N A+ ++        NA    + T+  N  L+TGD  G I+VW+I  Y   + +      PP L+  W++H + +  +          +++ S D +A LW   GV +G FGQE  W L
Sbjct:  642 IDRLLFLQKRVEDQQWRNRALLLSSQAGYICWWSICGPTHNHAKFYVPQREDERVNA----LRTNHDNSLLITGDTTGSIQVWNISQYGLYDGDEVVSEQPP-LVHTWRAHEEAVVSMEVLEHGKDLFLVSVSVDLNACLWTSCGVCVGSFGQELLWDL 795          
BLAST of WD repeat-containing protein 49 vs. Ensembl Cavefish
Match: si:dkey-202c14.3 (si:dkey-202c14.3 [Source:ZFIN;Acc:ZDB-GENE-121214-357])

HSP 1 Score: 119.398 bits (298), Expect = 1.364e-27
Identity = 87/310 (28.06%), Postives = 143/310 (46.13%), Query Frame = 3
Query: 1155 GINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDF-NGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAF--WTSSFKDHKVSPS-PWKGVQTHKDDILSGASIP-PHAVATGSYDGEIIIWNINSEQ 2069
            GI  F  + +L L+ TAG++  + +WN YV S+P  +L GH  +V DV  ++    + S+SKD +L++WD+  Q C++  +  FP  Q +             F  +    L ++       L   P                        VVTAC    +  W V+TG++   +    G Q E+T +T D +Q RL T A++G +K+W   NG   + L   +   V    I +    +L  G+S+ +  +    S  +D  V     WK  + H +DIL+         +ATGSYDGEII+W +++++
Sbjct:    9 GILCFDISWSLGLLVTAGLDPALRIWNRYVTSRPAAVLHGHRTTVVDVVIHQTLDKIFSYSKDAVLKMWDICSQQCVKTLSLRFPNIQPAC------------FPEQGSFPLLLS-------LAAAP------------------------VVTACAKSSVVVWDVNTGRKCMELNNAHG-QEEITAMTADPSQRRLITAASNGTIKVWSLQNGRPLHKLEAVSDAEV-TGVICLHDDQLLAVGWSRLVARYSIGGSHVRDMYVKADVSWKSGRLHSEDILAADHCAGKRLLATGSYDGEIIVWTLDTQR 273          

HSP 2 Score: 62.3882 bits (150), Expect = 2.455e-9
Identity = 43/159 (27.04%), Postives = 72/159 (45.28%), Query Frame = 3
Query: 2367 ISRLIYLESRKKIKHGGGANLISCGGNGIVRFW-------NSAEGWLIGEFVAHENASNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKL 2822
            I RL++L+ R + +      L+     G + +W       N A+ ++        NA    + T+  N  L+TGD  G I+VW+I  Y   + + Q     P L+  W++H + +  +          +++ S D +A LW   GV +G FGQE  W L
Sbjct:  290 IDRLLFLQKRVEDQQWRNRALLLSSQAGYICWWSICGPTHNHAKFYVPQREDERVNA----LRTNHDNSLLITGDTTGSIQVWNISQYGLYDGDEQ-----PPLVHTWRAHEEAVVSMEVLEHGKDLFLVSVSVDLNACLWTSCGVCVGSFGQELLWDL 439          
BLAST of WD repeat-containing protein 49 vs. Ensembl Cavefish
Match: ENSAMXT00000007963.2 (WD repeat-containing protein 5-like [Source:NCBI gene;Acc:103023146])

HSP 1 Score: 53.1434 bits (126), Expect = 9.698e-7
Identity = 46/221 (20.81%), Postives = 97/221 (43.89%), Query Frame = 3
Query: 1152 QGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDK-ISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFN-GHCYNT 1808
            + I+S  ++ N   +A++  +  + +W  +   K    L GH   ++DV ++     L+S S DK L+IWD+    C++       KG  +        ++   F  +  L +  +F+  + + ++K     K + +H  P+    +N   + +V++   G+   W   +GQ +KT+ +   P       + +     +     D  +K+WD++ G C  T
Sbjct:   43 KAISSVKFSPNGEWLASSSADKLIKIWGSF-DGKFEKSLSGHKLGISDVAWSPDSNLLVSASDDKTLKIWDMGSGKCLKTL-----KGHSN-------YVFCCNFNPQSNLVVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCLKTLIDDDNPPVSFVKFSPNG--KYILAATLDNTLKLWDYSKGKCLKT 248          

HSP 2 Score: 50.447 bits (119), Expect = 6.767e-6
Identity = 60/280 (21.43%), Postives = 118/280 (42.14%), Query Frame = 3
Query: 1251 KPNGLLR----GHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDK-ISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWD-FNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHA-VATGSYDGEIIIWNINSEQ 2069
            KPN  L+    GH  +++ V+F+     L S S DK+++IW            G F    E +L   ++ +    +  +  L +  + +  L + +M      K +  H   +  C +N   N VV+      +  W V TG+ +KT+     P   ++ +  +   + + + + DG  ++WD  +G C  TLI  +  PV   +     + +L      ++  +  S  K  K     + G +  K  + +  S+     + +GS D  + IWN+ +++
Sbjct:   29 KPNYTLKFTLAGHTKAISSVKFSPNGEWLASSSADKLIKIW------------GSFDGKFEKSLSGHKLGISDVAWSPDSNLLVSASDDKTLKIWDMGSGKCLKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGKCLKTLPAHSDP---VSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKT----YTGHKNEKYCVFANFSVTGGKWIVSGSEDHMVYIWNLQTKE 289          
BLAST of WD repeat-containing protein 49 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005521.1 (pep scaffold:Pmarinus_7.0:GL477585:56150:70911:-1 gene:ENSPMAG00000005018.1 transcript:ENSPMAT00000005521.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.05 bits (362), Expect = 2.140e-36
Identity = 98/326 (30.06%), Postives = 158/326 (48.47%), Query Frame = 3
Query: 1188 NLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDV---KDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAE--LTCITQDSTQTRLYTGATDGNVKIWDF-NGHCYNTLIVANGNP--VDISQIVILK-RCVLVFGFSKSITAFWTSSFKDHKVS-PSP-WKG--VQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTM----TQRSQDEMKE 2114
            +L+ T G++  V LWNPYV  +P G+LRGH + +  +   +    + S   D+ +++WD Q Q C+     V PK   S L        S   Y      L +    G+ +L ++  +       +SH +P+  C Y++ + QVV+  +  ++  W +D+G       E CG   E  +TC+  DS+  RL TG  DG +K+W++ NG C  TL          D + +V+ K + ++  G+ K I  F  S      +  P P W     + H++D+L  A  PP  +AT SYDGE+I+WN+ S   S  +     QRS D  ++
Sbjct:   12 SLVVTGGMDRTVRLWNPYVPGRPTGVLRGHTSPICYLSICEETSRIFSVGSDRNVKVWDAQEQTCL---CSVSPK--MSGLRGE----VSACHYLPAARALCVATEGGVALLSVRDGLHMDAGAATSHREPVRCCRYSAEFRQVVSCSEDSVVKLWDLDSGL---PTFEFCGAHGESAITCMAFDSSGRRLITGGRDGCLKVWNYNNGQCLRTLRKQRNAEEICDCTYVVVNKNKYIISVGWDKRINIFLDSQEDQQLIQFPQPHWADDLRKGHREDVLCVAQCPPSLLATSSYDGEVIVWNLVSGHVSCRLPPPPAQRSADPAED 325          

HSP 2 Score: 77.7962 bits (190), Expect = 7.512e-15
Identity = 44/156 (28.21%), Postives = 78/156 (50.00%), Query Frame = 3
Query: 2361 FNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEGW-LIGEFVAHENASNII-MNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKL 2822
             ++S++I+L+SR   K    A L++ G  G + FWN   G  L   F A      +  + + + +  L+  D  G++  WD+ SY     E +    PP L+S W++H   I+ +    +    L++T++ D S  LW ++G  +G FGQ+  W +
Sbjct:  328 LSVSKVIFLKSRVAHKDRA-ALLVASGPRGFIHFWNVYHGGRLFARFPAGRQGRPVCCLASALGDSVLLAADQTGHVYAWDVSSYAMQGPEEE----PPQLVSLWRAHVSAITSMDVIEEHK--LLLTAALDCSVRLWSVDGAFVGTFGQDTLWDI 476          
BLAST of WD repeat-containing protein 49 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008862.1 (pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 gene:ENSPMAG00000008000.1 transcript:ENSPMAT00000008862.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 6.106e-7
Identity = 30/119 (25.21%), Postives = 59/119 (49.58%), Query Frame = 3
Query: 2418 GANLISCGGNGIVRFWNSAEGWLIGEFVAHENASNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWEL 2774
            G +++S   +  +R W++  G  +   V H++ ++     ++ +  LV+G+ D  +++WDI    +T    Q +  P         H   ++    C +FSR L++TSS D +  LW+L
Sbjct:  404 GVHIVSGSLDTSIRVWDAETGTCLHTLVGHQSLTS---GMELRDNILVSGNADSTVKIWDI----KTGQCLQTLQGP-------NKHQSAVT----CLQFSRKLVVTSSDDGTVKLWDL 504          
BLAST of WD repeat-containing protein 49 vs. Ensembl Nematostella
Match: EDO44327 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW01])

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 298/655 (45.50%), Postives = 410/655 (62.60%), Query Frame = 3
Query:  129 KLELKLNIKDLETLQEAFFMDGS-HNRSQHFNGEEFVEALSLVLCKGTREEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHTES--CRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTXXXXXXXXXXXXXKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTM 2084
            KL  +L + DL+ +Q+AF ++ S   R    + ++F E LS+VL KG REEY +LF+KID+ +EG+VDW+KF+SHMLLE+YEKDDR K++ +PQW+EL+ +S PHK+VI+RI  + N +RYL++SKEG + LW    K  +  +   +    + RDLWVTDF  + N+ K+A++ TSKEI+ YD++ K EFNCQ +++NL   P+C+DY + PD   EAI+A+GD  G +N +L+S ++ +LF+R +  A  K                                 +V Y  +L+CF+SC+T++  S+V+ W+EK      T S M          RT+ F + QG+N+F YNE  NL+ATAGVN  VCLWNPYVISKP G+LRGHM SV  V F ++RG LIS SKDK+LRIWD  LQVC+QR +G+FPKG     +         MFY EE  +LF  FN  LT++ MKP+VKD++ SHE+P+   +YNS +NQVVTAC G +I  WM+DTGQ+VK      G  AE+T ITQD+T+TRL+T + DG VKIWDFNGHC++ L+  NG+P +IS                                       Q H+DDILS A  PP  +A+ SYDGEI+IWN+NSEQASR +
Sbjct:   40 KLVSRLTMHDLKAIQDAFTINQSGQQRELSLDVDQFCEILSIVLNKGVREEYEELFNKIDVAKEGFVDWDKFSSHMLLEYYEKDDRMKTTQVPQWRELRNISSPHKEVIRRISPLINPSRYLSVSKEGILCLWSLGMKQLRTVQVQPDQDEVKQRDLWVTDFIPMQNLYKLAIALTSKEIAIYDLSSKSEFNCQFRIKNLDDTPLCLDYCN-PDKPNEAILAFGDVSGQVNALLFSAVNIALFDRPAQPAGSK---------------------------------QVMYSAHLDCFISCSTSYKGSLVLGWIEK------TKSNM----------RTTAFKIPQGVNAFDYNEKANLVATAGVNHHVCLWNPYVISKPVGVLRGHMQSVVAVHFIESRGQLISLSKDKVLRIWDTHLQVCLQRLSGMFPKGPAEVSIT--------MFYDEEHSKLFTAFNQQLTLMVMKPEVKDRVMSHEQPVTAAIYNSKFNQVVTACAGSVITMWMIDTGQKVKQFANAHG-NAEITTITQDATETRLFTASADGTVKIWDFNGHCHSILMAGNGDPAEIS---------------------------------------QEHQDDILSVAYSPPTTIASASYDGEIVIWNMNSEQASRHL 596          

HSP 2 Score: 244.973 bits (624), Expect = 8.458e-67
Identity = 136/327 (41.59%), Postives = 194/327 (59.33%), Query Frame = 3
Query: 2352 DVMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEGWLIGEFVAHENASNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKLGSXXXXXXXXXXXXHEDEVVKQEEDKYKVDPNWYPDPEAIQNPS---GYRINTWKDTNLGKDYQELRVRKRERIQPSSIPDLPYLYGEKIGRPTFGPFYSLNISSFEEIEDIEQPEFMEYPEKFFNETEEFLTKTARVPLL---NETLKAVFDERSLLPEYILEFEHKFR 3314
            D+   +++LI+L SR       GANL+SC G+GIVRFWNS +   + EF+AH++A ++ M  D +N YLVTGD DG I+VWDI  YC  E +N  I  PP L+ Q+Q H+D I+ I    +  R L++T+S+D SAALW++ G  IG FGQE  WK+  I E    A  +  E+E   +EE +   D       +   N      YR++TW  T LGK Y E R  KRER QP SIPDLPYL  EK G+   GP+ +L  +   ++  I +P+F+ +PEK+F+E +    ++  +P L    E L+  +D++SL P+ ILE E K +
Sbjct:  618 DIGSAVTKLIFLNSRPLPTSSPGANLVSCCGSGIVRFWNSQKHAFLAEFLAHQHAGSLTMAVDGTNSYLVTGDADGLIKVWDISEYCVEEPDN-TITQPPPLLKQFQPHTDIINHIGLLTRNERLLVLTASSDCSAALWDIEGRQIGVFGQEEHWKIEPISEEERKAEQQRLEEEEESEEELEQNQDAEETGQADYFNNEDFDPEYRMSTWDRTILGKAYMETRSEKRERRQPMSIPDLPYLNWEKTGQAPAGPYAALETAELADVGTISKPDFVSHPEKYFSERQSAGKRSKALPPLPSITERLQMRYDDKSLFPKSILEMEAKMK 943          
BLAST of WD repeat-containing protein 49 vs. Ensembl Nematostella
Match: EDO38627 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCA8])

HSP 1 Score: 255.758 bits (652), Expect = 4.564e-72
Identity = 189/635 (29.76%), Postives = 311/635 (48.98%), Query Frame = 3
Query:  273 EEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDD---RTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSL--------FERVSSKASDKDENTXXXXXXXXXXXXXKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVI------CWMEKYNPSNSTSS-----EMAGI-----PESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPK-----GQESAL-MNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDF-NGHCYNTLIVAN--GNPVDISQIVILK-RCVLVFGFSKSITAFWTSSFKDHKVSPS--PWKG--VQTHKDDILSGASIPPHAVATGSYDGEIIIWN 2054
            ++ + LF KID + +G ++W++F + M LE+ EK++   R+K +S  Q   L   S   + VI+  V   + N +L +S++G V  W  + + +++   H ES   +  W+TD+  + + NK  +S   +EI F++++   E  CQ+    L   P+ +DY     +  E I+ +GD+ G +N+ +  +   +L         E ++S   D   N+             +   +   K H DWV ++ Y  +L   +SC+ +  T++VI        +E     N+TS       +A +     P  R  S  + F V++G+ +F + +  NLI T G++  V +WNPYV SKP G+LRGH A +  +        + S S DK +++WD+  Q C+     V PK     G  SA+  NP              L +  +    L  L+ KP  +D  ++H++ +    YN  +  VVTA +G +   W V+TG  V    ++ G  A +TC+  DST+ RL +G  DG ++IW++ NGHC  TL          D++ IV+ K R ++  G+ + I  F   +   H V      W    +  HK+DILS A  PP+ +AT SYDGEIIIWN
Sbjct:   33 DQMTALFMKIDSSSDGEINWDEFCTFMQLEYAEKEESYFRSKETSF-QLPALTENSSQREQVIR--VCHTSDNNFLVVSQDGLVSFWSQNLEFKRMK--HIESSSKKTKWITDYVLMPHFNKFIISTGDREIQFFELST-FEPYCQIS--GLETTPLRVDYC--SPSTDECIIIYGDSQGCVNIFIMHSTGETLRNWKKMPKVEGIASVNIDSVVNS-------------ENTKFIRWKVHNDWVAQLKYYDSLRAVISCSNHQETALVIGQTTGSTHIEAQLRENTTSQGERKKNVAAVVRDNQPRRRLDSDQTVFRVYKGVKTFDFCKEKNLIVTGGMDRLVRMWNPYVPSKPTGILRGHTAPIFHLFIVAEDDRIFSISTDKTVKVWDLHDQSCL---LTVRPKAHKIRGDVSAIHYNPS----------SRGLAVATSDQVALLPLKTKPSARDMTTTHKEAVTCLKYNKSFKHVVTASEGSVCRVWDVETGHAVFEFNQLHGDTA-ITCMAFDSTERRLISGGRDGRLRIWNYNNGHCIRTLEKEKDIDEVTDLTYIVMHKNRYIISVGWDRRINVFSDDTDDFHHVQRPYIDWSDDLLNGHKEDILSVAVCPPNLLATSSYDGEIIIWN 630          
BLAST of WD repeat-containing protein 49 vs. Ensembl Nematostella
Match: EDO36438 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIN2])

HSP 1 Score: 184.882 bits (468), Expect = 2.129e-47
Identity = 165/634 (26.03%), Postives = 284/634 (44.79%), Query Frame = 3
Query:   99 KESHTPLTENKLELKLNIKDLETLQEAFFMDGSHNRSQH--------FNG-EEFVEAL-SLVLCKGTREEYSDLFDKIDITREGYVDWEKF-----ASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPHK--DVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDY--WHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTXXXXXXXXXXXXXKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKP---DVKDKIS---SHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDF-NGHCYNTLIVANGNPVDISQIVIL-------KRCVLVFGFSKSIT 1901
            + S  P T      KL + D + ++E  ++D   N  +          NG E F EA+ +L     + ++   LF KI +  +  VDW +       +  + +    +D +   +  + K +    G  K  D++Q I+ V   + Y+T S++G +  W           ++ ES      WVT   FL ++ ++A + + + I+ +D   K + +   +++ +   P CM    W     N + I+ +GD  GY+N++    ISS      +S A  K ++ ++    + +   IK   +F      DWV K+ Y P LE F  C+                P +S S  + G+             V +G+N F Y    N+I TAG +  V +W+P + ++P G L GH+ ++ ++  N+    LIS S  ++ R+WD+Q   C+Q    VF   +E     P     S M +  +  RL      G ++++  P    ++D +    +H++P+   LYN   NQV++ C  G++  W ++TGQ V  +T+  G   E+T +  D+T  RL TGA DG++K WDF +G  Y             + I  L       KRCVLV  + + IT
Sbjct:    5 QNSSRPYTSGSFRTKLELFD-KFIKEFTYVDEELNPEERRQILQDRLTNGYEPFCEAIRNLFGNDVSTQDLKALFRKIALNPDAKVDWSELFGIGGPTDEVPDLLLNEDTSSVLTTSKRKTVAEAGGDKKRRDIVQSILHVPKYDFYITASQKGIICQW-----------SNKESS-----WVTGCGFLPSLRRIAAT-SERAIALWDYRAKRKQSTIYQIKPMENSPQCMTCIPWKANSMNEDTIL-FGDDQGYVNIL---TISSKDLHMKNSSA--KGDSAVVTIEPNKLSSEIKRRKFF-----DDWVLKIKYFPQLEMFGCCS----------------PGSSCSFILGGVDRVLNNGPVRELGVPKGVNCFDYCTRANVIVTAGADKIVRIWHPLIFTRPTGKLLGHLFTIVEIAVNEKDQQLISLSTARVFRVWDLQTLTCLQ----VFTDNEE----RPGEKRISAMLFDAKHDRLIT----GCSVIDTWPLTRAIQDSLQVPHTHDRPISQLLYNPQMNQVISVCTEGVMKVWEMETGQMVYQVTDAHGTSNEVTAMNVDNTGYRLITGAYDGSIKAWDFGSGQLYKKYPDEPAKKRQENTITGLVYHTVDNKRCVLVSSWGQGIT 581          

HSP 2 Score: 52.7582 bits (125), Expect = 1.105e-6
Identity = 41/141 (29.08%), Postives = 64/141 (45.39%), Query Frame = 3
Query: 2427 LISCGGNGIVRFWNSAEGWLIGEF--VAHENASNII-MNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQ---WQSHSDEISGISFCFKFSRTLIITSSADQSAALWELN-GVLIGRFGQEHRWKLGS 2828
            L+S   +G +RFW +  G L+ E   V    AS +  + TD   +++++GD  GY+ VWD                   +I Q   W++H   + G+      S   ++T+S D S  +W  + G  IG FGQ   W L S
Sbjct:  787 LVSAHHDGYLRFW-TLSGRLLTEIRAVTRRQASAVTSLCTDADCRHVISGDAKGYVTVWD------------------NVIKQVVCWRAHLTRVVGVEHV--DSADAVVTASTDLSVRVWYRDTGHFIGFFGQPRLWHLPS 906          
BLAST of WD repeat-containing protein 49 vs. Ensembl Nematostella
Match: EDO38985 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBD6])

HSP 1 Score: 140.969 bits (354), Expect = 8.730e-34
Identity = 129/467 (27.62%), Postives = 211/467 (45.18%), Query Frame = 3
Query: 1590 NSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDF-NGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANAELKRAASNSIQQETDDKLDFIKAEIQNSIANRQXXXXXXXXXXXXXXXXXXXXD----------------TVSDMQVQYKKMDVMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEGWLIGEFVAHENA--SNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQ---------------------------------KIMS----PPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKL 2822
            N  Y +VV+AC   ++  W ++TG+++   +      +E+T ++ D ++ RL TGA DG+VKIW+F NG C   L   +    +I+ I+  K+ ++  G+SK++  F  +   D +  P  W+    H DDILS A   P  VAT SYDG + IWN ++   S  +            K    T   N    R +++ I     D  + + A + +S  ++    S  +++ S    +S   D                 + D++V+    D +  +  +++L+ R+   H   A L++ G  G VR W    G L+G+F+A ++   S   + TD  N  LVT D  GY+RVWDI  Y   ESE                                   KI +    PP L+ ++++H   +  +S  F   + LI+T+S D SA LW   G  +G FGQ+  W +
Sbjct:  358 NLPYLKVVSACHESVVCVWSLETGEKIIQFSN-AHDDSEITAMSFDPSKRRLVTGARDGSVKIWNFNNGACLRVLHQVDDE--EITGILCHKQHIITVGWSKNVI-FHRNCRDDEEDVPRVWRAF--HADDILSIALYHPSLVATSSYDGCVKIWNADTGHMSCLL---------NTNKYHSNTAGNNG---RISTSGILI---DSYEILSACVASSRLSQGHRPSSRSASRSGNRRSSLFRDPTLIAMSRPNSRLITPILPDIEVRESDHDSV--VENVLFLQKRE--SHRQTATLVTSGSGGWVRLWTLFGGELLGQFMAAQSGKESVTALTTDSDNTMLVTADTLGYVRVWDISCYYIKESEKPPPKENPEERSDEDKHRQSAARRRANLRRDNLPLKIGNVSCVPPPLLCKFRAH--LMCVVSLDFVSGKNLIVTASTDCSARLWTSAGRYVGTFGQKVLWDI 797          

HSP 2 Score: 73.559 bits (179), Expect = 4.307e-13
Identity = 70/240 (29.17%), Postives = 97/240 (40.42%), Query Frame = 3
Query:  945 FSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGIPESRGFSRTSCFTVHQGINSFAYNENLNLIA----------------TAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMK---PDVKDKISSHEKPLIGCLYNSLYNQ 1607
             S   H DWVRKV Y P L+CF+SCAT+   SM +  +++                       S F   +GI SF Y +  N+I                 T G++  V LWNPYV SK    L         V F      +IS S DK+      Q++V I+    + P            I +    +    L +  T    L++LE K   P  + +I SH KPL   LYN L++Q
Sbjct:    1 MSQGLHNDWVRKVKYYPTLQCFISCATSSENSMYLGDVDRKK-------------------TCSMFRTRKGITSFDYCKEWNVIGKNMLHTYMYMLKHVKVTGGLDHYVRLWNPYVTSKSTSTLV--------VPFMINAITIISASMDKV-----KQMRVLIR---AIGPT-----------IDHCDTLFMISALTIISTAVDKLSVLEGKNDEPSEECEIMSHTKPLCAALYNDLFDQ 194          
BLAST of WD repeat-containing protein 49 vs. Ensembl Nematostella
Match: EDO38984 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBD4])

HSP 1 Score: 115.931 bits (289), Expect = 4.780e-28
Identity = 79/259 (30.50%), Postives = 128/259 (49.42%), Query Frame = 3
Query:  129 KLELKLNIKDLETLQEAFFMDGSHNRSQHFNGEEFVEALSLVL-CKGTRE--EYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKE-LKTLSGPHKDVIQRIVLV------------RNLNRYLTISKEGNVGLWGSDCKLQKV--AKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFE 851
            +LE ++N + LE LQ   F +   +     + EEF  A+   + CK   +  + +  F K+D   +G VDWE+F S+MLLE   KD  T      ++    + +   H+D I RI                N+ RY+T+S+EG +  W  D    +       +E   S+ +W+TD   L N  K+AVS   +EI+FYD +       Q  L  L    +CMDYW+ P +  ++I+ +GD+GG ++ I +S ++  LF+
Sbjct:   50 RLEDQMNNEHLEVLQR-IFEEADEDGGGGLDYEEFRRAMIKTMSCKEVPDDNQLAITFMKVDANCDGTVDWEEFCSYMLLENQLKDVMTSDEREMEFPHPAREIPSAHRDNIARITYFAKMSHGPDESGDNNVGRYVTVSREGVLHFWSMDLNPIRTITVSNASEGKASKSVWITDCVVLPNAKKIAVSSADREIAFYDCSAN-SVEKQFVLSGLENCALCMDYWYDPRHPNQSILLFGDSGGKVSCIKFSAVNLGLFD 306          
BLAST of WD repeat-containing protein 49 vs. Ensembl Medaka
Match: ENSORLT00000015414.2 (WD repeat-containing protein 64 [Source:NCBI gene;Acc:101165086])

HSP 1 Score: 307.76 bits (787), Expect = 2.515e-92
Identity = 175/482 (36.31%), Postives = 269/482 (55.81%), Query Frame = 3
Query:  111 TPLTENKLELKLNIKDLETLQEAFFMDGSHNRSQHFNGEEFVEALSLVLCKGTREEYSDLFDKIDIT--------------REGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGS-DCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTXXXXXXXXXXXXXKTCTYF-SHKAHQD-WVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFN 1505
            T +   +LE ++N KD   LQ + F+D S  + +  +  EF+        +G+++EY  LFD + +T              +EG+VDW    S +L E + K ++TK  ++P WK  +TL+ PH+D +Q+++ +++ ++YLT+SK G V LW   D  +    +    +  SRDLWVTD   L NV K+AVSFT +E+ FYD+  K +F C+ KL+ L   P C+DYW  P +  +A++  GDTGG ++ + +++  +SLFE   S+    D ++  +   D +     +C    +HKAH   WVRKV Y+ +L  F SC+T   +SMVI W +                E  G  R + +   +G+    Y+   NLIATAG++ QV LWNPYV S+P   L GH+  VT V+F + +  L+SFSKDK+L +WDV  Q+C+QR AGVFPK QE          ++ +F  EE+  L ++FN
Sbjct:    3 TAVEVGQLESRMNAKDYMHLQ-SIFVDCS-GKPRSLSRTEFIHLAWRSADRGSKQEYGLLFDSVVVTQKSSSLLHSSDEVKKEGHVDWGALCSFLLEETWRKLNQTKDFNVPLWKPRRTLTCPHRDSVQKVLYLQSSDQYLTVSKGGKVVLWQEVDLSVLSTCRLQNSTVASRDLWVTDVVLLQNVQKIAVSFTCEEVCFYDLRSKQDFPCKYKLQGLRFAPWCLDYWMDPCDADQAVLTIGDTGGQVSALHFTSAQTSLFE---SRCLQLDSDSAKVVSWDQLVKGRHSCCRMETHKAHAPAWVRKVLYLSSLRAFASCSTRPQSSMVIGWRD----------------EGAGKMRITSYVTRKGVWDIDYHRQWNLIATAGLDDQVLLWNPYVTSEPVCALAGHLNEVTAVRFMQTKDQLLSFSKDKVLCLWDVSSQLCVQRVAGVFPKVQEDT--------HTLLFLREERQHLLLSFN 455          
BLAST of WD repeat-containing protein 49 vs. Ensembl Medaka
Match: ENSORLT00000043076.1 (WD repeat-containing protein 64 [Source:NCBI gene;Acc:101165086])

HSP 1 Score: 307.76 bits (787), Expect = 2.515e-92
Identity = 175/482 (36.31%), Postives = 269/482 (55.81%), Query Frame = 3
Query:  111 TPLTENKLELKLNIKDLETLQEAFFMDGSHNRSQHFNGEEFVEALSLVLCKGTREEYSDLFDKIDIT--------------REGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGS-DCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTXXXXXXXXXXXXXKTCTYF-SHKAHQD-WVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFN 1505
            T +   +LE ++N KD   LQ + F+D S  + +  +  EF+        +G+++EY  LFD + +T              +EG+VDW    S +L E + K ++TK  ++P WK  +TL+ PH+D +Q+++ +++ ++YLT+SK G V LW   D  +    +    +  SRDLWVTD   L NV K+AVSFT +E+ FYD+  K +F C+ KL+ L   P C+DYW  P +  +A++  GDTGG ++ + +++  +SLFE   S+    D ++  +   D +     +C    +HKAH   WVRKV Y+ +L  F SC+T   +SMVI W +                E  G  R + +   +G+    Y+   NLIATAG++ QV LWNPYV S+P   L GH+  VT V+F + +  L+SFSKDK+L +WDV  Q+C+QR AGVFPK QE          ++ +F  EE+  L ++FN
Sbjct:    3 TAVEVGQLESRMNAKDYMHLQ-SIFVDCS-GKPRSLSRTEFIHLAWRSADRGSKQEYGLLFDSVVVTQKSSSLLHSSDEVKKEGHVDWGALCSFLLEETWRKLNQTKDFNVPLWKPRRTLTCPHRDSVQKVLYLQSSDQYLTVSKGGKVVLWQEVDLSVLSTCRLQNSTVASRDLWVTDVVLLQNVQKIAVSFTCEEVCFYDLRSKQDFPCKYKLQGLRFAPWCLDYWMDPCDADQAVLTIGDTGGQVSALHFTSAQTSLFE---SRCLQLDSDSAKVVSWDQLVKGRHSCCRMETHKAHAPAWVRKVLYLSSLRAFASCSTRPQSSMVIGWRD----------------EGAGKMRITSYVTRKGVWDIDYHRQWNLIATAGLDDQVLLWNPYVTSEPVCALAGHLNEVTAVRFMQTKDQLLSFSKDKVLCLWDVSSQLCVQRVAGVFPKVQEDT--------HTLLFLREERQHLLLSFN 455          
BLAST of WD repeat-containing protein 49 vs. Ensembl Medaka
Match: ENSORLT00000037247.1 (WD repeat-containing protein 64 [Source:NCBI gene;Acc:101165086])

HSP 1 Score: 307.76 bits (787), Expect = 2.515e-92
Identity = 175/482 (36.31%), Postives = 269/482 (55.81%), Query Frame = 3
Query:  111 TPLTENKLELKLNIKDLETLQEAFFMDGSHNRSQHFNGEEFVEALSLVLCKGTREEYSDLFDKIDIT--------------REGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGS-DCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTXXXXXXXXXXXXXKTCTYF-SHKAHQD-WVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFN 1505
            T +   +LE ++N KD   LQ + F+D S  + +  +  EF+        +G+++EY  LFD + +T              +EG+VDW    S +L E + K ++TK  ++P WK  +TL+ PH+D +Q+++ +++ ++YLT+SK G V LW   D  +    +    +  SRDLWVTD   L NV K+AVSFT +E+ FYD+  K +F C+ KL+ L   P C+DYW  P +  +A++  GDTGG ++ + +++  +SLFE   S+    D ++  +   D +     +C    +HKAH   WVRKV Y+ +L  F SC+T   +SMVI W +                E  G  R + +   +G+    Y+   NLIATAG++ QV LWNPYV S+P   L GH+  VT V+F + +  L+SFSKDK+L +WDV  Q+C+QR AGVFPK QE          ++ +F  EE+  L ++FN
Sbjct:    3 TAVEVGQLESRMNAKDYMHLQ-SIFVDCS-GKPRSLSRTEFIHLAWRSADRGSKQEYGLLFDSVVVTQKSSSLLHSSDEVKKEGHVDWGALCSFLLEETWRKLNQTKDFNVPLWKPRRTLTCPHRDSVQKVLYLQSSDQYLTVSKGGKVVLWQEVDLSVLSTCRLQNSTVASRDLWVTDVVLLQNVQKIAVSFTCEEVCFYDLRSKQDFPCKYKLQGLRFAPWCLDYWMDPCDADQAVLTIGDTGGQVSALHFTSAQTSLFE---SRCLQLDSDSAKVVSWDQLVKGRHSCCRMETHKAHAPAWVRKVLYLSSLRAFASCSTRPQSSMVIGWRD----------------EGAGKMRITSYVTRKGVWDIDYHRQWNLIATAGLDDQVLLWNPYVTSEPVCALAGHLNEVTAVRFMQTKDQLLSFSKDKVLCLWDVSSQLCVQRVAGVFPKVQEDT--------HTLLFLREERQHLLLSFN 455          
BLAST of WD repeat-containing protein 49 vs. Ensembl Medaka
Match: ENSORLT00000004931.2 (pep primary_assembly:ASM223467v1:13:8822834:8840121:-1 gene:ENSORLG00000003946.2 transcript:ENSORLT00000004931.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 118.242 bits (295), Expect = 1.194e-27
Identity = 87/311 (27.97%), Postives = 145/311 (46.62%), Query Frame = 3
Query: 1137 CFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKP----DVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFN-GHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWN 2054
            C  +   + + +   N  ++ T G++  + LW+P+   KP G+L+GH A +  +  +     ++S S D       V+ + C+  + G   + + S++        S   Y      L+I  +  + +L++KP      +    SH +P++ C Y+  + QVV+  +G ++  W +DTG R   ++E     A +TC+T D    RL TG  DG++KIW+FN G C  TL   + N     Q                 T    + +K +K +      +  HKDDIL  A  PP  +AT S DGEII+WN
Sbjct:    5 CLPLWSPVGTVSRVMNPKMLVTGGMDRLIRLWHPHFPGKPTGILKGHSAPIFFLWISSEDSQIVSVSVDCT-----VKDECCL--FTG---ESKASSIYGE----ISACHYSPAMKSLYIAAD-SIAVLKLKPRSFFPRRRLTESHNEPVLCCCYSEEFRQVVSCGEGSVLKVWDLDTG-RQGPVSERSSHGATITCMTMDDKGRRLITGRRDGSLKIWNFNSGQCLKTLKKGHANHCTTMQ-----------------TMNSNNLYKRYKATTFVSFQINGHKDDILCVAHCPPSLLATSSCDGEIIVWN 282          
BLAST of WD repeat-containing protein 49 vs. Ensembl Medaka
Match: ENSORLT00000040952.1 (pep primary_assembly:ASM223467v1:19:4064837:4070371:-1 gene:ENSORLG00000022716.1 transcript:ENSORLT00000040952.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.4413 bits (241), Expect = 1.081e-20
Identity = 99/406 (24.38%), Postives = 183/406 (45.07%), Query Frame = 3
Query:  192 GSHNRSQHFNGEEFVEALSLVLCKGTREEY-SDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRTKSSS--LPQWKELKTLSGPHKDVIQRIVLVRNLN--RYLTISKEGNVGLWGSDCKLQK---VAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFR---IPICMDY-WHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKA--------SDKDENTXXXXXXXXXXXXXKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKI 1349
            G  ++      EEF ++LS V C  + E +  +LF +IDI+  G V W++  S++L E+ E+   +   +  L    +    S   ++   RI+ +      RY+T+SK G++ +W S  ++ +   V+     S R R  WVTD A++  +++VA+    ++  F  ++    F   V L   FR     +C  +    P+     ++  GD  G ++++ + N S  LF+R S           SD D++  ++           +C + ++  H+  + +V + P     ++ + +  TS+V   +            M   P    FS        QG   F Y+ +L L+ T G + ++ LW+ YV   P  +L+GH ASV DV   +    + S+S+D +
Sbjct:   65 GGPDKQPGIKLEEFKKSLSSVTC--SEESWIEELFCEIDISHAGEVTWQQLCSYLLQEYKERQRASTPPAALLDAQPQFTLCSQNKREPTVRILSISQQPPLRYITVSKGGHITVWSSSLRILQTFMVSGDPEHSSRLRG-WVTDAAYMRGLHRVAIVTDHRDAHFVKVSPTDIFE-DVHLFG-FRCVLTAVCFGFDSQRPEQ--PPLLLLGDEKGGVHLMWFLNTSKGLFKRASKTERGPQRILFSDLDDHDNMV-----------SCRHIAN-IHRAAINRVMFDPGANVIMTSSESETTSVVFMKVS-----------MKQEPYIWKFS--------QGALCFDYSSSLQLLVTGGKDRKIRLWSRYVTFSPLAVLQGHQASVMDVAIYQPVEQIFSYSRDSV 432          
BLAST of WD repeat-containing protein 49 vs. Planmine SMEST
Match: SMESG000041940.1 (SMESG000041940.1)

HSP 1 Score: 2262.26 bits (5861), Expect = 0.000e+0
Identity = 1133/1141 (99.30%), Postives = 1133/1141 (99.30%), Query Frame = 3
Query:   81 MNLNRSKESHTPLTENKLELKLNIKDLETLQEAFFMDGSHNRSQHFNGEEFVEALSLVLCKGTREEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTXXXXXXXXXXXXXKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAG--------IPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANAELKRAASNSIQQETDDKLDFIKAEIQNSIANRQXXXXXXXXXXXXXXXXXXXXDTVSDMQVQYKKMDVMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEGWLIGEFVAHENASNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKLGSXXXXXXXXXXXXHEDEVVKQEEDKYKVDPNWYPDPEAIQNPSGYRINTWKDTNLGKDYQELRVRKRERIQPSSIPDLPYLYGEKIGRPTFGPFYSLNISSFEEIEDIEQPEFMEYPEKFFNETEEFLTKTARVPLLNETLKAVFDERSLLPEYILEFEHKFRNRFQRHLSEAKVKLSLDDSNSFQEQLPRKAKTVRLKPIQEGSKYQKKLMHKLHIK 3479
            MNLNRSKESHTPLTENKLELKLNIKDLETLQEAFFMDGSHNRSQHFNGEEFVEALSLVLCKGTREEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTIIISINDIIHGSIKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAG        IPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANAELKRAASNSIQQETDDKLDFIKAEIQNSIANRQIEESITTSTSSEETSTSSSTDTVSDMQVQYKKMDVMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEGWLIGEFVAHENASNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKLGSIIETPTIAAIETHEDEVVKQEEDKYKVDPNWYPDPEAIQNPSGYRINTWKDTNLGKDYQELRVRKRERIQPSSIPDLPYLYGEKIGRPTFGPFYSLNISSFEEIEDIEQPEFMEYPEKFFNETEEFLTKTARVPLLNETLKAVFDERSLLPEYILEFEHKFRNRFQRHLSEAKVKLSLDDSNSFQEQLPRKAKTVRLKPIQEGSKYQKKLMHKLHIK
Sbjct:    1 MNLNRSKESHTPLTENKLELKLNIKDLETLQEAFFMDGSHNRSQHFNGEEFVEALSLVLCKGTREEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTIIISINDIIHGSIKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGSKDEFISDIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANAELKRAASNSIQQETDDKLDFIKAEIQNSIANRQIEESITTSTSSEETSTSSSTDTVSDMQVQYKKMDVMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEGWLIGEFVAHENASNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKLGSIIETPTIAAIETHEDEVVKQEEDKYKVDPNWYPDPEAIQNPSGYRINTWKDTNLGKDYQELRVRKRERIQPSSIPDLPYLYGEKIGRPTFGPFYSLNISSFEEIEDIEQPEFMEYPEKFFNETEEFLTKTARVPLLNETLKAVFDERSLLPEYILEFEHKFRNRFQRHLSEAKVKLSLDDSNSFQEQLPRKAKTVRLKPIQEGSKYQKKLMHKLHIK 1141          
BLAST of WD repeat-containing protein 49 vs. Planmine SMEST
Match: SMESG000041940.1 (SMESG000041940.1)

HSP 1 Score: 2221.43 bits (5755), Expect = 0.000e+0
Identity = 1127/1165 (96.74%), Postives = 1127/1165 (96.74%), Query Frame = 3
Query:   81 MNLNRSKESHTPLTENKLELKLNIKDLETLQEAFFMDGSHNRSQHFNGEEFVEALSLVLCKGTREEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTXXXXXXXXXXXXXKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAG--------IPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANAELKRAASNSIQQETDDKLDFIKAEIQNSIANRQXXXXXXXXXXXXXXXXXXXXDTVSDMQVQYKKMDVMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEGWLIGEFVAHENASNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKLGSXXXXXXXXXXXXHEDEVVKQEEDKYKVDPNWYPDPEAIQNPSGYRINTWKDTNLGKDYQELRVRKRERIQPSSIPDLPYLYGEKIGRPTFGPFYSLNISSFEEIEDIEQPEFMEYPEKFFNETEEFLTKTARVPLLN------------------------ETLKAVFDERSLLPEYILEFEHKFRNRFQRHLSEAKVKLSLDDSNSFQEQLPRKAKTVRLKPIQEGSKYQKKLMHKLHIK 3479
            MNLNRSKESHTPLTENKLELKLNIKDLETLQEAFFMDGSHNRSQHFNGEEFVEALSLVLCKGTREEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTIIISINDIIHGSIKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAG        IPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANAELKRAASNSIQQETDDKLDFIKAEIQNSIANRQIEESITTSTSSEETSTSSSTDTVSDM      MDVMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEGWLIGEFVAHENASNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKLGSIIETPTIAAIETHEDEVVKQEEDKYKVDPNWYPDPEAIQNPSGYRINTWKDTNLGKDYQELRVRKRERIQPSSIPDLPYLYGEKIGRPTFGPFYSLNISSFEEIEDIEQPEFMEYPEKFFNETEEFLTKTARVPLLN                        ETLKAVFDERSLLPEYILEFEHKFRNRFQRHLSEAKVKLSLDDSNSFQEQLPRKAKTVRLKPIQEGSKYQKKLMHKLHIK
Sbjct:    1 MNLNRSKESHTPLTENKLELKLNIKDLETLQEAFFMDGSHNRSQHFNGEEFVEALSLVLCKGTREEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTIIISINDIIHGSIKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGSKDEFISDIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANAELKRAASNSIQQETDDKLDFIKAEIQNSIANRQIEESITTSTSSEETSTSSSTDTVSDM------MDVMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEGWLIGEFVAHENASNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKLGSIIETPTIAAIETHEDEVVKQEEDKYKVDPNWYPDPEAIQNPSGYRINTWKDTNLGKDYQELRVRKRERIQPSSIPDLPYLYGEKIGRPTFGPFYSLNISSFEEIEDIEQPEFMEYPEKFFNETEEFLTKTARVPLLNENNPKNVTHNLNTSNVNSNSGNSVETLKAVFDERSLLPEYILEFEHKFRNRFQRHLSEAKVKLSLDDSNSFQEQLPRKAKTVRLKPIQEGSKYQKKLMHKLHIK 1159          
BLAST of WD repeat-containing protein 49 vs. Planmine SMEST
Match: SMESG000041940.1 (SMESG000041940.1)

HSP 1 Score: 2216.04 bits (5741), Expect = 0.000e+0
Identity = 1123/1165 (96.39%), Postives = 1124/1165 (96.48%), Query Frame = 3
Query:   81 MNLNRSKESHTPLTENKLELKLNIKDLETLQEAFFMDGSHNRSQHFNGEEFVEALSLVLCKGTREEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTXXXXXXXXXXXXXKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAG--------IPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANAELKRAASNSIQQETDDKLDFIKAEIQNSIANRQXXXXXXXXXXXXXXXXXXXXDTVSDMQVQYKKMDVMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEGWLIGEFVAHENASNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKLGSXXXXXXXXXXXXHEDEVVKQEEDKYKVDPNWYPDPEAIQNPSGYRINTWKDTNLGKDYQELRVRKRERIQPSSIPDLPYLYGEKIGRPTFGPFYSLNISSFEEIEDIEQPEFMEYPEKFFNETEEFLTKTARVPLLN------------------------ETLKAVFDERSLLPEYILEFEHKFRNRFQRHLSEAKVKLSLDDSNSFQEQLPRKAKTVRLKPIQEGSKYQKKLMHKLHIK 3479
            MNLNRSKESHTPLTENKLELKLNIKDLETLQEAFFMDGSHNRSQHFNGEEFVEALSLVLCKGTREEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTIIISINDIIHGSIKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAG        IPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQE         +YSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANAELKRAASNSIQQETDDKLDFIKAEIQNSIANRQIEESITTSTSSEETSTSSSTDTVSDMQVQYKKMDVMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEGWLIGEFVAHENASNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKLGSIIETPTIAAIETHEDEVVKQEEDKYKVDPNWYPDPEAIQNPSGYRINTWKDTNLGKDYQELRVRKRERIQPSSIPDLPYLYGEKIGRPTFGPFYSLNISSFEEIEDIEQPEFMEYPEKFFNETEEFLTKTARVPLLN                        ETLKAVFDERSLLPEYILEFEHKFRNRFQRHLSEAKVKLSLDDSNSFQEQLPRKAKTVRLKPIQEGSKYQKKLMHKLHIK
Sbjct:    1 MNLNRSKESHTPLTENKLELKLNIKDLETLQEAFFMDGSHNRSQHFNGEEFVEALSLVLCKGTREEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTIIISINDIIHGSIKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGSKDEFISDIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQE---------MYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANAELKRAASNSIQQETDDKLDFIKAEIQNSIANRQIEESITTSTSSEETSTSSSTDTVSDMQVQYKKMDVMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEGWLIGEFVAHENASNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKLGSIIETPTIAAIETHEDEVVKQEEDKYKVDPNWYPDPEAIQNPSGYRINTWKDTNLGKDYQELRVRKRERIQPSSIPDLPYLYGEKIGRPTFGPFYSLNISSFEEIEDIEQPEFMEYPEKFFNETEEFLTKTARVPLLNENNPKNVTHNLNTSNVNSNSGNSVETLKAVFDERSLLPEYILEFEHKFRNRFQRHLSEAKVKLSLDDSNSFQEQLPRKAKTVRLKPIQEGSKYQKKLMHKLHIK 1156          
BLAST of WD repeat-containing protein 49 vs. Planmine SMEST
Match: SMESG000041940.1 (SMESG000041940.1)

HSP 1 Score: 1480.31 bits (3831), Expect = 0.000e+0
Identity = 750/758 (98.94%), Postives = 750/758 (98.94%), Query Frame = 3
Query:   81 MNLNRSKESHTPLTENKLELKLNIKDLETLQEAFFMDGSHNRSQHFNGEEFVEALSLVLCKGTREEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTXXXXXXXXXXXXXKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAG--------IPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANAELKRAASNSIQQETDDKLDFIKAEIQNSIANRQXXXXXXXXXXXXXXXXXXXXDTVSDM 2330
            MNLNRSKESHTPLTENKLELKLNIKDLETLQEAFFMDGSHNRSQHFNGEEFVEALSLVLCKGTREEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTIIISINDIIHGSIKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAG        IPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANAELKRAASNSIQQETDDKLDFIKAEIQNSIANRQIEESITTSTSSEETSTSSSTDTVSDM
Sbjct:    1 MNLNRSKESHTPLTENKLELKLNIKDLETLQEAFFMDGSHNRSQHFNGEEFVEALSLVLCKGTREEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDDRTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTIIISINDIIHGSIKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGSKDEFISDIPESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDFNGHCYNTLIVANGNPVDISQIVILKRCVLVFGFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSYDGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANAELKRAASNSIQQETDDKLDFIKAEIQNSIANRQIEESITTSTSSEETSTSSSTDTVSDM 758          
BLAST of WD repeat-containing protein 49 vs. Planmine SMEST
Match: SMESG000033045.1 (SMESG000033045.1)

HSP 1 Score: 258.84 bits (660), Expect = 1.396e-70
Identity = 187/682 (27.42%), Postives = 332/682 (48.68%), Query Frame = 3
Query:  126 NKLELKLNIKDLETLQEAFFMDGSHNRSQHFNGEEFVEALSLVLCKGTREEYSD--LFDKIDITREGYVDWEKFASHMLLEFYEKDD-----RTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGSDCKLQKVAKTHT--ESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNVKLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSNISSSLFERVSSKASDKDENTXXXXXXXXXXXXXKTCTYFSHKAHQDWVRKVSYIPNLECFVSCATNWNTSMVICWME---------KYNPSNSTSSEMAGI-----PESRGFSRTSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHMASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESALMNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDKIS-SHEKPLIGCLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDSTQTRLYTGATDGNVKIWDF-NGHCYNTLIVANGNP--VDISQI----VILKRCVLVFGFSKSITAFWTSSFKDHKVSPSP---WKGVQT--HKDDILSGASIPPHAVATGSYDGEIIIWNINS 2063
            +K+E ++++  LE L+ AF  +  ++RS   +  EF   L   L   T E+     LF KID    G ++W++F ++M LE+ EK++     R  +  LP   E    + PH++ + RI    +   ++  S +G +  W +  +L+K     T  +S R +  W+ DF  +   NK+ V+   +EI F++++    F    ++ +L  +P+C+DY+   DN  + ++ WGD  G +N++        L    + K   + E    I + +++     +  ++  K H DWV K+ Y  +L   +SC+ +  T++VI  +E         K    + T S+         P+ R  +  + F +++GI +F + ++ N++ T G++  + LWNPYV SKP G+LRGH   +  V   +    + S   DK +++WD+    C+     V PKG        R  + S  +    K  +  T    +  +++KP +   ++ +H+ P+  C YN  +NQVVT C+G  +  W + TG++V    E     + +TC+T DST  RL TG  DG V++W+F NGHC   L     +    +IS +    +   + ++  G+ ++I  +          S  P   W    +  HK+DIL+ A++  H +AT  Y G II+WN+ S
Sbjct:  119 DKIEERIDLTVLEELKAAF-ENAEYDRSGKLDLSEFKALLKEKLQLPTFEDIQTETLFKKIDWASSGAINWDEFCTYMQLEYAEKEETYLKAREMAFCLPARIE----NTPHRENVIRITSTSD-GSFIAGSTDGILSFWSNTLELKKCKSVVTIEQSQRVKSKWIIDFLIMNEFNKIIVATGDREIEFFELS---SFEPYCRIHSLENVPLCLDYYVDKDNLDDCLILWGDRKGCVNILHLHATGECL---RTWKKQPRSEGIAGIGMENVLSN--PSIKFYRWKVHNDWVLKLKYYDSLRQIISCSNDEATALVIGCVEGSTQLDQQMKLKSMHQTKSKDMTFGNMLQPKRRISTDQTVFNIYKGIQTFDFGKSKNVLVTGGLDRIIRLWNPYVNSKPTGMLRGHNKPLVYVHIAEQENRIFSICADKCVKVWDLHDHNCL---LTVRPKGHRI-----RGDMQSCHYSDFAKSLMIATDQVSMLNIKIKPVLHTDVAVTHKDPVTCCKYNEAFNQVVTCCEGSTVKLWNLSTGEKVFEFNE-AHEDSGVTCLTFDSTGRRLLTGGRDGMVRMWNFNNGHCLTELKKEESDLKYAEISAVEYVEISRNKFIVSVGWDRAINVYIDQCEPGMHKSYYPQSRWLDDMSNGHKEDILTLATLKGHLLATADYHGTIIVWNLMS 777          

HSP 2 Score: 87.0409 bits (214), Expect = 6.637e-17
Identity = 52/175 (29.71%), Postives = 88/175 (50.29%), Query Frame = 3
Query: 2319 VSDMQVQYKKMDVMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEGWLI-GEFVAHENASNIIM------NTDVSNQYLVTGDMDGYIRVWDILSYCQTESENQKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNGVLIGRFGQEHRWKL 2822
            V+D+      +D   +I++L++L+SR K K    A+L++ G  G+V FWN  EG ++ G F     +   +       + D+ ++ L  GD  G+I VWDI +Y   + E       P L+ +W++H   I+ +    +    ++ITSS D +  +W   G  +G FGQ   W L
Sbjct:  788 VADLDEDTDYIDEDLSINKLLFLQSRAKNK--SSASLVASGPYGLVHFWNVKEGGILYGRFKGGTESGQSLTAMIACKDQDIDDKLLFIGDRFGFISVWDIENYANNKVET----DCPELLRRWRAHVSSITSLDLVLQ--SQVLITSSDDCTVRVWTFEGEYVGTFGQTEMWDL 954          
The following BLAST results are available for this feature:
BLAST of WD repeat-containing protein 49 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR490.000e+038.15WD repeat domain 49 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR494.111e-15337.73WD repeat domain 49 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR495.068e-14839.25WD repeat domain 49 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR494.342e-12242.11WD repeat domain 49 [Source:HGNC Symbol;Acc:HGNC:2... [more]
EFCAB87.978e-7925.85EF-hand calcium binding domain 8 [Source:HGNC Symb... [more]
back to top
BLAST of WD repeat-containing protein 49 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
snrp-40.29.049e-928.44Small Nuclear RibonucleoProtein homolog [Source:U... [more]
wdr-5.11.718e-820.40WD repeat-containing protein wdr-5.1 [Source:UniP... [more]
wdr-5.11.718e-820.40WD repeat-containing protein wdr-5.1 [Source:UniP... [more]
snrp-40.19.933e-728.92Small Nuclear RibonucleoProtein homolog [Source:U... [more]
back to top
BLAST of WD repeat-containing protein 49 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
WDY4.539e-3923.25gene:FBgn0267449 transcript:FBtr0347028[more]
wds1.098e-621.43gene:FBgn0040066 transcript:FBtr0308566[more]
wds1.098e-621.43gene:FBgn0040066 transcript:FBtr0070438[more]
CG30718.492e-626.97gene:FBgn0023527 transcript:FBtr0070398[more]
back to top
BLAST of WD repeat-containing protein 49 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
wdr957.217e-6430.01WD40 repeat domain 95 [Source:ZFIN;Acc:ZDB-GENE-13... [more]
si:dkey-202c14.34.750e-3330.23si:dkey-202c14.3 [Source:ZFIN;Acc:ZDB-GENE-121214-... [more]
wdr51.082e-620.36WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
back to top
BLAST of WD repeat-containing protein 49 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr492.120e-4944.79WD repeat domain 49 [Source:NCBI gene;Acc:549615][more]
ENSXETT00000013976.11.257e-5825.43EF-hand calcium binding domain 8 [Source:NCBI gene... [more]
ENSXETT00000029824.11.707e-5825.43EF-hand calcium binding domain 8 [Source:NCBI gene... [more]
ENSXETT00000025824.12.500e-5026.94WD repeat-containing protein 64-like [Source:NCBI ... [more]
ENSXETT00000013991.17.396e-5026.13EF-hand calcium binding domain 8 [Source:NCBI gene... [more]
back to top
BLAST of WD repeat-containing protein 49 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wdr496.305e-14736.28WD repeat domain 49 [Source:MGI Symbol;Acc:MGI:364... [more]
Wdr491.489e-12241.54WD repeat domain 49 [Source:MGI Symbol;Acc:MGI:364... [more]
Wdr494.282e-12142.76WD repeat domain 49 [Source:MGI Symbol;Acc:MGI:364... [more]
Efcab82.089e-7825.23EF-hand calcium binding domain 8 [Source:MGI Symbo... [more]
Wdr951.914e-4427.68WD40 repeat domain 95 [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of WD repeat-containing protein 49 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IV35|WDR49_HUMAN1.974e-15237.73WD repeat-containing protein 49 OS=Homo sapiens OX... [more]
sp|Q17I16|WDY_AEDAE6.556e-4423.00WD repeat-containing protein on Y chromosome OS=Ae... [more]
sp|B7FF09|WDY_DROWI2.721e-3823.37WD repeat-containing protein on Y chromosome OS=Dr... [more]
sp|B4F7L9|WDY_DROME4.550e-3823.25WD repeat-containing protein on Y chromosome OS=Dr... [more]
sp|B7FF07|WDY_DROMO4.552e-3823.31WD repeat-containing protein on Y chromosome OS=Dr... [more]
back to top
BLAST of WD repeat-containing protein 49 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JWS00.000e+045.44WD repeat-containing protein 49-like OS=Lingula un... [more]
A0A1S3JX590.000e+045.44WD repeat-containing protein 49 OS=Lingula unguis ... [more]
R7UEX80.000e+046.94WD_REPEATS_REGION domain-containing protein OS=Cap... [more]
A0A2T7PSF00.000e+049.22Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A210PY340.000e+045.59WD repeat-containing protein 49 OS=Mizuhopecten ye... [more]
back to top
BLAST of WD repeat-containing protein 49 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr957.411e-7129.28WD repeat-containing protein on Y chromosome-like ... [more]
ENSAMXT00000043902.14.071e-5837.54pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
si:dkey-202c14.38.140e-4024.26si:dkey-202c14.3 [Source:ZFIN;Acc:ZDB-GENE-121214-... [more]
si:dkey-202c14.31.364e-2728.06si:dkey-202c14.3 [Source:ZFIN;Acc:ZDB-GENE-121214-... [more]
ENSAMXT00000007963.29.698e-720.81WD repeat-containing protein 5-like [Source:NCBI g... [more]
back to top
BLAST of WD repeat-containing protein 49 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000005521.12.140e-3630.06pep scaffold:Pmarinus_7.0:GL477585:56150:70911:-1 ... [more]
ENSPMAT00000008862.16.106e-725.21pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 ... [more]
back to top
BLAST of WD repeat-containing protein 49 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD repeat-containing protein 49 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO443278.458e-6745.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO386274.564e-7229.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364382.129e-4726.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389858.730e-3427.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389844.780e-2830.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WD repeat-containing protein 49 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000015414.22.515e-9236.31WD repeat-containing protein 64 [Source:NCBI gene;... [more]
ENSORLT00000043076.12.515e-9236.31WD repeat-containing protein 64 [Source:NCBI gene;... [more]
ENSORLT00000037247.12.515e-9236.31WD repeat-containing protein 64 [Source:NCBI gene;... [more]
ENSORLT00000004931.21.194e-2727.97pep primary_assembly:ASM223467v1:13:8822834:884012... [more]
ENSORLT00000040952.11.081e-2024.38pep primary_assembly:ASM223467v1:19:4064837:407037... [more]
back to top
BLAST of WD repeat-containing protein 49 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041940.10.000e+099.30SMESG000041940.1[more]
SMESG000041940.10.000e+096.74SMESG000041940.1[more]
SMESG000041940.10.000e+096.39SMESG000041940.1[more]
SMESG000041940.10.000e+098.94SMESG000041940.1[more]
SMESG000033045.11.396e-7027.42SMESG000033045.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020318 ID=SMED30020318|Name=WD repeat-containing protein 49|organism=Schmidtea mediterranea sexual|type=transcript|length=3978bp
CTACTTTAAGGTTAACACAATTGCCTTGCCTCCCTTTGTAACTAATTTAA
AATATACGAATCTAAGAAATAATAAAAATAATGAATTTAAATCGATCTAA
AGAATCTCATACGCCATTAACTGAAAATAAGTTAGAACTAAAGTTAAATA
TAAAAGATTTAGAAACTTTACAAGAAGCATTTTTTATGGATGGTAGTCAT
AATCGTTCACAGCATTTCAATGGCGAAGAATTTGTTGAAGCATTAAGCCT
GGTTCTCTGTAAAGGAACTAGAGAAGAATATAGCGATTTATTCGATAAAA
TTGATATTACCAGAGAAGGATATGTTGACTGGGAAAAATTTGCTTCACAC
ATGCTTTTAGAATTTTATGAAAAGGATGATAGAACTAAATCATCATCTCT
GCCACAATGGAAAGAATTAAAAACGCTTTCTGGACCTCACAAAGATGTCA
TTCAAAGAATAGTGCTTGTTAGAAACCTTAACCGTTACCTCACAATCAGC
AAGGAAGGAAATGTTGGCTTGTGGGGTTCGGATTGTAAACTTCAGAAAGT
TGCCAAAACTCACACAGAAAGTTGTCGATCACGAGACTTATGGGTGACAG
ATTTTGCATTCTTAGGCAATGTTAATAAAGTTGCTGTTAGTTTCACAAGC
AAGGAAATCAGCTTTTACGATATGAATGTAAAACTTGAATTTAATTGCCA
GGTGAAATTGGAAAATTTGTTCAGAATTCCCATATGCATGGATTACTGGC
ATCATCCTGATAACAATGGGGAAGCGATAATGGCTTGGGGTGATACTGGA
GGTTATATAAATGTCATTTTATGGAGTAACATCAGTTCATCTCTGTTTGA
AAGAGTTTCCTCAAAGGCATCTGACAAAGATGAAAATACGATCATAATAT
CAATCAATGATATTATTCATGGTAGTATTAAAACATGCACTTATTTTTCT
CACAAAGCCCATCAAGATTGGGTTCGGAAAGTGTCATATATTCCAAATCT
CGAGTGTTTTGTAAGTTGCGCAACAAATTGGAACACTTCAATGGTTATAT
GCTGGATGGAAAAATACAATCCATCAAATTCAACTTCATCTGAAATGGCC
GGCATTCCAGAAAGTCGGGGATTCTCAAGAACATCATGTTTTACCGTCCA
CCAAGGCATCAATTCATTTGCTTACAATGAAAATCTCAACTTAATTGCTA
CGGCTGGAGTGAATTTTCAAGTTTGTCTGTGGAATCCTTATGTGATATCG
AAACCAAATGGGCTCTTGAGAGGACACATGGCTTCGGTAACAGATGTTCA
ATTTAACAAGGCTAGGGGTCATCTAATAAGTTTTTCAAAAGATAAAATAC
TTCGCATTTGGGATGTTCAATTGCAAGTCTGCATCCAGAGATATGCTGGC
GTATTTCCTAAAGGACAAGAAAGTGCCTTAATGAATCCGCGGATTATTTT
GTACTCAAAAATGTTTTATCACGAAGAAAAGTTGAGGCTGTTTATAACTT
TCAATTTCGGACTGACAATGCTCGAAATGAAGCCCGATGTTAAAGACAAA
ATAAGTAGCCATGAAAAGCCTTTAATTGGATGTCTTTATAATTCTCTGTA
CAACCAAGTTGTAACTGCTTGCCAGGGAGGTATTATTTATTGTTGGATGG
TTGATACTGGACAACGAGTAAAGACAATTACCGAAATTTGTGGTCCTCAA
GCCGAATTGACTTGCATTACTCAAGATAGCACTCAAACTCGTTTGTACAC
AGGAGCCACCGATGGCAATGTTAAAATTTGGGATTTTAACGGCCACTGCT
ATAATACTTTAATTGTGGCTAATGGAAACCCCGTGGATATTAGTCAGATA
GTGATTTTAAAGCGATGCGTTCTTGTTTTTGGATTTTCCAAAAGCATAAC
AGCATTTTGGACAAGTAGCTTTAAAGATCATAAGGTTAGCCCGTCTCCTT
GGAAGGGAGTTCAGACTCACAAAGATGACATTTTGTCCGGTGCATCCATT
CCACCACACGCGGTTGCGACTGGCTCGTACGATGGTGAAATAATAATTTG
GAATATAAATTCTGAACAAGCTTCCCGAACTATGACTCAAAGAAGTCAAG
ATGAGATGAAAGAAGTGAAAAAGCTAGCAGAACAAACAATGGCTGCAAAC
GCGGAGTTGAAAAGGGCAGCCTCGAATTCGATTCAACAGGAAACTGATGA
TAAACTAGATTTTATTAAAGCTGAAATTCAAAATTCAATTGCAAATCGTC
AAATTGAGGAATCCATTACAACTTCGACAAGTAGTGAAGAAACTTCAACG
TCTTCATCAACAGATACTGTTTCTGATATGCAAGTGCAATATAAAAAAAT
GGACGTCATGTTTAATATTTCGCGATTGATTTATCTGGAATCTCGCAAAA
AAATTAAGCATGGAGGAGGGGCAAATTTAATTTCATGTGGAGGCAATGGA
ATTGTGAGATTTTGGAATTCGGCTGAAGGTTGGCTTATTGGGGAATTTGT
TGCTCATGAAAATGCTAGTAATATTATTATGAATACTGATGTCTCGAACC
AATATCTGGTAACCGGTGATATGGACGGATATATAAGGGTTTGGGATATA
CTCAGTTATTGCCAAACAGAAAGTGAAAATCAAAAAATAATGAGTCCTCC
AACATTAATCAGCCAATGGCAAAGCCATTCTGATGAAATCAGTGGAATCT
CATTTTGCTTCAAATTCAGTCGGACATTGATTATAACTAGCTCGGCTGAC
CAATCGGCTGCTTTGTGGGAATTGAATGGTGTTCTTATTGGCCGATTTGG
ACAAGAGCATCGATGGAAACTAGGATCTATTATTGAAACTCCAACAATTG
CTGCTATTGAAACTCATGAAGATGAAGTTGTAAAGCAAGAAGAGGACAAG
TATAAGGTTGACCCGAATTGGTATCCCGATCCAGAAGCTATTCAAAATCC
CTCTGGATACAGAATTAATACATGGAAGGATACAAATCTTGGAAAAGATT
ACCAGGAACTCCGAGTTCGTAAAAGGGAACGCATTCAACCATCATCGATT
CCAGATCTTCCTTATTTATATGGTGAAAAAATTGGTAGACCAACATTTGG
TCCATTTTATTCATTAAATATATCAAGTTTCGAAGAAATTGAAGACATAG
AACAACCGGAATTTATGGAATATCCTGAAAAGTTTTTTAATGAAACTGAA
GAATTTTTAACCAAGACAGCAAGGGTTCCTCTTCTCAATGAAACTCTGAA
AGCTGTATTCGACGAAAGATCTCTTTTACCAGAATATATTTTGGAATTTG
AACATAAATTCCGGAATAGATTCCAGCGACATTTATCAGAGGCCAAAGTC
AAATTGTCATTAGACGATTCCAATAGTTTCCAAGAACAATTACCTCGAAA
AGCTAAAACAGTTAGATTGAAGCCAATTCAGGAAGGTTCAAAATATCAGA
AAAAATTAATGCATAAGCTTCATATTAAATAATATTTTTCATGTTTATGA
TTAATGTTAAGATTAAAAGTATGAGCGGAAATTTTCTTTCATTAATTTCT
CTCTTTTTTTCAATTGTAATACATCATTTTCAAAATGAATCTGCTATTTG
TGTGACAAATTTTGTGTTTGTATAGAAAATACACCAAAATGCAAATAACT
CAAAATTGTATACTCATTTATCCCATTTAATAAGTGTAAATAAAGCCAGA
TATATTTCACATTTGTATCATGGTTCTGACTGTATGTTACTAATTTAACA
GATCTTATGCAACAATGTTGTCTATAATATAGGTAGATTTATAATAGAAT
AGATGACTCGTAATTGCTAACAAGTCATTTTTTTCAAAATATGAATTTAC
AAAATTGTTTATTATCTAGTAATGTGGTTAATAACAATTGTTATTATTAA
TAATTTATTATTAATTATTAATAAAAAACAGAACAATTAAGAAATTACAT
AATGCAATATTGCTTTCATTACTATCCT
back to top

protein sequence of SMED30020318-orf-1

>SMED30020318-orf-1 ID=SMED30020318-orf-1|Name=SMED30020318-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1134bp
MNLNRSKESHTPLTENKLELKLNIKDLETLQEAFFMDGSHNRSQHFNGEE
FVEALSLVLCKGTREEYSDLFDKIDITREGYVDWEKFASHMLLEFYEKDD
RTKSSSLPQWKELKTLSGPHKDVIQRIVLVRNLNRYLTISKEGNVGLWGS
DCKLQKVAKTHTESCRSRDLWVTDFAFLGNVNKVAVSFTSKEISFYDMNV
KLEFNCQVKLENLFRIPICMDYWHHPDNNGEAIMAWGDTGGYINVILWSN
ISSSLFERVSSKASDKDENTIIISINDIIHGSIKTCTYFSHKAHQDWVRK
VSYIPNLECFVSCATNWNTSMVICWMEKYNPSNSTSSEMAGIPESRGFSR
TSCFTVHQGINSFAYNENLNLIATAGVNFQVCLWNPYVISKPNGLLRGHM
ASVTDVQFNKARGHLISFSKDKILRIWDVQLQVCIQRYAGVFPKGQESAL
MNPRIILYSKMFYHEEKLRLFITFNFGLTMLEMKPDVKDKISSHEKPLIG
CLYNSLYNQVVTACQGGIIYCWMVDTGQRVKTITEICGPQAELTCITQDS
TQTRLYTGATDGNVKIWDFNGHCYNTLIVANGNPVDISQIVILKRCVLVF
GFSKSITAFWTSSFKDHKVSPSPWKGVQTHKDDILSGASIPPHAVATGSY
DGEIIIWNINSEQASRTMTQRSQDEMKEVKKLAEQTMAANAELKRAASNS
IQQETDDKLDFIKAEIQNSIANRQIEESITTSTSSEETSTSSSTDTVSDM
QVQYKKMDVMFNISRLIYLESRKKIKHGGGANLISCGGNGIVRFWNSAEG
WLIGEFVAHENASNIIMNTDVSNQYLVTGDMDGYIRVWDILSYCQTESEN
QKIMSPPTLISQWQSHSDEISGISFCFKFSRTLIITSSADQSAALWELNG
VLIGRFGQEHRWKLGSIIETPTIAAIETHEDEVVKQEEDKYKVDPNWYPD
PEAIQNPSGYRINTWKDTNLGKDYQELRVRKRERIQPSSIPDLPYLYGEK
IGRPTFGPFYSLNISSFEEIEDIEQPEFMEYPEKFFNETEEFLTKTARVP
LLNETLKAVFDERSLLPEYILEFEHKFRNRFQRHLSEAKVKLSLDDSNSF
QEQLPRKAKTVRLKPIQEGSKYQKKLMHKLHIK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR020472G-protein_beta_WD-40_rep
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR011992EF-hand-dom_pair
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
IPR011047Quinoprotein_ADH-like_supfam
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 676..699
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 8..128
e-value: 3.8E-5
score: 25.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 725..748
NoneNo IPR availablePANTHERPTHR44324FAMILY NOT NAMEDcoord: 19..1091
NoneNo IPR availablePANTHERPTHR44324:SF1WD REPEAT-CONTAINING PROTEIN 49coord: 19..1091
IPR020472G-protein beta WD-40 repeatPRINTSPR00320GPROTEINBRPTcoord: 415..429
score: 37.51
coord: 826..840
score: 35.13
coord: 555..569
score: 34.24
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 799..839
e-value: 0.16
score: 21.1
coord: 484..523
e-value: 8.4
score: 11.2
coord: 347..385
e-value: 0.067
score: 22.3
coord: 109..149
e-value: 42.0
score: 6.8
coord: 151..197
e-value: 35.0
score: 7.2
coord: 856..897
e-value: 0.083
score: 22.0
coord: 620..658
e-value: 1.2
score: 16.6
coord: 389..428
e-value: 0.0017
score: 27.7
coord: 526..568
e-value: 6.5E-4
score: 29.0
coord: 284..326
e-value: 12.0
score: 10.1
coord: 733..796
e-value: 260.0
score: 1.7
IPR001680WD40 repeatPFAMPF00400WD40coord: 542..568
e-value: 0.16
score: 12.9
coord: 393..428
e-value: 0.0044
score: 17.8
coord: 801..839
e-value: 0.0026
score: 18.6
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 822..840
score: 9.372
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 536..570
score: 9.573
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 627..667
score: 9.673
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 396..430
score: 13.048
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 219..439
e-value: 3.1E-15
score: 58.4
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 739..939
e-value: 3.5E-17
score: 64.0
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 480..712
e-value: 1.4E-18
score: 68.6
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 826..840
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 884..898
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 645..659
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 555..569
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 783..797
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 783..906
score: 12.183
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 353..667
score: 15.926
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 358..897
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 6..96
IPR011047Quinoprotein alcohol dehydrogenase-like superfamilySUPERFAMILYSSF50998Quinoprotein alcohol dehydrogenase-likecoord: 110..436