Dipeptidyl peptidase 4

Overview
NameDipeptidyl peptidase 4
Smed IDSMED30020315
Length (bp)1965
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dipeptidyl peptidase 4 (SMED30020315) t-SNE clustered cells

Violin plots show distribution of expression levels for Dipeptidyl peptidase 4 (SMED30020315) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dipeptidyl peptidase 4 (SMED30020315) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dipeptidyl peptidase 4 (SMED30020315) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020315

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30020315SMESG000018885.1 SmedASXL_013977SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30020315SMESG000018885.1 dd_Smed_v4_9183_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30020315SMESG000018885.1 dd_Smed_v4_9183_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020315SMESG000018885.1 dd_Smed_v4_9183_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30020315SMESG000018885.1 dd_Smed_v6_9183_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30020315SMESG000018885.1 OX_Smed_1.0.10214ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30020315SMESG000018885.1 dd_Smed_v4_9183_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Human
Match: DPP6 (dipeptidyl peptidase like 6 [Source:HGNC Symbol;Acc:HGNC:3010])

HSP 1 Score: 169.088 bits (427), Expect = 1.617e-43
Identity = 164/556 (29.50%), Postives = 244/556 (43.88%), Query Frame = 1
Query:  250 EEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGP-VPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIP--EDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGT-EYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFD--GDKTIYFSAILANDSKELHLYKANITTGNF--VCVSCK-NPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAMP 1890
            +E+V SNP  ++WKGI IA+LVIL+I  LI+ ++   +P    + N  S   K T  D+F           +WI      Y  +K   +L N++T   T LI    ++   A     S  R+  L    Y     Y+HS T  Y +  +   +      P V  A LQ A W P G  L F++ NN+YY  +    +  +  T    +   I  G++DWLYEEEIL+   A WWSP G  +A+ + ND +V   E+  Y     +        YPK               AGS    +NP +  ++  LN   +    +P   P   +YYI  VKW     + + W NR QN + L+L  +  TG   +     HE  +  W   L + N EP+     +K F I      G  ++ +I   +     S   I+  I + D+D T I+ +D  G+K  + S    +  +   LY AN T GNF   C+SC    NCTY +  F+    F +  C GP VP   +   T+K  +     L  N  +K+ I  + MP
Sbjct:   19 QELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPA---EDNSLSQKKKVTVEDLFSEDFKIHDPEAKWISDTEFIYREQKGTVRLWNVETNTSTVLIEGKKIESLRAIRYEISPDREYALF--SYNVEPIYQHSYTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTG---KEGVIYNGLSDWLYEEEILKTHIAHWWSPDGTRLAYAAINDSRVPIMELPTY--TGSIYPTVKPYHYPK---------------AGS----ENPSISLHVIGLNGPTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLC-DATTGVCTKK----HEDESEAW---LHRQNEEPVFSKDGRKFFFIRAIPQGGRGKFYHITVSSSQPNSSNDNIQS-ITSGDWDVTKILAYDEKGNKIYFLST--EDLPRRRQLYSAN-TVGNFNRQCLSCDLVENCTYFSASFSHSMDFFLLKCEGPGVPMVTVHNTTDKKKMFD---LETNEHVKKAINDRQMP 530          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Human
Match: DPP6 (dipeptidyl peptidase like 6 [Source:HGNC Symbol;Acc:HGNC:3010])

HSP 1 Score: 168.703 bits (426), Expect = 2.218e-43
Identity = 164/555 (29.55%), Postives = 243/555 (43.78%), Query Frame = 1
Query:  253 EIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGP-VPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIP--EDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGT-EYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFD--GDKTIYFSAILANDSKELHLYKANITTGNF--VCVSCK-NPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAMP 1890
            E+V SNP  ++WKGI IA+LVIL+I  LI+ ++   +P    + N  S   K T  D+F           +WI      Y  +K   +L N++T   T LI    ++   A     S  R+  L    Y     Y+HS T  Y +  +   +      P V  A LQ A W P G  L F++ NN+YY  +    +  +  T    +   I  G++DWLYEEEIL+   A WWSP G  +A+ + ND +V   E+  Y     +        YPK               AGS    +NP +  ++  LN   +    +P   P   +YYI  VKW     + + W NR QN + L+L  +  TG   +     HE  +  W   L + N EP+     +K F I      G  ++ +I   +     S   I+  I + D+D T I+ +D  G+K  + S    +  +   LY AN T GNF   C+SC    NCTY +  F+    F +  C GP VP   +   T+K  +     L  N  +K+ I  + MP
Sbjct:   18 ELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPA---EDNSLSQKKKVTVEDLFSEDFKIHDPEAKWISDTEFIYREQKGTVRLWNVETNTSTVLIEGKKIESLRAIRYEISPDREYALF--SYNVEPIYQHSYTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTG---KEGVIYNGLSDWLYEEEILKTHIAHWWSPDGTRLAYAAINDSRVPIMELPTY--TGSIYPTVKPYHYPK---------------AGS----ENPSISLHVIGLNGPTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLC-DATTGVCTKK----HEDESEAW---LHRQNEEPVFSKDGRKFFFIRAIPQGGRGKFYHITVSSSQPNSSNDNIQS-ITSGDWDVTKILAYDEKGNKIYFLST--EDLPRRRQLYSAN-TVGNFNRQCLSCDLVENCTYFSASFSHSMDFFLLKCEGPGVPMVTVHNTTDKKKMFD---LETNEHVKKAINDRQMP 528          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Human
Match: DPP6 (dipeptidyl peptidase like 6 [Source:HGNC Symbol;Acc:HGNC:3010])

HSP 1 Score: 168.703 bits (426), Expect = 2.578e-43
Identity = 163/556 (29.32%), Postives = 243/556 (43.71%), Query Frame = 1
Query:  250 EEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGP-VPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIP--EDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGT-EYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFD--GDKTIYFSAILANDSKELHLYKANITTGNF--VCVSCK-NPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAMP 1890
            +E+V SNP  ++WKGI IA+LVIL+I  LI+ ++   +P    + N  S   K T  D+F           +WI      Y  +K   +L N++T   T LI    ++   A      +S D       Y     Y+HS T  Y +  +   +      P V  A LQ A W P G  L F++ NN+YY  +    +  +  T    +   I  G++DWLYEEEIL+   A WWSP G  +A+ + ND +V   E+  Y     +        YPK               AGS    +NP +  ++  LN   +    +P   P   +YYI  VKW     + + W NR QN + L+L  +  TG   +     HE  +  W   L + N EP+     +K F I      G  ++ +I   +     S   I+  I + D+D T I+ +D  G+K  + S    +  +   LY AN T GNF   C+SC    NCTY +  F+    F +  C GP VP   +   T+K  +     L  N  +K+ I  + MP
Sbjct:   81 DELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPA---EDNSLSQKKKVTVEDLFSEDFKIHDPEAKWISDTEFIYREQKGTVRLWNVETNTSTVLIEGKKIESLRA--IRYEISPDREYALFSYNVEPIYQHSYTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTG---KEGVIYNGLSDWLYEEEILKTHIAHWWSPDGTRLAYAAINDSRVPIMELPTY--TGSIYPTVKPYHYPK---------------AGS----ENPSISLHVIGLNGPTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLC-DATTGVCTKK----HEDESEAW---LHRQNEEPVFSKDGRKFFFIRAIPQGGRGKFYHITVSSSQPNSSNDNIQS-ITSGDWDVTKILAYDEKGNKIYFLST--EDLPRRRQLYSAN-TVGNFNRQCLSCDLVENCTYFSASFSHSMDFFLLKCEGPGVPMVTVHNTTDKKKMFD---LETNEHVKKAINDRQMP 592          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Human
Match: DPP10 (dipeptidyl peptidase like 10 [Source:HGNC Symbol;Acc:HGNC:20823])

HSP 1 Score: 156.762 bits (395), Expect = 2.127e-39
Identity = 159/561 (28.34%), Postives = 257/561 (45.81%), Query Frame = 1
Query:  250 EEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGP--VPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPED------YYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSG--TEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFD-GDKTIYFSAILANDSKELHLYKANITTG--NFVCVSCK--NPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAM 1887
            EE+ +++P  ++WKGI IA+LVIL++  LI +++   +P+   ++++T    + +  D+FR   +       WI    + Y +E      LN++T   T L+         AS    S+S D   + + Y     + +S TA Y ++++  +EV  E+ P  V  + LQ A W   G  L +++ NN+YY   P   S  + +TS+  +   I  G+ADWLYEEE+L    A WWSP G+ +AFL  ND  V    I            F    YPK          +    AG V    NP +K Y+ NL    Y      E +P D      YYI  VKW+ +   ++ W NR QN + L++ +   TG   + +    E T++ W   L Q N EP+ F R    F +   +  G   E+ ++A   +     ++ +R  + + +++   I+ +D   + IYF +   +  +   LY A+ T G  N  C+SC      CTY    F+      +  C GP VP   L          +  IL +N+ LK+ I +K +
Sbjct:   13 EELGSNSPPQRNWKGIAIALLVILVVCSLITMSVILLTPDELTNSSET----RLSLEDLFRKDFVLHDPEARWINDTDVVYKSENGHVIKLNIETNATTLLLENTTFVTFKAS--RHSVSPDLKYVLLAYDVKQIFHYSYTASYVIYNIHTREV-WELNPPEVEDSVLQYAAWGVQGQQLIYIFENNIYYQ--PDIKSSSLRLTSS-GKEEIIFNGIADWLYEEELLHSHIAHWWSPDGERLAFLMINDSLVPTMVIP----------RFTGALYPK-------GKQYPYPKAGQV----NPTIKLYVVNL----YGPTHTLELMPPDSFKSREYYITMVKWVSNTKTVVRWLNRAQNISILTVCET-TTGACSKKY----EMTSDTW---LSQQNEEPV-FSRDGSKFFMTVPVKQGGRGEFHHVAMFLIQSKSEQITVRH-LTSGNWEVIKILAYDETTQKIYFLST-ESSPRGRQLYSAS-TEGLLNRQCISCNFMKEQCTYFDASFSPMNQHFLLFCEGPRVPVVSLHSTDNPA---KYFILESNSMLKEAILKKKI 523          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Human
Match: DPP10 (dipeptidyl peptidase like 10 [Source:HGNC Symbol;Acc:HGNC:20823])

HSP 1 Score: 156.377 bits (394), Expect = 3.094e-39
Identity = 161/567 (28.40%), Postives = 259/567 (45.68%), Query Frame = 1
Query:  235 KALPTEEIVASN-PSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGP--VPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPED------YYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSG--TEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFD-GDKTIYFSAILANDSKELHLYKANITTG--NFVCVSCK--NPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAM 1887
            +A P ++ + SN P  ++WKGI IA+LVIL++  LI +++   +P+   ++++T    + +  D+FR   +       WI    + Y +E      LN++T   T L+         AS    S+S D   + + Y     + +S TA Y ++++  +EV  E+ P  V  + LQ A W   G  L +++ NN+YY   P   S  + +TS+  +   I  G+ADWLYEEE+L    A WWSP G+ +AFL  ND  V    I            F    YPK          +    AG V    NP +K Y+ NL    Y      E +P D      YYI  VKW+ +   ++ W NR QN + L++ +   TG   + +    E T++ W   L Q N EP+ F R    F +   +  G   E+ ++A   +     ++ +R  + + +++   I+ +D   + IYF +   +  +   LY A+ T G  N  C+SC      CTY    F+      +  C GP VP   L          +  IL +N+ LK+ I +K +
Sbjct:   18 QAQPADQELGSNSPPQRNWKGIAIALLVILVVCSLITMSVILLTPDELTNSSET----RLSLEDLFRKDFVLHDPEARWINDTDVVYKSENGHVIKLNIETNATTLLLENTTFVTFKAS--RHSVSPDLKYVLLAYDVKQIFHYSYTASYVIYNIHTREV-WELNPPEVEDSVLQYAAWGVQGQQLIYIFENNIYYQ--PDIKSSSLRLTSS-GKEEIIFNGIADWLYEEELLHSHIAHWWSPDGERLAFLMINDSLVPTMVIP----------RFTGALYPK-------GKQYPYPKAGQV----NPTIKLYVVNL----YGPTHTLELMPPDSFKSREYYITMVKWVSNTKTVVRWLNRAQNISILTVCET-TTGACSKKY----EMTSDTW---LSQQNEEPV-FSRDGSKFFMTVPVKQGGRGEFHHVAMFLIQSKSEQITVRH-LTSGNWEVIKILAYDETTQKIYFLST-ESSPRGRQLYSAS-TEGLLNRQCISCNFMKEQCTYFDASFSPMNQHFLLFCEGPRVPVVSLHSTDNPA---KYFILESNSMLKEAILKKKI 534          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Celegans
Match: dpf-2 (Dipeptidyl peptidase family member 2 [Source:UniProtKB/Swiss-Prot;Acc:Q18253])

HSP 1 Score: 87.0409 bits (214), Expect = 1.634e-17
Identity = 65/237 (27.43%), Postives = 106/237 (44.73%), Query Frame = 1
Query:  655 YRHSSTAQYTVFDVKKKEVNVE---IGPVPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPE---DYYICFVKWI---------DDDHLLIGWANREQNEAWLSLA 1320
            +RHS+   Y +  +  K V+ E   +GP   + +Q   W+P   +  FVY +N               +   +  S    +G+A+WLYEEEIL  S+A+WWSPSG+ +++L F+D +V    +  Y + D    +F  + YPK                       N +V  YI++  + +    + P  +     DYY+   KWI          ++ L+  WANR+QN  + SL 
Sbjct:  168 WRHSAEYLYHIVKINNKTVSTEQWHVGPEENSLIQAFYWNPNASSNDFVYVHNYNLYYQKDPEKPDGAIQLTVGGSTFNRFGLANWLYEEEILEASSAVWWSPSGRYVSYLRFDDREVNRIFLPKYTDDDSYVEYF-ELPYPKAGV------------------QNNTLVTQYIWDSENHKIVETAPPNELSAANGDYYVLTNKWITMPRNGSDLGEERLVTVWANRDQNHVYFSLC 385          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Celegans
Match: dpf-2 (Dipeptidyl peptidase family member 2 [Source:UniProtKB/Swiss-Prot;Acc:Q18253])

HSP 1 Score: 87.0409 bits (214), Expect = 1.634e-17
Identity = 65/237 (27.43%), Postives = 106/237 (44.73%), Query Frame = 1
Query:  655 YRHSSTAQYTVFDVKKKEVNVE---IGPVPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPE---DYYICFVKWI---------DDDHLLIGWANREQNEAWLSLA 1320
            +RHS+   Y +  +  K V+ E   +GP   + +Q   W+P   +  FVY +N               +   +  S    +G+A+WLYEEEIL  S+A+WWSPSG+ +++L F+D +V    +  Y + D    +F  + YPK                       N +V  YI++  + +    + P  +     DYY+   KWI          ++ L+  WANR+QN  + SL 
Sbjct:  168 WRHSAEYLYHIVKINNKTVSTEQWHVGPEENSLIQAFYWNPNASSNDFVYVHNYNLYYQKDPEKPDGAIQLTVGGSTFNRFGLANWLYEEEILEASSAVWWSPSGRYVSYLRFDDREVNRIFLPKYTDDDSYVEYF-ELPYPKAGV------------------QNNTLVTQYIWDSENHKIVETAPPNELSAANGDYYVLTNKWITMPRNGSDLGEERLVTVWANRDQNHVYFSLC 385          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Celegans
Match: dpf-1 (Dipeptidyl peptidase family member 1 [Source:UniProtKB/Swiss-Prot;Acc:Q7JKY3])

HSP 1 Score: 75.0998 bits (183), Expect = 9.944e-14
Identity = 77/328 (23.48%), Postives = 140/328 (42.68%), Query Frame = 1
Query:  889 GVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSK-----RYYAISIPEGIPEDYYICFVKWID---DDHLLIGWANREQNEAWLSLAQNWLTG---------KDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGD-KTIYFSAILANDS-KELHLYK-ANITTGNFVCVSCKNPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTE 1812
            G+ DW+YEEEI     A+WWS  G  +A+ S+++   +N  +K Y   +          YP     +  N  +        PK    V+  Y  ++ +K     R   + + + +   +Y+  VKW++    + L+  W NR QNE  L++  +W T             + WV     T + + ++    ++   + P  K+             ++ +A L LS+   +L   K++   ++D T I   + + +TI+F A     S + L  Y  A+ +  +  C+SC   NCT+     + +    I SC GP+ P   ++ LT 
Sbjct:  169 GLFDWIYEEEIFGRKDAMWWSTKGDQLAYASYDNHLTKNVSLKTYHRLEP---------YP-----IDTNFHY--------PKTFAKVLPTYTLSIWNKKTEQSRQLDVQLKDSLSY-HYLLAVKWLEINGTEQLVSVWTNRYQNEVALTIC-DWDTAICRLEFEYKYASKRWV-----THDDFHSITSFEDTLFFLLPHDKR----------DNAFQQVASLRLSH--GQLRTPKFLNLGEYDVTSINGINKETRTIFFHAAAPKPSHRSLFSYSLADESRNSAYCISCSIKNCTWAQAQMDDQMKTAIVSCKGPAAPHTAIVNLTR 455          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Celegans
Match: dpf-1 (Dipeptidyl peptidase family member 1 [Source:UniProtKB/Swiss-Prot;Acc:Q7JKY3])

HSP 1 Score: 75.0998 bits (183), Expect = 1.029e-13
Identity = 77/328 (23.48%), Postives = 140/328 (42.68%), Query Frame = 1
Query:  889 GVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSK-----RYYAISIPEGIPEDYYICFVKWID---DDHLLIGWANREQNEAWLSLAQNWLTG---------KDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGD-KTIYFSAILANDS-KELHLYK-ANITTGNFVCVSCKNPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTE 1812
            G+ DW+YEEEI     A+WWS  G  +A+ S+++   +N  +K Y   +          YP     +  N  +        PK    V+  Y  ++ +K     R   + + + +   +Y+  VKW++    + L+  W NR QNE  L++  +W T             + WV     T + + ++    ++   + P  K+             ++ +A L LS+   +L   K++   ++D T I   + + +TI+F A     S + L  Y  A+ +  +  C+SC   NCT+     + +    I SC GP+ P   ++ LT 
Sbjct:  209 GLFDWIYEEEIFGRKDAMWWSTKGDQLAYASYDNHLTKNVSLKTYHRLEP---------YP-----IDTNFHY--------PKTFAKVLPTYTLSIWNKKTEQSRQLDVQLKDSLSY-HYLLAVKWLEINGTEQLVSVWTNRYQNEVALTIC-DWDTAICRLEFEYKYASKRWV-----THDDFHSITSFEDTLFFLLPHDKR----------DNAFQQVASLRLSH--GQLRTPKFLNLGEYDVTSINGINKETRTIFFHAAAPKPSHRSLFSYSLADESRNSAYCISCSIKNCTWAQAQMDDQMKTAIVSCKGPAAPHTAIVNLTR 495          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Celegans
Match: dpf-1 (Dipeptidyl peptidase family member 1 [Source:UniProtKB/Swiss-Prot;Acc:Q7JKY3])

HSP 1 Score: 75.0998 bits (183), Expect = 1.036e-13
Identity = 77/327 (23.55%), Postives = 140/327 (42.81%), Query Frame = 1
Query:  889 GVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSK-----RYYAISIPEGIPEDYYICFVKWID---DDHLLIGWANREQNEAWLSLAQNWLTG---------KDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGD-KTIYFSAILANDS-KELHLYK-ANITTGNFVCVSCKNPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLT 1809
            G+ DW+YEEEI     A+WWS  G  +A+ S+++   +N  +K Y   +          YP     +  N  +        PK    V+  Y  ++ +K     R   + + + +   +Y+  VKW++    + L+  W NR QNE  L++  +W T             + WV     T + + ++    ++   + P  K+             ++ +A L LS+   +L   K++   ++D T I   + + +TI+F A     S + L  Y  A+ +  +  C+SC   NCT+     + +    I SC GP+ P   ++ LT
Sbjct:  229 GLFDWIYEEEIFGRKDAMWWSTKGDQLAYASYDNHLTKNVSLKTYHRLEP---------YP-----IDTNFHY--------PKTFAKVLPTYTLSIWNKKTEQSRQLDVQLKDSLSY-HYLLAVKWLEINGTEQLVSVWTNRYQNEVALTIC-DWDTAICRLEFEYKYASKRWV-----THDDFHSITSFEDTLFFLLPHDKR----------DNAFQQVASLRLSH--GQLRTPKFLNLGEYDVTSINGINKETRTIFFHAAAPKPSHRSLFSYSLADESRNSAYCISCSIKNCTWAQAQMDDQMKTAIVSCKGPAAPHTAIVNLT 514          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Fly
Match: ome (gene:FBgn0259175 transcript:FBtr0333043)

HSP 1 Score: 111.309 bits (277), Expect = 4.678e-25
Identity = 109/419 (26.01%), Postives = 190/419 (45.35%), Query Frame = 1
Query:  607 SRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGPVPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKA--KNPVVKPYIYNLNSKRYYA-------ISIPEGI--PEDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINM----LKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDG-DKTIYFSAILANDSKELHLYKAN-ITTGNFVCVSCK-----NPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYL 1797
            S DG  + +   +  N+R+S  A+Y ++++  KE         Q  L   +WSP G+ L   Y+ NLYY E+ L  ++ I +TS+  +   I  G+ DW+YEEE+   + A W++PSG  +AF+ F+D          YG+  +L       +YP    I             + PKA   NP V+  + +L  KR  A       + +P  +    DY +  V W+DDD++L  W NR QN A++      +T       VIY  ++  GW+++     +  N   + F            +     Y+++  L+ +   S+    + +    +    I+++DG +  I+++A   +  ++LHLY    +   +  C++C      +   TY +  FN     VI S LGP +PT ++
Sbjct:  111 SADGEFLLLAKNYKKNFRYSFLAEYDLYNLNTKEFIQLTIQNEQHYLSMVQWSPVGNALVINYDRNLYYKESAL--AQEIALTSD--EQAGILNGIPDWVYEEEVFSSNVATWFNPSGTQLAFIKFDDSSTHLINFPYYGDAGDL-----RYQYPLHQVI-------------AYPKAGSSNPRVELVMVDL--KRAVAGGDFVTVMPVPSALNTETDYIVTVVSWVDDDNVLSIWMNRIQNAAYV------VTFDGLNRKVIYSAESKTGWVDLYTAPFRNRNGSRLAF------------VLPHNNYKHVQLLSSTVASSEPQALEPLTEGKYVVDSILHWDGKNDIIFYTANTEDHPEQLHLYAIRALAKQSPKCLTCNLIKSGDVQQTYFSATFNDNNHIVITS-LGPGIPTTHI 486          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Fly
Match: ome (gene:FBgn0259175 transcript:FBtr0299650)

HSP 1 Score: 110.923 bits (276), Expect = 5.990e-25
Identity = 109/419 (26.01%), Postives = 190/419 (45.35%), Query Frame = 1
Query:  607 SRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGPVPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKA--KNPVVKPYIYNLNSKRYYA-------ISIPEGI--PEDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINM----LKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDG-DKTIYFSAILANDSKELHLYKAN-ITTGNFVCVSCK-----NPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYL 1797
            S DG  + +   +  N+R+S  A+Y ++++  KE         Q  L   +WSP G+ L   Y+ NLYY E+ L  ++ I +TS+  +   I  G+ DW+YEEE+   + A W++PSG  +AF+ F+D          YG+  +L       +YP    I             + PKA   NP V+  + +L  KR  A       + +P  +    DY +  V W+DDD++L  W NR QN A++      +T       VIY  ++  GW+++     +  N   + F            +     Y+++  L+ +   S+    + +    +    I+++DG +  I+++A   +  ++LHLY    +   +  C++C      +   TY +  FN     VI S LGP +PT ++
Sbjct:  129 SADGEFLLLAKNYKKNFRYSFLAEYDLYNLNTKEFIQLTIQNEQHYLSMVQWSPVGNALVINYDRNLYYKESAL--AQEIALTSD--EQAGILNGIPDWVYEEEVFSSNVATWFNPSGTQLAFIKFDDSSTHLINFPYYGDAGDL-----RYQYPLHQVI-------------AYPKAGSSNPRVELVMVDL--KRAVAGGDFVTVMPVPSALNTETDYIVTVVSWVDDDNVLSIWMNRIQNAAYV------VTFDGLNRKVIYSAESKTGWVDLYTAPFRNRNGSRLAF------------VLPHNNYKHVQLLSSTVASSEPQALEPLTEGKYVVDSILHWDGKNDIIFYTANTEDHPEQLHLYAIRALAKQSPKCLTCNLIKSGDVQQTYFSATFNDNNHIVITS-LGPGIPTTHI 504          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Fly
Match: ome (gene:FBgn0259175 transcript:FBtr0299649)

HSP 1 Score: 110.923 bits (276), Expect = 7.681e-25
Identity = 109/419 (26.01%), Postives = 190/419 (45.35%), Query Frame = 1
Query:  607 SRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGPVPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKA--KNPVVKPYIYNLNSKRYYA-------ISIPEGI--PEDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINM----LKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDG-DKTIYFSAILANDSKELHLYKAN-ITTGNFVCVSCK-----NPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYL 1797
            S DG  + +   +  N+R+S  A+Y ++++  KE         Q  L   +WSP G+ L   Y+ NLYY E+ L  ++ I +TS+  +   I  G+ DW+YEEE+   + A W++PSG  +AF+ F+D          YG+  +L       +YP    I             + PKA   NP V+  + +L  KR  A       + +P  +    DY +  V W+DDD++L  W NR QN A++      +T       VIY  ++  GW+++     +  N   + F            +     Y+++  L+ +   S+    + +    +    I+++DG +  I+++A   +  ++LHLY    +   +  C++C      +   TY +  FN     VI S LGP +PT ++
Sbjct:  250 SADGEFLLLAKNYKKNFRYSFLAEYDLYNLNTKEFIQLTIQNEQHYLSMVQWSPVGNALVINYDRNLYYKESAL--AQEIALTSD--EQAGILNGIPDWVYEEEVFSSNVATWFNPSGTQLAFIKFDDSSTHLINFPYYGDAGDL-----RYQYPLHQVI-------------AYPKAGSSNPRVELVMVDL--KRAVAGGDFVTVMPVPSALNTETDYIVTVVSWVDDDNVLSIWMNRIQNAAYV------VTFDGLNRKVIYSAESKTGWVDLYTAPFRNRNGSRLAF------------VLPHNNYKHVQLLSSTVASSEPQALEPLTEGKYVVDSILHWDGKNDIIFYTANTEDHPEQLHLYAIRALAKQSPKCLTCNLIKSGDVQQTYFSATFNDNNHIVITS-LGPGIPTTHI 625          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Fly
Match: CG11034 (gene:FBgn0031741 transcript:FBtr0306841)

HSP 1 Score: 110.538 bits (275), Expect = 8.552e-25
Identity = 123/476 (25.84%), Postives = 200/476 (42.02%), Query Frame = 1
Query:  508 ERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGPVPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDEL---NGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNL--NSKRYYAISIP-EGIPEDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKI---FIIENRITSGTEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGDK-TIYFSAILANDSKELHLYKANITTGNFVCVSC-----KNPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAMP 1890
            +R +       +TD+I++      N    + SLS D T + I +  +  +RHS  AQY VFD+   E N  +       LQ   WSP    LA+VY NN++ +      S  I +T +      +  GV DW+YEEE+L   +A+WWS  G  +A   FND +V+ +   +YG+         H   ++YPK               +GS    KNPVV   +Y++  N    + I  P + + +D+ +  V W +  HLLI W NR QN   L+  Q+     + +   +   +   GW+++     S P      K     + I+N       +  +  L+L     +  +  W    +F    +  +D  +  +Y+ A L  D    H++       N  C+SC         C   +  F+K   +   SC GP+ P++  +       LQ D     NT  ++ I  K  P
Sbjct:   70 DRSIHKFNAATKTDVIFQNSSFLNNYVGATFSLSPDNTKILIRHNLTEKFRHSYIAQYDVFDI---ETNTTVQIHKGEKLQYCGWSPLRDRLAYVYLNNVFIH---FSESLEISITDDGVDGV-VYNGVPDWVYEEEVLSSGSAIWWSSDGSRLAVGFFNDTEVETFTYFLYGDGATTFYQYPHEEQLKYPK---------------SGS----KNPVVSLRVYDVSDNDPTMHTIVAPVDIVGDDHILQSVVWSNSTHLLITWMNRRQN---LTSIQS--CSYEGDCVEVKRLEEPQGWVDI-----STPKCLSTGKSCIFGYFIDN-------WHQVWNLDL-----ETGLNSWQSRGNFTVLSVYGYDEARDKLYYQATLPGDPSVYHVFS------NDECLSCGQIDADGAACRSASGTFSKSFSYYTLSCTGPN-PSYTRIFEASTKTLQVD--WEPNTAYRKQIEEKLRP 488          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Fly
Match: CG11034 (gene:FBgn0031741 transcript:FBtr0342609)

HSP 1 Score: 110.538 bits (275), Expect = 8.552e-25
Identity = 123/476 (25.84%), Postives = 200/476 (42.02%), Query Frame = 1
Query:  508 ERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGPVPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDEL---NGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNL--NSKRYYAISIP-EGIPEDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKI---FIIENRITSGTEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGDK-TIYFSAILANDSKELHLYKANITTGNFVCVSC-----KNPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAMP 1890
            +R +       +TD+I++      N    + SLS D T + I +  +  +RHS  AQY VFD+   E N  +       LQ   WSP    LA+VY NN++ +      S  I +T +      +  GV DW+YEEE+L   +A+WWS  G  +A   FND +V+ +   +YG+         H   ++YPK               +GS    KNPVV   +Y++  N    + I  P + + +D+ +  V W +  HLLI W NR QN   L+  Q+     + +   +   +   GW+++     S P      K     + I+N       +  +  L+L     +  +  W    +F    +  +D  +  +Y+ A L  D    H++       N  C+SC         C   +  F+K   +   SC GP+ P++  +       LQ D     NT  ++ I  K  P
Sbjct:   70 DRSIHKFNAATKTDVIFQNSSFLNNYVGATFSLSPDNTKILIRHNLTEKFRHSYIAQYDVFDI---ETNTTVQIHKGEKLQYCGWSPLRDRLAYVYLNNVFIH---FSESLEISITDDGVDGV-VYNGVPDWVYEEEVLSSGSAIWWSSDGSRLAVGFFNDTEVETFTYFLYGDGATTFYQYPHEEQLKYPK---------------SGS----KNPVVSLRVYDVSDNDPTMHTIVAPVDIVGDDHILQSVVWSNSTHLLITWMNRRQN---LTSIQS--CSYEGDCVEVKRLEEPQGWVDI-----STPKCLSTGKSCIFGYFIDN-------WHQVWNLDL-----ETGLNSWQSRGNFTVLSVYGYDEARDKLYYQATLPGDPSVYHVFS------NDECLSCGQIDADGAACRSASGTFSKSFSYYTLSCTGPN-PSYTRIFEASTKTLQVD--WEPNTAYRKQIEEKLRP 488          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Zebrafish
Match: dpp6a (dipeptidyl-peptidase 6a [Source:ZFIN;Acc:ZDB-GENE-090918-4])

HSP 1 Score: 175.252 bits (443), Expect = 3.286e-46
Identity = 150/522 (28.74%), Postives = 234/522 (44.83%), Query Frame = 1
Query:  250 EEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGP-VPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPED-----YYICFVKWIDDDHLLIGWANREQNEAWLSL--AQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGDKTIYFSAILANDSKELHLYKAN-ITTGNFVCVSCK-NPNCTYNTFDFNKKGGFVIHSCLGPSVP 1785
            +E+V SNP  ++WKGI IA+LVIL+I  LI+ ++   +P    + +  ++  K T  +IF+          +WI  + L Y   + +    N++T   T L+     +   AS     +S D  L+ + Y     Y HS TA Y +  ++  E  +   P V  A LQ A W P G  L F++ NN+YY    ++N  +  V++   +   I  G+ DWLYE EI +   A WWSP G  +A+ + ND  V   EI ++     L        YPK               AG     +NPV+  Y+ NLN   +   +I    PED     YY+  VKW     L + W NR QN + L+L  A   +  K        HE  + GW   L + N EP+      ++F        G        +++S   S     + I + D+D T ++ +D +  + +     +D K  HLY A+ + T N  C+SC    +C Y +  F+    + + +C GP VP
Sbjct:   19 QELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTP---GEDDSLAFKEKVTVEEIFKKDFKVHDPNAKWISNNELLYRTREGDVVRFNMETNESTILVTNRKFEMYKAS--KYEVSPDMKLVLLAYNVQLVYEHSFTADYIICSLETPETWILNPPEVRNAHLQYAGWGPRGQQLIFIFENNIYYRAT-VENRSIRLVSTG--KEGVIFNGLTDWLYEAEIFKSHIAHWWSPDGARLAYATINDTLVPRMEIPMF--TGSLYPTARQYHYPK---------------AGE----ENPVISLYVVNLNGPLH---TIEMRRPEDQRIGEYYVTMVKWATSTKLAVNWLNRAQNISILTLCVATTGVCTKK-------HEDESEGW---LHRQNEEPLFSKDGLRLFFTRAIPQGGRGKFFHISMSISQPNSSTDTLQSITSGDWDVTQVLAYDEESQLIYFLSTEDDPKRRHLYSADTVGTFNRRCLSCDFTDSCGYVSGSFSPTMDYFLLNCKGPGVP 498          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Zebrafish
Match: dpp6a (dipeptidyl-peptidase 6a [Source:ZFIN;Acc:ZDB-GENE-090918-4])

HSP 1 Score: 174.481 bits (441), Expect = 1.438e-45
Identity = 150/524 (28.63%), Postives = 233/524 (44.47%), Query Frame = 1
Query:  250 EEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGP-VPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKA--KNPVVKPYIYNLNSKRYYAISIPEGIPED-----YYICFVKWIDDDHLLIGWANREQNEAWLSL--AQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGDKTIYFSAILANDSKELHLYKAN-ITTGNFVCVSCK-NPNCTYNTFDFNKKGGFVIHSCLGPSVP 1785
            +E+V SNP  ++WKGI IA+LVIL+I  LI+ ++   +P    + +  ++  K T  +IF+          +WI  + L Y   + +    N++T   T L+     +   AS     +S D  L+ + Y     Y HS TA Y +  ++  E  +   P V  A LQ A W P G  L F++ NN+YY    ++N  +  V++   +   I  G+ DWLYE EI +   A WWSP G  +A+ + ND  V   EI +          F    YP                    PKA  +NPV+  Y+ NLN   +   +I    PED     YY+  VKW     L + W NR QN + L+L  A   +  K        HE  + GW   L + N EP+      ++F        G        +++S   S     + I + D+D T ++ +D +  + +     +D K  HLY A+ + T N  C+SC    +C Y +  F+    + + +C GP VP
Sbjct:   19 QELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTP---GEDDSLAFKEKVTVEEIFKKDFKVHDPNAKWISNNELLYRTREGDVVRFNMETNESTILVTNRKFEMYKAS--KYEVSPDMKLVLLAYNVQLVYEHSFTADYIICSLETPETWILNPPEVRNAHLQYAGWGPRGQQLIFIFENNIYYRAT-VENRSIRLVSTG--KEGVIFNGLTDWLYEAEIFKSHIAHWWSPDGARLAYATINDTLVPRMEIPM----------FTGSLYPTAR-------------QYHYPKAGEENPVISLYVVNLNGPLH---TIEMRRPEDQRIGEYYVTMVKWATSTKLAVNWLNRAQNISILTLCVATTGVCTKK-------HEDESEGW---LHRQNEEPLFSKDGLRLFFTRAIPQGGRGKFFHISMSISQPNSSTDTLQSITSGDWDVTQVLAYDEESQLIYFLSTEDDPKRRHLYSADTVGTFNRRCLSCDFTDSCGYVSGSFSPTMDYFLLNCKGPGVP 498          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Zebrafish
Match: dpp6b (dipeptidyl-peptidase 6b [Source:ZFIN;Acc:ZDB-GENE-070705-88])

HSP 1 Score: 166.777 bits (421), Expect = 8.966e-43
Identity = 153/526 (29.09%), Postives = 235/526 (44.68%), Query Frame = 1
Query:  250 EEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSK--FTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLI----WKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGP--VPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYA-ISIPEG--IPEDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIA-ELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGDKTIYFSAILANDSKELHLYKANITTGNF--VCVSCKNPNCTYNTFDFNKKGGFVIHSCLGPSVP 1785
            +E+V  +   ++WKGI IA+LVIL+I  LI+ ++   +P        TS  SK   T  DIF  +    +    W+    L Y +     K+LN+QT     L+    ++ +  ++   PT   +S D   + + Y     Y++S  A Y +  +   E  VE+ P  V    LQ A W P G  L F++ NN+YY       S  +  T +L     I  G+ADWLYEEEI +   A WWSP G  +A+ + ND  V   EI ++      NG     RYPK               AG     +NP +   + +LN   +   +  PE   I +DYYI  VKW     L + W NR QN + L+L +   TG   +     HE  ++ W++      +EP +F +    F     +  G   +     ++ S   S     + + + D+D T I+ ++ D  I +     + +    LY AN TTG+F   C+SC N  C Y +  F+    +   +C GP VP
Sbjct:   64 DELVGGSAPQRNWKGIAIALLVILVICSLIVTSVILLTP-----VEDTSLASKQKVTIEDIFSGKLQAHNPQATWLSDTELLYHDHDGNVKMLNIQTNYNKTLVENKTFESFHSQEAYRPTQYQVSPDLKYVLLAYNIMPIYQYSFMAYYIICSLDSPE-RVELTPNEVQSTALQYAGWGPKGQQLIFIFENNIYYKAQVNSPSIRLVSTGSLGV---IFNGLADWLYEEEIFQNHIAHWWSPDGLRLAYATINDTLVPKMEIPMFTSVLYPNGQ--EYRYPK---------------AGE----ENPEIYLSVVSLNGPLHTVRMKKPEDPRIRKDYYITMVKWATSTKLAVNWLNRAQNSSILTLCEA-TTGICTKK----HEDESDSWLH----RQNEPPLFSKDGYRFFFTRAVPQGGRGKFFHISMSTSQPNSSTDTLQSLTSGDWDVTQILAYNEDTRIVYFLSTEDGASRRQLYSAN-TTGSFNRRCLSC-NFRCGYVSGSFSPDANYFFLNCKGPGVP 548          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Zebrafish
Match: dpp6b (dipeptidyl-peptidase 6b [Source:ZFIN;Acc:ZDB-GENE-070705-88])

HSP 1 Score: 165.236 bits (417), Expect = 2.010e-42
Identity = 153/521 (29.37%), Postives = 230/521 (44.15%), Query Frame = 1
Query:  253 EIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSK--FTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGP--VPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYA-ISIPEG--IPEDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIA-ELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGDKTIYFSAILANDSKELHLYKANITTGNF--VCVSCKNPNCTYNTFDFNKKGGFVIHSCLGPSVP 1785
            E+V  +   ++WKGI IA+LVIL+I  LI+ ++   +P        TS  SK   T  DIF  +    +    W+    L Y +     K+LN+QT     L+     +     PT   +S D   + + Y     Y++S  A Y +  +   E  VE+ P  V    LQ A W P G  L F++ NN+YY       S  +  T +L     I  G+ADWLYEEEI +   A WWSP G  +A+ + ND  V   EI ++      NG     RYPK               AG     +NP +   + +LN   +   +  PE   I +DYYI  VKW     L + W NR QN + L+L +   TG   +     HE  ++ W++      +EP +F +    F     +  G   +     ++ S   S     + + + D+D T I+ ++ D  I +     + +    LY AN TTG+F   C+SC N  C Y +  F+    +   +C GP VP
Sbjct:    1 ELVGGSAPQRNWKGIAIALLVILVICSLIVTSVILLTP-----VEDTSLASKQKVTIEDIFSGKLQAHNPQATWLSDTELLYHDHDGNVKMLNIQTNYNKTLVENKTFEAYR--PTQYQVSPDLKYVLLAYNIMPIYQYSFMAYYIICSLDSPE-RVELTPNEVQSTALQYAGWGPKGQQLIFIFENNIYYKAQVNSPSIRLVSTGSLGV---IFNGLADWLYEEEIFQNHIAHWWSPDGLRLAYATINDTLVPKMEIPMFTSVLYPNGQ--EYRYPK---------------AGE----ENPEIYLSVVSLNGPLHTVRMKKPEDPRIRKDYYITMVKWATSTKLAVNWLNRAQNSSILTLCEA-TTGICTKK----HEDESDSWLH----RQNEPPLFSKDGYRFFFTRAVPQGGRGKFFHISMSTSQPNSSTDTLQSLTSGDWDVTQILAYNEDTRIVYFLSTEDGASRRQLYSAN-TTGSFNRRCLSC-NFRCGYVSGSFSPDANYFFLNCKGPGVP 478          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Zebrafish
Match: dpp4 (dipeptidyl-peptidase 4 [Source:ZFIN;Acc:ZDB-GENE-081104-277])

HSP 1 Score: 149.828 bits (377), Expect = 1.918e-37
Identity = 138/508 (27.17%), Postives = 226/508 (44.49%), Query Frame = 1
Query:  409 FTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKE-VNVEIGPVPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAK--NPVVKPYIYNLNSKRYYAISIPEGI-PEDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQ----NWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGDKTIYFSAILANDS-KELHLYKANITTGNFV---CVSC--KNPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAMP 1890
            FT  D F       S    W+  D   +   +    L N  T N  + + +       A     S  R        Y  +  +RH+ TA Y+++D++K++ +N +I   P   +Q   WSPTGH LAFV+  N+Y  E P  NS    VT+N   +  ++ GV DW+YEEE+   ++ALWWSP+G+ +A+  FND +V N E   +GE           +YP+  F+               PKA   NP VK ++++ N+     +S+P  +   ++Y+  V W  D  + + W  R QN   L        NW  G    S +I    ++ GW+     S  EP+  P     + I   +++   ++++A   +      L   KW V +    T       +  +YF +   N+S  + ++YK  I   +     C++C      C YN+  F+ +G + + SC GP +P     L T +    + R+L NN+ L+  +   AMP
Sbjct:   39 FTLEDYFNGTGRTKSYNMRWVSDDEYFHKTGEGSVFLFNATTGNGNEFVNQQIFARVAAFDYLVSADRKYVCFLSNY--TKLWRHTYTASYSIYDLEKRDFINTDI---PH-DVQYLAWSPTGHKLAFVWKYNVYVKETP--NSAFKQVTTNGAHNLILN-GVPDWVYEEEMFSTNSALWWSPNGRFVAYAEFNDSEVHNIEYTWFGEG----------QYPETVFV-------------PYPKAGTPNPTVKLFVFDTNTNTIKQVSVPSDVGAGEHYLSTVTWASDHRIAVQWQKRTQNYVVLETYDFNDGNWTEGS--LSQII---TSSTGWVGRF--SPDEPVFRPDGNSCYYI---LSNDERFKHLAYF-IGTQRIFLTRGKWEVISILKVT-------NNALYFVSNEHNESPGQRNVYKITINGASHSDRECLTCTLNADRCKYNSATFSTEGSYYLMSCSGPGLP-----LYTLRNSQAELRVLENNSVLEHKLQEIAMP 491          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Xenopus
Match: dpp6 (dipeptidyl-peptidase 6 [Source:NCBI gene;Acc:100125080])

HSP 1 Score: 179.874 bits (455), Expect = 3.668e-47
Identity = 173/560 (30.89%), Postives = 260/560 (46.43%), Query Frame = 1
Query:  250 EEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIF-RSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGP-VPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPED-----YYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSG--TEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFD-GDKTIYFSAILANDSKELHLYKANITTGNF--VCVSCKNPN-CTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAMP 1890
            +E+V SNP  ++WKGI IA+LVIL+I  LI+ ++   +P+   + N  S   K    D+  R  A+H     +WI    + +  ++     LN++    T LI     +    S     +S D   + + Y     YR S TA Y + ++   E  +   P V  A LQ A W P G  L F++ NN+YY  N    S+ I + S   +   I  G++DWLYEEE+LR   A WWSP G  +A+ + ND KV   EI +Y     L        YPK               AGS    +NPVV  ++ NLN   ++    P   P+D     YYI  VKW     + + W NREQN + L+L  +  TG   +     HE  +  W   L + N EP+ F R  + F     I  G   ++ +IA  +     S   ++  I + D+D T I+ +D  ++ +YF +   +  +  HLY AN T G+F   C+SC     CTY +  F+    + I  C GP VP   +   T + IL +   L NN+ ++  +  K +P
Sbjct:   19 QELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPD---EDNSLSLKPKVCLEDLVSRDFAIHDPEA-KWINDKTIIFRTQQGNVVKLNVEQNESTLLIENKTFEALKVS--KYEVSPDMKYVLMAYDVVPVYRRSFTAHYVLCNLITGEHRILNPPEVRNAQLQYAGWGPKGQQLIFIFENNIYYQMNA--ESRAIRLVSTGKEGV-IFNGLSDWLYEEEVLRTHIAHWWSPDGARLAYSTINDTKVPTMEIPLY--TGSLYPTVKTYHYPK---------------AGS----ENPVVTLHVVNLNGPLHHVEMTP---PDDQRMREYYITMVKWATSTKVAVNWLNREQNISILTLC-DATTGICTKK----HEDESEAW---LHRQNEEPV-FSRDGRKFFFVRAIPQGGRGKFHHIAMSSSQANNSNDNLQS-ITSGDWDVTKILAYDEKNQKVYFLST-EDSPRRRHLYSAN-TNGSFNRRCISCDLIEYCTYVSASFSHGLDYFILRCEGPRVPVVTVHNTTNRQILIE---LENNSYVEYAMGEKQIP 530          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Xenopus
Match: dpp6 (dipeptidyl-peptidase 6 [Source:NCBI gene;Acc:100125080])

HSP 1 Score: 179.489 bits (454), Expect = 5.287e-47
Identity = 173/559 (30.95%), Postives = 259/559 (46.33%), Query Frame = 1
Query:  253 EIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIF-RSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGP-VPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPED-----YYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSG--TEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFD-GDKTIYFSAILANDSKELHLYKANITTGNF--VCVSCKNPN-CTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAMP 1890
            E+V SNP  ++WKGI IA+LVIL+I  LI+ ++   +P+   + N  S   K    D+  R  A+H     +WI    + +  ++     LN++    T LI     +    S     +S D   + + Y     YR S TA Y + ++   E  +   P V  A LQ A W P G  L F++ NN+YY  N    S+ I + S   +   I  G++DWLYEEE+LR   A WWSP G  +A+ + ND KV   EI +Y     L        YPK               AGS    +NPVV  ++ NLN   ++    P   P+D     YYI  VKW     + + W NREQN + L+L  +  TG   +     HE  +  W   L + N EP+ F R  + F     I  G   ++ +IA  +     S   ++  I + D+D T I+ +D  ++ +YF +   +  +  HLY AN T G+F   C+SC     CTY +  F+    + I  C GP VP   +   T + IL +   L NN+ ++  +  K +P
Sbjct:   50 ELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPD---EDNSLSLKPKVCLEDLVSRDFAIHDPEA-KWINDKTIIFRTQQGNVVKLNVEQNESTLLIENKTFEALKVS--KYEVSPDMKYVLMAYDVVPVYRRSFTAHYVLCNLITGEHRILNPPEVRNAQLQYAGWGPKGQQLIFIFENNIYYQMNA--ESRAIRLVST-GKEGVIFNGLSDWLYEEEVLRTHIAHWWSPDGARLAYSTINDTKVPTMEIPLY--TGSLYPTVKTYHYPK---------------AGS----ENPVVTLHVVNLNGPLHHVEMTP---PDDQRMREYYITMVKWATSTKVAVNWLNREQNISILTLC-DATTGICTKK----HEDESEAW---LHRQNEEPV-FSRDGRKFFFVRAIPQGGRGKFHHIAMSSSQANNSNDNLQS-ITSGDWDVTKILAYDEKNQKVYFLST-EDSPRRRHLYSAN-TNGSFNRRCISCDLIEYCTYVSASFSHGLDYFILRCEGPRVPVVTVHNTTNRQILIE---LENNSYVEYAMGEKQIP 560          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Xenopus
Match: dpp6 (dipeptidyl-peptidase 6 [Source:NCBI gene;Acc:100125080])

HSP 1 Score: 179.489 bits (454), Expect = 6.018e-47
Identity = 173/560 (30.89%), Postives = 260/560 (46.43%), Query Frame = 1
Query:  250 EEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIF-RSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGP-VPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPED-----YYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSG--TEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFD-GDKTIYFSAILANDSKELHLYKANITTGNF--VCVSCKNPN-CTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAMP 1890
            +E+V SNP  ++WKGI IA+LVIL+I  LI+ ++   +P+   + N  S   K    D+  R  A+H     +WI    + +  ++     LN++    T LI     +    S     +S D   + + Y     YR S TA Y + ++   E  +   P V  A LQ A W P G  L F++ NN+YY  N    S+ I + S   +   I  G++DWLYEEE+LR   A WWSP G  +A+ + ND KV   EI +Y     L        YPK               AGS    +NPVV  ++ NLN   ++    P   P+D     YYI  VKW     + + W NREQN + L+L  +  TG   +     HE  +  W   L + N EP+ F R  + F     I  G   ++ +IA  +     S   ++  I + D+D T I+ +D  ++ +YF +   +  +  HLY AN T G+F   C+SC     CTY +  F+    + I  C GP VP   +   T + IL +   L NN+ ++  +  K +P
Sbjct:   64 DELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPD---EDNSLSLKPKVCLEDLVSRDFAIHDPEA-KWINDKTIIFRTQQGNVVKLNVEQNESTLLIENKTFEALKVS--KYEVSPDMKYVLMAYDVVPVYRRSFTAHYVLCNLITGEHRILNPPEVRNAQLQYAGWGPKGQQLIFIFENNIYYQMNA--ESRAIRLVSTGKEG-VIFNGLSDWLYEEEVLRTHIAHWWSPDGARLAYSTINDTKVPTMEIPLY--TGSLYPTVKTYHYPK---------------AGS----ENPVVTLHVVNLNGPLHHVEMTP---PDDQRMREYYITMVKWATSTKVAVNWLNREQNISILTLC-DATTGICTKK----HEDESEAW---LHRQNEEPV-FSRDGRKFFFVRAIPQGGRGKFHHIAMSSSQANNSNDNLQS-ITSGDWDVTKILAYDEKNQKVYFLST-EDSPRRRHLYSAN-TNGSFNRRCISCDLIEYCTYVSASFSHGLDYFILRCEGPRVPVVTVHNTTNRQILIE---LENNSYVEYAMGEKQIP 575          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Xenopus
Match: dpp6 (dipeptidyl-peptidase 6 [Source:NCBI gene;Acc:100125080])

HSP 1 Score: 166.777 bits (421), Expect = 8.240e-43
Identity = 168/558 (30.11%), Postives = 250/558 (44.80%), Query Frame = 1
Query:  253 EIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIF-RSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGP-VPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPED-----YYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSG--TEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGDKTIYFSAILANDSKELHLYKANITTGNF--VCVSCKNPN-CTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAMP 1890
            E+V SNP  ++WKGI IA+LVIL+I  LI+ ++   +P+   + N  S   K    D+  R  A+H     +WI    + +  ++     LN++    T LI     +    S     +S D   + + Y     YR S TA Y + ++   E  +   P V  A LQ A W P G  L F++ NN+YY  N    S+ I + S   +   I  G++DWLYEEE+LR   A WWSP G  +A+ + ND KV   EI +Y     L        YPK               AGS    +NPVV  ++ NLN   ++    P   P+D     YYI  VKW     + + W NREQN + L+L  +  TG   +     HE  +  W   L + N EP+ F R  + F     I  G   ++ +IA   +S +     +  + + A  +             YF +   +  +  HLY AN T G+F   C+SC     CTY +  F+    + I  C GP VP   +   T + IL +   L NN+ ++  +  K +P
Sbjct:    1 ELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPD---EDNSLSLKPKVCLEDLVSRDFAIHDPEA-KWINDKTIIFRTQQGNVVKLNVEQNESTLLIENKTFEALKVS--KYEVSPDMKYVLMAYDVVPVYRRSFTAHYVLCNLITGEHRILNPPEVRNAQLQYAGWGPKGQQLIFIFENNIYYQMNA--ESRAIRLVSTGKEG-VIFNGLSDWLYEEEVLRTHIAHWWSPDGARLAYSTINDTKVPTMEIPLY--TGSLYPTVKTYHYPK---------------AGS----ENPVVTLHVVNLNGPLHHVEMTP---PDDQRMREYYITMVKWATSTKVAVNWLNREQNISILTLC-DATTGICTKK----HEDESEAW---LHRQNEEPV-FSRDGRKFFFVRAIPQGGRGKFHHIA---MSSSQVTNQLENFNIPAQIEGLLCKRVGKLALTYFLST-EDSPRRRHLYSAN-TNGSFNRRCISCDLIEYCTYVSASFSHGLDYFILRCEGPRVPVVTVHNTTNRQILIE---LENNSYVEYAMGEKQIP 508          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Xenopus
Match: dpp6 (dipeptidyl-peptidase 6 [Source:NCBI gene;Acc:100125080])

HSP 1 Score: 159.844 bits (403), Expect = 1.574e-40
Identity = 156/518 (30.12%), Postives = 240/518 (46.33%), Query Frame = 1
Query:  253 EIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIF-RSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGPVPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPED-----YYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGT-EYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFD-GDKTIYFSAILANDSKELHLYKANITTGNF--VCVSCKNPN-CTYNTFDFNKKGGFVIHSCLG 1773
            E+V SNP  ++WKGI IA+LVIL+I  LI+ ++   +P+   + N  S   K    D+  R  A+H     +WI    + +  ++     LN++    T LI       +N +  +  +S  GT++F+            T+ + VF  ++  + +    V  A LQ A W P G  L F++ NN+YY  N    S+ I + S   +   I  G++DWLYEEE+LR   A WWSP G  +A+ + ND KV   EI +Y     L        YPK               AGS    +NPVV  ++ NLN   ++    P   P+D     YYI  VKW     + + W NREQN + L+L  +  TG   +     HE  +  W   L + N EP+     +K F +      G  ++ +IA  +     S   ++  I + D+D T I+ +D  ++ +YF +   +  +  HLY AN T G+F   C+SC     CTY +  F+    + I  C G
Sbjct:   16 ELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPD---EDNSLSLKPKVCLEDLVSRDFAIHDPEA-KWINDKTIIFRTQQGNVVKLNVEQNESTLLI-------ENKTFVTI-ISTLGTIIFL------------TSSFVVFHFREHRI-LNPPEVRNAQLQYAGWGPKGQQLIFIFENNIYYQMNA--ESRAIRLVSTGKEG-VIFNGLSDWLYEEEVLRTHIAHWWSPDGARLAYSTINDTKVPTMEIPLY--TGSLYPTVKTYHYPK---------------AGS----ENPVVTLHVVNLNGPLHHVEMTP---PDDQRMREYYITMVKWATSTKVAVNWLNREQNISILTLC-DATTGICTKK----HEDESEAW---LHRQNEEPVFSRDGRKFFFVRAIPQGGRGKFHHIAMSSSQANNSNDNLQS-ITSGDWDVTKILAYDEKNQKVYFLST-EDSPRRRHLYSAN-TNGSFNRRCISCDLIEYCTYVSASFSHGLDYFILRCEG 470          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Mouse
Match: Dpp6 (dipeptidylpeptidase 6 [Source:MGI Symbol;Acc:MGI:94921])

HSP 1 Score: 168.318 bits (425), Expect = 2.397e-43
Identity = 164/570 (28.77%), Postives = 248/570 (43.51%), Query Frame = 1
Query:  202 TALLNQNVNDLKALPTEEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGP-VPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIP--EDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGT-EYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGDKT-IYFSAILANDSKELHLYKAN-ITTGNFVCVSCK-NPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAMP 1890
            TA  + NV        +E+V SNP  ++WKGI IA+LVIL+I  LI+ ++   +P    +    S   K T  D+F           +WI      Y   K    L N++T N T LI    ++   A      +S D   +   Y     Y+HS T  Y +  +   +      P V  A LQ A W P G  L F++ NN+YY  +    +  +  T    +   I  G++DWLYEEEIL+   A WWSP G  +A+ + ND +V   E+  Y     +        YPK               AGS    +NP +  ++  LN   +    +P   P   +YYI  VKW     + + W NR QN + L+L  +  TG   +     HE  +  W   L + N EP+     +K F +      G  ++ +I   +     S   I+  I + D+D T I+ +D  +  IYF +   +  +  HLY AN +   N  C+SC    NCTY +  F+    F +  C GP VPT  +   T+K  +     L  N ++++ I  + MP
Sbjct:    4 TAGASNNVRCPPGKGHKELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPA---EDTSLSQKKKVTVEDLFSEDFKIHDPEAKWISNKEFIYRERKGSVILRNVETNNSTVLIEGKKIESLRA--IRYEISPDKEYVLFSYNVEPVYQHSHTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTG---KEGVIYNGLSDWLYEEEILKSHIAHWWSPDGTRLAYATINDSRVPLMELPTY--TGSVYPTVKPYHYPK---------------AGS----ENPSISLHVIGLNGPTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLC-DATTGVCTKK----HEDESEAW---LHRQNEEPVFSKDGRKFFFVRAIPQGGRGKFYHITVSSSQPNSSNDNIQS-ITSGDWDVTKILSYDEKRNKIYFLST-EDLPRRRHLYSANTVDDFNRQCLSCDLVENCTYVSASFSHNMDFFLLKCEGPGVPTVTVHNTTDKRRMFD---LEANEEVQKAINDRQMP 531          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Mouse
Match: Dpp6 (dipeptidylpeptidase 6 [Source:MGI Symbol;Acc:MGI:94921])

HSP 1 Score: 167.548 bits (423), Expect = 4.171e-43
Identity = 161/557 (28.90%), Postives = 245/557 (43.99%), Query Frame = 1
Query:  250 EEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGP-VPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVR---YPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIP--EDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGT-EYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGDKT-IYFSAILANDSKELHLYKAN-ITTGNFVCVSCK-NPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAMP 1890
            +E+V SNP  ++WKGI IA+LVIL+I  LI+ ++   +P    +    S   K T  D+F           +WI      Y   K    L N++T N T LI    ++   A      +S D   +   Y     Y+HS T  Y +  +   +      P V  A LQ A W P G  L F++ NN+YY  +    +  +  T    +   I  G++DWLYEEEIL+   A WWSP G  +A+ + ND +V   E+  Y         +  V+   YPK               AGS    +NP +  ++  LN   +    +P   P   +YYI  VKW     + + W NR QN + L+L  +  TG   +     HE  +  W   L + N EP+     +K F +      G  ++ +I   +     S   I+  I + D+D T I+ +D  +  IYF +   +  +  HLY AN +   N  C+SC    NCTY +  F+    F +  C GP VPT  +   T+K  +     L  N ++++ I  + MP
Sbjct:   19 QELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPA---EDTSLSQKKKVTVEDLFSEDFKIHDPEAKWISNKEFIYRERKGSVILRNVETNNSTVLIEGKKIESLRA--IRYEISPDKEYVLFSYNVEPVYQHSHTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTG---KEGVIYNGLSDWLYEEEILKSHIAHWWSPDGTRLAYATINDSRVPLMELPTY-----TGSVYPTVKPYHYPK---------------AGS----ENPSISLHVIGLNGPTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLC-DATTGVCTKK----HEDESEAW---LHRQNEEPVFSKDGRKFFFVRAIPQGGRGKFYHITVSSSQPNSSNDNIQS-ITSGDWDVTKILSYDEKRNKIYFLST-EDLPRRRHLYSANTVDDFNRQCLSCDLVENCTYVSASFSHNMDFFLLKCEGPGVPTVTVHNTTDKRRMFD---LEANEEVQKAINDRQMP 530          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Mouse
Match: Dpp6 (dipeptidylpeptidase 6 [Source:MGI Symbol;Acc:MGI:94921])

HSP 1 Score: 166.392 bits (420), Expect = 8.453e-43
Identity = 160/553 (28.93%), Postives = 242/553 (43.76%), Query Frame = 1
Query:  253 EIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGP-VPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIP--EDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGT-EYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGDKT-IYFSAILANDSKELHLYKAN-ITTGNFVCVSCK-NPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAMP 1890
            E+V SNP  ++WKGI IA+LVIL+I  LI+ ++   +P    +    S   K T  D+F           +WI      Y   K    L N++T N T LI    ++   A      +S D   +   Y     Y+HS T  Y +  +   +      P V  A LQ A W P G  L F++ NN+YY  +    +  +  T    +   I  G++DWLYEEEIL+   A WWSP G  +A+ + ND +V   E+  Y     +        YPK               AGS    +NP +  ++  LN   +    +P   P   +YYI  VKW     + + W NR QN + L+L  +  TG   +     HE  +  W   L + N EP+     +K F +      G  ++ +I   +     S   I+  I + D+D T I+ +D  +  IYF +   +  +  HLY AN +   N  C+SC    NCTY +  F+    F +  C GP VPT  +   T+K  +     L  N ++++ I  + MP
Sbjct:   18 ELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPA---EDTSLSQKKKVTVEDLFSEDFKIHDPEAKWISNKEFIYRERKGSVILRNVETNNSTVLIEGKKIESLRA--IRYEISPDKEYVLFSYNVEPVYQHSHTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTG---KEGVIYNGLSDWLYEEEILKSHIAHWWSPDGTRLAYATINDSRVPLMELPTY--TGSVYPTVKPYHYPK---------------AGS----ENPSISLHVIGLNGPTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLC-DATTGVCTKK----HEDESEAW---LHRQNEEPVFSKDGRKFFFVRAIPQGGRGKFYHITVSSSQPNSSNDNIQS-ITSGDWDVTKILSYDEKRNKIYFLST-EDLPRRRHLYSANTVDDFNRQCLSCDLVENCTYVSASFSHNMDFFLLKCEGPGVPTVTVHNTTDKRRMFD---LEANEEVQKAINDRQMP 528          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Mouse
Match: Dpp6 (dipeptidylpeptidase 6 [Source:MGI Symbol;Acc:MGI:94921])

HSP 1 Score: 166.777 bits (421), Expect = 9.835e-43
Identity = 160/554 (28.88%), Postives = 242/554 (43.68%), Query Frame = 1
Query:  250 EEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGP-VPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIP--EDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGT-EYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGDKT-IYFSAILANDSKELHLYKAN-ITTGNFVCVSCK-NPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAMP 1890
            +E+V SNP  ++WKGI IA+LVIL+I  LI+ ++   +P    +    S   K T  D+F           +WI      Y   K    L N++T N T LI    ++   A      +S D   +   Y     Y+HS T  Y +  +   +      P V  A LQ A W P G  L F++ NN+YY  +    +  +  T    +   I  G++DWLYEEEIL+   A WWSP G  +A+ + ND +V   E+  Y     +        YPK               AGS    +NP +  ++  LN   +    +P   P   +YYI  VKW     + + W NR QN + L+L  +  TG         HE  +  W   L + N EP+     +K F +      G  ++ +I   +     S   I+  I + D+D T I+ +D  +  IYF +   +  +  HLY AN +   N  C+SC    NCTY +  F+    F +  C GP VPT  +   T+K  +     L  N ++++ I  + MP
Sbjct:   75 DELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPA---EDTSLSQKKKVTVEDLFSEDFKIHDPEAKWISNKEFIYRERKGSVILRNVETNNSTVLIEGKKIESLRA--IRYEISPDKEYVLFSYNVEPVYQHSHTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTG---KEGVIYNGLSDWLYEEEILKSHIAHWWSPDGTRLAYATINDSRVPLMELPTY--TGSVYPTVKPYHYPK---------------AGS----ENPSISLHVIGLNGPTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLC-DATTG----VCTKKHEDESEAW---LHRQNEEPVFSKDGRKFFFVRAIPQGGRGKFYHITVSSSQPNSSNDNIQS-ITSGDWDVTKILSYDEKRNKIYFLST-EDLPRRRHLYSANTVDDFNRQCLSCDLVENCTYVSASFSHNMDFFLLKCEGPGVPTVTVHNTTDKRRMFD---LEANEEVQKAINDRQMP 586          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Mouse
Match: Dpp10 (dipeptidylpeptidase 10 [Source:MGI Symbol;Acc:MGI:2442409])

HSP 1 Score: 154.836 bits (390), Expect = 7.085e-39
Identity = 159/559 (28.44%), Postives = 255/559 (45.62%), Query Frame = 1
Query:  250 EEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGP--VPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKA--KNPVVKPYIYNLNSKRYYAISIPEGI--PEDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSG--TEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFD-GDKTIYFSAILANDSKELHLYKANITTG--NFVCVSCK--NPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAM 1887
            EE+ +++P  ++WKGI IA+LVIL++  LI +++   +P+   ++++T    +   G  F    LH +    WI   ++ Y         LN ++   T L+         AS    SLS D   + + Y     + +S TA Y ++++   EV  E+ P  V  + LQ A W   G  L +++ NN+YY   P   S  + +TS+  +   I  G+ADWLYEEE+L    A WWSP G+ +AFL  ND  V N  I            F    YPK                   PKA   NP VK Y+ NL    +    +P  I    +YYI  VKW+ +   ++ W NR QN + L+L ++  TG     +    E T++ W   L + N EP+ F R    F +   +  G   E+ +IA   +     ++ +R  + + +++   I+ +D   + IYF +  ++      LY A+ T G  N  C+SC     +CTY    F+      +  C GP VP   L +        +  +L NN+ +K+ I +K +
Sbjct:   13 EELGSNSPPQRNWKGIAIALLVILVVCSLITMSVILLTPDELTNSSETRLSLEELLGKGF---GLH-NPEPRWINDTVVVYKTNNGHVMKLNTESNASTLLLDNSTFVTFKAS--RHSLSPDLKYVLLAYDVKQIFHYSFTASYLIYNIHTGEV-WELNPPEVEDSVLQYAAWGVQGQQLIYIFENNIYYQ--PDIKSSSLRLTSSGKEGI-IFNGIADWLYEEELLHSHIAHWWSPDGERLAFLMINDSLVPNMIIP----------RFTGALYPKAK-------------QYPYPKAGQANPSVKLYVVNLYGPTHTLELMPPDIFKSREYYITMVKWVSNTRTVVRWLNRPQNISILTLCES-TTGACSRKY----EMTSDTW---LSKQNEEPV-FSRDGSKFFMTVPVKQGGRGEFHHIAMFLVQSKSEQITVRH-LTSGNWEVIRILAYDETTQKIYFLSTESSPQGR-QLYSAS-TEGLLNRDCISCNFMKEDCTYFDASFSPMNQHFLLFCEGPKVPVVSLHITDNPS---RYFLLENNSVMKETIQKKKL 523          
BLAST of Dipeptidyl peptidase 4 vs. UniProt/SwissProt
Match: sp|Q5IS50|DPP6_PANTR (Dipeptidyl aminopeptidase-like protein 6 OS=Pan troglodytes OX=9598 GN=DPP6 PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 2.140e-43
Identity = 163/555 (29.37%), Postives = 241/555 (43.42%), Query Frame = 1
Query:  250 EEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGP-VPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIP--EDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFD--GDKTIYFSAILANDSKELHLYKANITTGNF--VCVSCK-NPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAMP 1890
            +E+V SNP  ++WKGI IA+LVIL+I  LI+ ++   +P    + N  S   K T  D+F           +WI      Y  +K   +L N++T   T LI    ++   A      +S D       Y     Y+HS T  Y +  +   +      P V  A LQ A W P G  L F++ NN+YY  +    +  +  T    +   I  G++DWLYEEEIL+   A WWSP G  +A+ + ND +V   E+  Y     +        YPK               AGS    +NP +  ++  LN   +    +P   P   +YYI  VKW     + + W NR QN + L+L  +  TG   +     HE  +  W   L + N EP+     +K F I      G        ++LS   S     + I + D+D T I+ +D  G+K  + S    +  +   LY AN T GNF   C+SC    NCTY +  F+    F +  C GP VP   +   T+K  +     L  N  +K+ I  + MP
Sbjct:   19 QELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPA---EDNSLSQKKKVTVEDLFSEDFKIHDPEAKWISDTEFIYREQKGTVRLWNVETNISTVLIEGKKIESLRA--IRYEISPDREYALFSYNVEPIYQHSYTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTG---KEGVIYNGLSDWLYEEEILKTHIAHWWSPDGTRLAYATINDSRVPIMELPTY--TGSIYPTVKPYHYPK---------------AGS----ENPSISLHVIGLNGPTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLC-DATTGVCTKK----HEDESEAW---LHRQNEEPVFSKDGRKFFFIRAIPQGGRGKFYHITMSLSQPNSSNDNIQSITSGDWDVTKILAYDEKGNKIYFLST--EDLPRRRQLYSAN-TVGNFNRQCLSCDLVDNCTYFSASFSHSMDFFLLKCEGPGVPMVTVHNTTDKKKMFD---LETNEHVKKAINDRQMP 530          
BLAST of Dipeptidyl peptidase 4 vs. UniProt/SwissProt
Match: sp|P42658|DPP6_HUMAN (Dipeptidyl aminopeptidase-like protein 6 OS=Homo sapiens OX=9606 GN=DPP6 PE=1 SV=2)

HSP 1 Score: 168.703 bits (426), Expect = 1.238e-42
Identity = 163/556 (29.32%), Postives = 243/556 (43.71%), Query Frame = 1
Query:  250 EEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGP-VPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIP--EDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGT-EYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFD--GDKTIYFSAILANDSKELHLYKANITTGNF--VCVSCK-NPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAMP 1890
            +E+V SNP  ++WKGI IA+LVIL+I  LI+ ++   +P    + N  S   K T  D+F           +WI      Y  +K   +L N++T   T LI    ++   A      +S D       Y     Y+HS T  Y +  +   +      P V  A LQ A W P G  L F++ NN+YY  +    +  +  T    +   I  G++DWLYEEEIL+   A WWSP G  +A+ + ND +V   E+  Y     +        YPK               AGS    +NP +  ++  LN   +    +P   P   +YYI  VKW     + + W NR QN + L+L  +  TG   +     HE  +  W   L + N EP+     +K F I      G  ++ +I   +     S   I+  I + D+D T I+ +D  G+K  + S    +  +   LY AN T GNF   C+SC    NCTY +  F+    F +  C GP VP   +   T+K  +     L  N  +K+ I  + MP
Sbjct:   81 DELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPA---EDNSLSQKKKVTVEDLFSEDFKIHDPEAKWISDTEFIYREQKGTVRLWNVETNTSTVLIEGKKIESLRA--IRYEISPDREYALFSYNVEPIYQHSYTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTG---KEGVIYNGLSDWLYEEEILKTHIAHWWSPDGTRLAYAAINDSRVPIMELPTY--TGSIYPTVKPYHYPK---------------AGS----ENPSISLHVIGLNGPTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLC-DATTGVCTKK----HEDESEAW---LHRQNEEPVFSKDGRKFFFIRAIPQGGRGKFYHITVSSSQPNSSNDNIQS-ITSGDWDVTKILAYDEKGNKIYFLST--EDLPRRRQLYSAN-TVGNFNRQCLSCDLVENCTYFSASFSHSMDFFLLKCEGPGVPMVTVHNTTDKKKMFD---LETNEHVKKAINDRQMP 592          
BLAST of Dipeptidyl peptidase 4 vs. UniProt/SwissProt
Match: sp|Q9Z218|DPP6_MOUSE (Dipeptidyl aminopeptidase-like protein 6 OS=Mus musculus OX=10090 GN=Dpp6 PE=1 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.677e-42
Identity = 164/570 (28.77%), Postives = 248/570 (43.51%), Query Frame = 1
Query:  202 TALLNQNVNDLKALPTEEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGP-VPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIP--EDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGT-EYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGDKT-IYFSAILANDSKELHLYKAN-ITTGNFVCVSCK-NPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAMP 1890
            TA  + NV        +E+V SNP  ++WKGI IA+LVIL+I  LI+ ++   +P    +    S   K T  D+F           +WI      Y   K    L N++T N T LI    ++   A      +S D   +   Y     Y+HS T  Y +  +   +      P V  A LQ A W P G  L F++ NN+YY  +    +  +  T    +   I  G++DWLYEEEIL+   A WWSP G  +A+ + ND +V   E+  Y     +        YPK               AGS    +NP +  ++  LN   +    +P   P   +YYI  VKW     + + W NR QN + L+L  +  TG   +     HE  +  W   L + N EP+     +K F +      G  ++ +I   +     S   I+  I + D+D T I+ +D  +  IYF +   +  +  HLY AN +   N  C+SC    NCTY +  F+    F +  C GP VPT  +   T+K  +     L  N ++++ I  + MP
Sbjct:    4 TAGASNNVRCPPGKGHKELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPA---EDTSLSQKKKVTVEDLFSEDFKIHDPEAKWISNKEFIYRERKGSVILRNVETNNSTVLIEGKKIESLRA--IRYEISPDKEYVLFSYNVEPVYQHSHTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTG---KEGVIYNGLSDWLYEEEILKSHIAHWWSPDGTRLAYATINDSRVPLMELPTY--TGSVYPTVKPYHYPK---------------AGS----ENPSISLHVIGLNGPTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLC-DATTGVCTKK----HEDESEAW---LHRQNEEPVFSKDGRKFFFVRAIPQGGRGKFYHITVSSSQPNSSNDNIQS-ITSGDWDVTKILSYDEKRNKIYFLST-EDLPRRRHLYSANTVDDFNRQCLSCDLVENCTYVSASFSHNMDFFLLKCEGPGVPTVTVHNTTDKRRMFD---LEANEEVQKAINDRQMP 531          
BLAST of Dipeptidyl peptidase 4 vs. UniProt/SwissProt
Match: sp|P46101|DPP6_RAT (Dipeptidyl aminopeptidase-like protein 6 OS=Rattus norvegicus OX=10116 GN=Dpp6 PE=1 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 8.427e-42
Identity = 158/556 (28.42%), Postives = 240/556 (43.17%), Query Frame = 1
Query:  250 EEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGP-VPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVR---YPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIP--EDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGT-EYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGDKTIYFSAILANDSKELHLYKAN-ITTGNFVCVSCK-NPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAMP 1890
            +E+V SNP  ++WKGI IA+LVIL+I  LI+ ++   +P    +    S   K T  D+F           +WI      Y   K    L N++T N T LI    ++   A      +S D       Y     Y+HS T  Y +  +   +      P V  A LQ A W P G  L F++ NN+YY  +    +  +  T    +   I  G++DWLYEEEIL+   A WWSP G  +A+ + ND +V   E+  Y         +  V+   YPK               AGS    +NP +  ++  LN   +    +P   P   +YYI  VKW     + + W NR QN + L+L  +  TG         HE  +  W   L + N EP+     +K F +      G  ++ +I   +     S   I+  I + D+D T+I+ +D  +   +     +  +  HLY AN +   N  C+SC    NCTY +  F+    F +  C GP VPT  +   T+K  +     L  N  +++ I  + MP
Sbjct:   75 DELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPA---EDTSLSQKKKVTVEDLFSEDFKIHDPEAKWISDKEFIYRERKGSVILRNVETNNSTVLIEGKKIESLRA--IRYEISPDKEYALFSYNVEPVYQHSHTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTG---KEGVIYNGLSDWLYEEEILKSHIAHWWSPDGTRLAYATINDSRVPLMELPTY-----TGSVYPTVKPYHYPK---------------AGS----ENPSISLHVIGLNGPTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLC-DATTG----VCTKKHEDESEAW---LHRQNEEPVFSKDGRKFFFVRAIPQGGRGKFYHITVSSSQPNSSNDNIQS-ITSGDWDVTEILTYDEKRNKLYFLSTEDLPRRRHLYSANTVDDFNRQCLSCDLVENCTYVSASFSHNMDFFLLKCEGPGVPTVTVHNTTDKRRMFD---LEANEQVQKAIYDRQMP 586          
BLAST of Dipeptidyl peptidase 4 vs. UniProt/SwissProt
Match: sp|P42659|DPP6_BOVIN (Dipeptidyl aminopeptidase-like protein 6 OS=Bos taurus OX=9913 GN=DPP6 PE=1 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.636e-40
Identity = 158/555 (28.47%), Postives = 242/555 (43.60%), Query Frame = 1
Query:  250 EEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGP-VPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIP--EDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGT-EYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGDKT-IYFSAILANDSKELHLYKANITTGNF--VCVSCK-NPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAMP 1890
            +E+V SNP  ++WKGI IA+LVIL+I  LI+ ++   +P    + N  S   K T  D+F           +WI      Y  +K    L N++T   T LI    ++   A      +S D       Y     Y+HS T  Y +  +   +      P V  A LQ A W P G  L F++ NN+YY  +     + I V S   +   I  G++DWLYEEEIL+   A WWSP G  +A+ + ND +V   E+  Y     +        YPK                      +NP +  ++  LN   +     P   P   +YYI  VKW     + + W +R QN + L+L  +  TG   +     HE  +  W   L + N EP+     +K F +      G  ++ +I   +     S   I+  I + D+D T I+ +D  ++ IYF +   +  +   LY A+ T G+F   C+SC    NCTY +  F+    F +  C GP VPT  +   T+K  +     L  N  +++ I+ + MP
Sbjct:   79 DELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPA---EDNSLSQKKKVTVEDLFSEDFKIHDPEAKWISDKEFIYREQKGSVILRNVETNTSTVLIEGKKIESLRA--IRYEISPDREYALFSYNVEPIYQHSYTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIFIFENNIYYCAHV--GKQAIRVVSTGKEG-VIYNGLSDWLYEEEILKTHIAHWWSPDGTRLAYATINDSRVPVMELPTY--TGSVYPTAKPYHYPKAG-------------------CENPSISLHVIGLNGPTHDLEMTPPDDPRMREYYITMVKWATSTKVAVNWLSRAQNVSILTLC-DATTGVCTKK----HEDESEAW---LHRQNEEPVFSKDGRKFFFVRAIPQGGQGKFYHITVSSSQPNSSNDNIQS-ITSGDWDVTKILSYDEKRSQIYFLST-EDLPRRRQLYSAS-TVGSFNRQCLSCDLVDNCTYFSASFSPGADFFLLKCEGPGVPTVSVHNTTDKKKMFD---LETNEHVQKAISDRQMP 590          
BLAST of Dipeptidyl peptidase 4 vs. TrEMBL
Match: G7YGX2 (Dipeptidyl peptidase 4 OS=Clonorchis sinensis OX=79923 GN=CLF_107591 PE=3 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 2.327e-81
Identity = 184/572 (32.17%), Postives = 289/572 (50.52%), Query Frame = 1
Query:  250 EEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVF-------DVKKKEVNVEIGPV----PQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQS---PQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPEDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKL-AIRKWIVTADFDFTDIVYFDGDKTIYFSAILANDSKELHLYKANITTGNFVCVSCKNPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLL----------TEKGILQQDRILINNTDLKQLIARKAMP 1890
            +E++A+ P  ++W+GI++A+LVI +IS +I+ A   T+P    D    +YG  +TF D          + Y+ I KD + Y++   +   LN  T  +  L+ +  L+EK       S+S D + + + Y      R +   +Y          DV   +  VEIGPV     Q  L  A WSP GH LAF ++ ++Y + N  D++  +    N+TQ      I YG+ADW+Y EEI+R + A+WW+PS   IAFL+F++  V N  I ++G     + H +  +YP+               AG+     NP V  +IY++ +K       P  +P D +  F +W + + L++ W++R Q +AW+++  +W       SWVIY     NGW++M KQ+N EP++  + + +FII  R  +   YR IA L +  +  +     KW++T DFD +DI+YF+GD    F      D K  HLY      G+  C++C NPNCTYN    ++ G   +  C GP  PT+ L  +          T    L Q   L++N DLKQL+  +AMP
Sbjct:    4 QELLANTPQKRNWRGILLALLVIAVISSIIVTASILTTPREPAD----NYGKPYTFSDFIHMNKWFELLSYK-IVKDGIVYLSHTGDLVYLNQTTMTQRTLLPRHSLNEKRLFNGLFSVSSDLSGVLLQYGDYQTSRINGPNKYDAVQVPGSTEDVYGSDKRVEIGPVKGALEQPYLPFAIWSPEGHHLAFSFDRHVYVHLNLFDDT--LSTILNITQGMPDEDIQYGMADWMYGEEIMRTNVAVWWNPSATRIAFLAFDERNVTNVPILLFGVDGGTHEHVLQHKYPQ---------------AGNPSPYGNPRVSLWIYDIETKERREFERPASVPWDGHFMFERWYNPETLIVCWSDRTQTQAWITVV-SWTRNS---SWVIYKTSANNGWVDMTKQANKEPLVHEKTQSLFIILPREYTEKAYRGIARLRVDLSGRETQQTMKWMITPDFDISDILYFNGDDEFVFLGT-GPDPKHSHLYWGK-AGGDISCLTCGNPNCTYNRAKVSRDGHCFVQECRGPDPPTYILYTINRTTDISGAVTSVEALYQS-TLMDNIDLKQLLWERAMP 546          
BLAST of Dipeptidyl peptidase 4 vs. TrEMBL
Match: A0A074ZWG5 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_05304 PE=3 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 9.991e-80
Identity = 187/596 (31.38%), Postives = 296/596 (49.66%), Query Frame = 1
Query:  175 MDMNEEKSGTALLNQNVNDLKALPTEEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVF-------DVKKKEVNVEIGPVPQAPLQN----AEWSPTGHTLAFVXXXXXXXXXXPLDN--SKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPEDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKL-AIRKWIVTADFDFTDIVYFDGDKTIYFSAILANDSKELHLYKANITTGNFVCVSCKNPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLL----------LLTEKGILQQDRILINNTDLKQLIARKAMP 1890
            ++ N   SG +L     +D       E++A+ P  ++W+GI++A+LVI +IS +I+ A   T+P    D    +YG  +TF D          + Y+ I KD + Y++   +   LN     +  L+ +  L+EK       S+S D + + + Y      R +   +Y          DV   +  VEIGPV +A  Q     A WSP GH LAF ++ ++Y + N  D+  S ++ +T  +     I YG+ADW+Y EEI+R + A+WW+PS   IAFL+F++  V N  I ++G     +   +  +YP+               AG+     NP V  +IY++ +        P  +P D +  F +W + D L++ W++R Q +AW+++  +W       SWVIY     NGW++M KQ+N EP++  + + +FII  R  +   YR IA L +  +  +     KWI+T DFD +DI+YF+GD    F      D K  HLY      G+  C++C NPNCTYN    ++ G + +  C GP  PT+ L            +T    L Q   L++N DLKQL+  +AMP
Sbjct:   32 IEANSIHSGNSLKPSETDD------PELLANTPQKRNWRGILLALLVIAVISSIIVTASILTTPREPAD----NYGKPYTFSDFIHMNKWFELLSYK-IVKDGIVYLSHNGDLVYLNQTAMTQRTLLPRHSLNEKRLFNGLFSVSSDLSGILLQYGDYQTSRINGPNKYDAVQVPGSTEDVYGSDKRVEIGPVKEALEQPYLPFAIWSPEGHHLAFSFDRHVYVHLNLFDDKLSTILNITQGMPDE-DIQYGMADWMYGEEIMRTNVAVWWNPSATRIAFLAFDERNVTNVPILLFGVDGGTHERVLQHKYPQ---------------AGNPSPYGNPRVSLWIYDIEAGERREFERPASVPWDGHFMFERWYNPDTLIVCWSDRTQTQAWITVV-SWTRNS---SWVIYKTSANNGWVDMTKQANKEPLVHEKTQSLFIILPREYTEKAYRGIARLRVDLSGRETQQTMKWIITPDFDISDILYFNGDDEFLFLGT-GPDPKHSHLYWGK-AGGDISCLTCANPNCTYNRAKVSRDGHWFVQECRGPDPPTYILYKINRTTDISGAVTSVEALYQS-TLMDNIDLKQLLWERAMP 593          
BLAST of Dipeptidyl peptidase 4 vs. TrEMBL
Match: A0A3R7G506 (Dipeptidyl aminopeptidase-like protein 6 OS=Clonorchis sinensis OX=79923 GN=DPP6 PE=3 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 1.942e-77
Identity = 188/593 (31.70%), Postives = 295/593 (49.75%), Query Frame = 1
Query:  226 NDLKALPTE--EIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGD---------IFRSRALHISMVYEWIGKDLLSYVNEKN--ERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVF-------DVKKKEVNVEIGPVP----QAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQS---PQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPEDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKL-AIRKWIVTADFDFTDIVYFDGDKTIYFSAILANDSKELHLYKANITTGNFVCVSCKNPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLL----------TEKGILQQDRILINNTDLKQLIARKAMP 1890
            N LK   T+  E++A+ P  ++W+GI++A+LVI +IS +I+ A   T+P    D    +YG  +TF D         +   + +   +VY     DL+ Y+N+    +R LL   + NE   ++     +K       S+S D + + + Y      R +   +Y          DV   +  VEIGPV     Q  L  A WSP GH LAF ++ ++Y + N  D++  +    N+TQ      I YG+ADW+Y EEI+R + A+WW+PS   IAFL+F++  V N  I ++G     + H +  +YP+               AG+     NP V  +IY++ ++       P  +P D +  F +W + D L++ W++R Q +AW+++  +W       SWVIY     NGW++M KQ+N EP++  + + +FII  R  +   YR IA L +  +  +     KW++T DFD +DI+YF+GD    F      D K  HLY      G+  C++C NPNCTYN    ++ G   +  C GP  PT+ L  +          T    L Q   L++N DLKQL+  +AMP
Sbjct:   41 NSLKPSETDDPELLANTPQKRNWRGILLALLVIAVISSIIVTASILTTPREPAD----NYGKPYTFSDFIHMNKWFELLSYKIVKDGIVYLSHTGDLV-YLNQTTMTQRTLLPRHSLNEWSTLFSNLFGQKRLFNGLFSVSSDLSGVLLQYGDYQTSRINGPNKYDAVQVPGSTEDVYGSDKRVEIGPVKGALEQPYLPFAIWSPEGHHLAFSFDRHVYVHLNLFDDT--LSTILNITQGMPDEDIQYGMADWMYGEEIMRTNVAVWWNPSATRIAFLAFDERNVTNVPILLFGVDGGTHEHVLQHKYPQ---------------AGNPSPYGNPRVSLWIYDIETRERREFERPASVPWDGHFMFERWYNPDTLIVCWSDRTQTQAWITVV-SWTRN---SSWVIYKTSANNGWVDMTKQANKEPLVHEKTQSLFIILPREYTEKAYRGIARLRVDLSGRETQQTMKWMITPDFDISDILYFNGDDEFVFLGT-GPDPKHSHLYWGK-AGGDISCLTCGNPNCTYNRAKVSRDGHCFVQECRGPDPPTYILYTINRTTDISGAVTSVEALYQS-TLMDNIDLKQLLWERAMP 604          
BLAST of Dipeptidyl peptidase 4 vs. TrEMBL
Match: A0A095BWJ2 (Dipeptidyl aminopeptidase-like protein 6 (Fragment) OS=Schistosoma haematobium OX=6185 GN=MS3_01574 PE=3 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 1.264e-75
Identity = 173/537 (32.22%), Postives = 276/537 (51.40%), Query Frame = 1
Query:  253 EIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDI---------FRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDV----------KKKEVNVEIGPVPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLD--NSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPEDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSK-LAIRKWIVTADFDFTDIVYFDGDKTIYFSAILANDSKELHLYKANITTGNFVCVSCKNPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYL 1797
            EI+ + P  ++WKGI++A+LVI+ IS LI+ A   T+P+      K  +G  FTF D+         F S++++ S VY   GKDL+          +L+  T  ET L+    + EK +      ++ D + + + Y      R S  ++Y V ++          ++ E+ V+     Q  L   +WSP  + +AFV   N++   NPLD  N K++ +T ++ QS  +SYGV+ WLYEEEIL  + ALWWS SG  +A  +F++  V  YEI  +G+  EL      ++Y                 AG      +PVV  Y+Y++ +  +  I IP+ IP D  +   +W++DD  +  W NR QN  W+++    L     +SWV Y     NGW+++LKQ+N EPI+    +++ II  R  S   YR IA+L +   PS+ L + KWI+T +FD  +I+Y+DG+  + F      DSK  H+Y  + + GN  C++C+N N TYN  +    G +++    G   P  +L
Sbjct:   72 EIMTNTPQKRNWKGILLALLVIMFISSLILTASVLTTPK----EKKIDHGLPFTFSDLILIDRLLESFNSQSVNGSFVYLTRGKDLI----------VLDTDTLKETLLLSHLVIQEKASFMDKYFVAPDLSGVILAYDFKDPTRRSGKSKYDVVNLNPVAKRTGLERRIEIGVDDQMTEQPFLDFVKWSPKSNCIAFVTQKNIHLLFNPLDSNNRKVVNLTQSMPQS-HMSYGVSTWLYEEEILHTNEALWWSDSGNYLAVAAFDETNVSTYEILKFGDDYELKNRNRKMKYSM---------------AGETSLYNSPVVTLYLYDMKTMNFQIIPIPKQIPSDGLLTMARWMNDDIFVHAWTNRIQNRGWITVFSQSLN----QSWVFYKIGYENGWVDLLKQTNVEPIINKENQEMLIILPRDYSEKGYRGIAKLKIPMLPSETLQLPKWIITPNFDVKEILYYDGNDEVIFIGT-GPDSKNAHVYWTSQSIGNMTCLTCENVNNTYNWAEVLSNGKYLVQDVRGSGNPKTFL 573          
BLAST of Dipeptidyl peptidase 4 vs. TrEMBL
Match: A0A4E0RJE5 (Subfamily S9B unassigned peptidase (S09 family) OS=Fasciola hepatica OX=6192 GN=D915_001479 PE=3 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 7.122e-73
Identity = 187/580 (32.24%), Postives = 311/580 (53.62%), Query Frame = 1
Query:  238 ALPTE----EIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFR-SRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQ-------YTVFDVKKKEVNVEIGPVP----QAPLQNAEWSPTGHTLAFVXXXXXXXXXXPL--DNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPEDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKLAIR---KWIVTADFDFTDIVYFDGDKTIYFSAILANDSKELHLYKANITTGNFV-CVSCKNPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLT----EKGILQQD----RILINNTDLKQLIARKAM 1887
            A P+E    E++A+NP  ++W+GI++A++VI +IS +II A   T+P      ++ +YG  +TF D+ +  RA+ + +VY+ I  + + YV+   +   ++L T +E  L+ +  + EK        +S D + + + Y  ++  R+S  ++       ++  +V   E  +E+GP P    Q  L   +WSP  + L+F YN ++Y +++P   + S+++ VT  +     I YG  DWLYEEE+L+   ALWW+P+   +AF SFN + V +Y +  Y   ++L G+   ++YPK               AG V    NP ++ ++Y+L +        P  IP D  + F +W D+D +L+ W NR Q EAW++ A +W   K   SW+I++    NGW+ MLK++++EPI+    K +FII  R  S   +R IA L +  T   +  R   KW++T +FD TDI++FDGD    F      D+K  H++    T+ N V C++C NPNCTYN    +  G + +  C GP VPT+ L+ +     E G L       RIL +N + K ++  +A+
Sbjct:   44 AKPSELDEPELLANNPQKRNWRGILLALIVIAVISSIIITASILTTPR----EHEINYGKTYTFTDMVQFPRAMKM-LVYQ-IKSNHVVYVSPDYDVVAIDLTTLDERMLVSRHDIIEKPEYMGIFIVSPDLSAIVLEYDAASENRNSRLSKIDALLLPHSSSNVTTIEKRIEVGPFPDALEQPHLPFVQWSPQKNFLSFTYNGHIYVHKHPFVSELSEIVNVTKGMPDV-DIIYGETDWLYEEELLQTKAALWWNPTATRLAFASFNQKNVSSYYMSRYDGPNDLYGYVQRIKYPK---------------AGDVSDYTNPQIEFFVYDLETGERREFKRPAKIPWDGLLVFTRWYDEDVILVAWTNRIQTEAWIT-AVSWSRNK---SWIIFNTAIQNGWVEMLKETSTEPIVHEPTKSLFIILPRDYSPKAFRGIARLKVDLT--GIETRQPVKWVITPEFDITDILHFDGDSHFLFLGT-GPDAKNSHVFFG--TSDNVVTCLTCGNPNCTYNRAKVSSCGRYFVQECRGPDVPTYILMWINQTRRESGELSVGAVPVRILQDNREFKSVLRGRAL 592          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Cavefish
Match: DPP10 (dipeptidyl peptidase like 10 [Source:NCBI gene;Acc:103044892])

HSP 1 Score: 162.155 bits (409), Expect = 1.591e-41
Identity = 160/564 (28.37%), Postives = 256/564 (45.39%), Query Frame = 1
Query:  250 EEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNAS-----PTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGP--VPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAK--NPVVKPYIYNLNSKRY-YAISIPEGIP-EDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSG--TEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGD-KTIYFSAILANDSKELHLYKANITTGNF--VCVSCK--NPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAM 1887
            E++   +P  ++WKGI IA+LVIL++  LI +++   +P      + T    +  FG  F            WI +  + Y N        N+ T NET+++ K      N++      T  S+S D   +   Y     YRHS TA Y ++++  +EV  E+ P  V  + LQ+A W   G  L +++ NN+YY  +   NS  + +TS+  +   +  G+ADWLYEEEIL    A WWSP G+ +AFL  ND  V N  +            F    YPK                   PKA   NP VK ++ NL    +   ++ P+G+   ++Y+  VKWI      + W NR QN + L++  +  TG    + +  HE+T+  W   L + N EP  F +    F +   +  G   ++ +IA         +  +R  + + +++ T+IV +D + +TIYF +   +  +   L+  + T G F   C++C     +CT+ + DF+     VI  C GP  P   L  L          IL NN  LK  +  K +
Sbjct:   18 EDLGGVSPPQRNWKGIAIALLVILLVCSLITMSVILLTPADTQAGSDTKLKVEDLFGPDFHVHDPEA----RWINESEVIYRNRNGHVIRFNILT-NETEIVLK------NSTFVAFKATKYSISPDMKYVLFAYDVKQVYRHSFTASYIIYNIHTREV-WELDPPEVLNSRLQHAAWGVQGQQLVYIFENNIYYQSDVRSNS--LRLTSSGKEG-VVYNGIADWLYEEEILHTHVAHWWSPDGERLAFLVLNDSLVPNMVLPT----------FTGATYPKGK-------------QYPYPKAGQPNPRVKLFVVNLYGPTHTLELTPPDGLKLREHYVVMVKWISKTKTAVRWLNRAQNISILTVCDS-TTG----ACIKRHEETSELW---LSKQNQEP-FFSQDGSRFFLAVPVKQGGRGDFHHIAMFTTQIRADQNEVRH-LTSGNWEVTEIVAYDENTQTIYFLSTEGSPRRR-QLFSVS-TVGLFPRRCLTCDLNKVHCTFFSADFSPTHQHVILDCKGPGAPAVILHTLNTANYF----ILENNPLLKAALVYKRI 527          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Cavefish
Match: DPP10 (dipeptidyl peptidase like 10 [Source:NCBI gene;Acc:103044892])

HSP 1 Score: 160.614 bits (405), Expect = 5.271e-41
Identity = 159/561 (28.34%), Postives = 256/561 (45.63%), Query Frame = 1
Query:  250 EEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWK--PYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGP--VPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAK--NPVVKPYIYNLNSKRY-YAISIPEGIP-EDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSG--TEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGD-KTIYFSAILANDSKELHLYKANITTGNF--VCVSCK--NPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAM 1887
            +++   +P  ++WKGI IA+LVIL++  LI +++   +P      + T    +  FG  F            WI +  + Y N        N+ T NET+++ K   ++  K    T  S+S D   +   Y     YRHS TA Y ++++  +EV  E+ P  V  + LQ+A W   G  L +++ NN+YY  +   NS  + +TS+  +   +  G+ADWLYEEEIL    A WWSP G+ +AFL  ND  V N  +            F    YPK                   PKA   NP VK ++ NL    +   ++ P+G+   ++Y+  VKWI      + W NR QN + L++  +  TG    + +  HE+T+  W   L + N EP  F +    F +   +  G   ++ +IA         +  +R  + + +++ T+IV +D + +TIYF +   +  +   L+  + T G F   C++C     +CT+ + DF+     VI  C GP  P   L  L          IL NN  LK  +  K +
Sbjct:   19 KDLGGVSPPQRNWKGIAIALLVILLVCSLITMSVILLTPADTQAGSDTKLKVEDLFGPDFHVHDPEA----RWINESEVIYRNRNGHVIRFNILT-NETEIVLKNSTFVAFK---ATKYSISPDMKYVLFAYDVKQVYRHSFTASYIIYNIHTREV-WELDPPEVLNSRLQHAAWGVQGQQLVYIFENNIYYQSDVRSNS--LRLTSSGKEG-VVYNGIADWLYEEEILHTHVAHWWSPDGERLAFLVLNDSLVPNMVLPT----------FTGATYPKGK-------------QYPYPKAGQPNPRVKLFVVNLYGPTHTLELTPPDGLKLREHYVVMVKWISKTKTAVRWLNRAQNISILTVCDS-TTG----ACIKRHEETSELW---LSKQNQEP-FFSQDGSRFFLAVPVKQGGRGDFHHIAMFTTQIRADQNEVRH-LTSGNWEVTEIVAYDENTQTIYFLSTEGSPRRR-QLFSVS-TVGLFPRRCLTCDLNKVHCTFFSADFSPTHQHVILDCKGPGAPAVILHTLNTANYF----ILENNPLLKAALVYKRI 528          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Cavefish
Match: DPP10 (dipeptidyl peptidase like 10 [Source:NCBI gene;Acc:103044892])

HSP 1 Score: 143.28 bits (360), Expect = 3.497e-35
Identity = 145/520 (27.88%), Postives = 233/520 (44.81%), Query Frame = 1
Query:  268 NPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWK--PYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGP--VPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAK--NPVVKPYIYNLNSKRY-YAISIPEGIP-EDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSG--TEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGD-KTIYFSAILANDSKELHLYKANITTGNF--VCVSCK--NPNCTYNTFDFNKKGGFVIHSCLGPSV 1782
            +P  ++WKGI IA+LVIL++  LI +++   +P      + T    +  FG  F            WI +  + Y N        N+ T NET+++ K   ++  K    T  S+S D   +   Y     YRHS TA Y ++++  +EV  E+ P  V  + LQ+A W   G  L +++ NN+YY  +   NS  + +TS+  +   +  G+ADWLYEEEIL    A WWSP G+ +AFL  ND  V N  +            F    YPK                   PKA   NP VK ++ NL    +   ++ P+G+   ++Y+  VKWI      + W NR QN + L++                 + TT   I      N EP  F +    F +   +  G   ++ +IA         +  +R  + + +++ T+IV +D + +TIYF +   +  +   L+  + T G F   C++C     +CT+ + DF+     VI  C G +V
Sbjct:   24 SPPQRNWKGIAIALLVILLVCSLITMSVILLTPADTQAGSDTKLKVEDLFGPDFHVHDPEA----RWINESEVIYRNRNGHVIRFNILT-NETEIVLKNSTFVAFK---ATKYSISPDMKYVLFAYDVKQVYRHSFTASYIIYNIHTREV-WELDPPEVLNSRLQHAAWGVQGQQLVYIFENNIYYQSDVRSNS--LRLTSSGKEG-VVYNGIADWLYEEEILHTHVAHWWSPDGERLAFLVLNDSLVPNMVLPT----------FTGATYPKGK-------------QYPYPKAGQPNPRVKLFVVNLYGPTHTLELTPPDGLKLREHYVVMVKWISKTKTAVRWLNRAQNISILTVC----------------DSTTGACIK-----NQEP-FFSQDGSRFFLAVPVKQGGRGDFHHIAMFTTQIRADQNEVRH-LTSGNWEVTEIVAYDENTQTIYFLSTEGSPRRR-QLFSVS-TVGLFPRRCLTCDLNKVHCTFFSADFSPTHQHVILDCKGITV 483          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Cavefish
Match: dpp6a (dipeptidyl-peptidase 6a [Source:ZFIN;Acc:ZDB-GENE-090918-4])

HSP 1 Score: 141.739 bits (356), Expect = 9.707e-35
Identity = 146/522 (27.97%), Postives = 225/522 (43.10%), Query Frame = 1
Query:  268 NPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWI-GKDLLSYVNEKNERKLLNLQTKNETDLI---------WKPYLDEKNA--SPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGPVPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPED-----YYICFVKWIDDDHLLIGWANREQNEAWLSLAQ---NWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGDKTIYFSAILANDSKELHLYKANITTGNF--VCVSCKNPNCTYNTFDFNKKGGFVIHSC 1767
            NP  ++WKGI IA+LVIL+I  LI+ ++   +P    + N  +   K T  DIF+          +WI GK+LL    E N  K  N++T + T L+         +  Y+  KN    P S  L R   L F                +    + ++   +    V  A LQ A W P G  L F++ NN+YY    ++N  +  V++   +   I  G++DWLYEEEI +   A WWSP G  +A+ + ND  V   E+ ++       G      YPK               AG     +NPV+  Y+ NLN   +   +I    PED     YY+  VKW     L + W NR QN + L+L Q      T +  E W    E+T     + LK   + PI    + K F I   I+               T S + +   I + D+D T+++ ++ ++ + +     +  K  HLY A  T G+F   C+SC +  C Y +  F+    + + +C
Sbjct:   32 NPPQRNWKGIAIALLVILVICSLIVTSVILLTP---GEDNSLALKGKVTVEDIFKKDFRVHDPDAKWISGKELLYRTREGNVVKF-NVETNDTTVLVPNKTFVSLSFSIYIISKNVLQQPNSVELHRFLCLSF-------KPELCGKLSFCCCVLCRETWILNPPEVRNARLQFAGWGPQGQQLIFIFENNIYYRAT-VENRSIRLVSTG--KEGVIFNGLSDWLYEEEIFQSHIAHWWSPDGARLAYATINDTLVPRMELPIFTGSPYPTGR--EYHYPK---------------AGE----ENPVISLYVVNLNGPLH---TIEMKRPEDQRIGEYYVTMVKWATSTKLAVNWLNRAQNISILTLCQATTGVCTKRTEERWA-RREETPLFSRDGLKMFFTRPIPQGGRGKFFHISMSISQPN------------TSSDMLLS--ITSGDWDVTEVLAYNEEEQLIYFLSTEDGPKRRHLYSAG-TVGSFNRRCLSCNSDGCGYVSSSFSHDMAYFLLNC 499          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Cavefish
Match: ENSAMXT00000056368.1 (inactive dipeptidyl peptidase 10-like [Source:NCBI gene;Acc:103022732])

HSP 1 Score: 139.813 bits (351), Expect = 3.945e-34
Identity = 149/584 (25.51%), Postives = 266/584 (45.55%), Query Frame = 1
Query:  193 KSGTALLNQNVNDL------KALPTEEIV--ASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGP--VPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPE--DYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTE--YRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGD-KTIYFSAILANDSKELHLYK-ANITTGNFVCVSC--KNPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAMP 1890
            K G  LL +    L      + L TE +   A    +++WKGI I++LVI  +  +I L+I+  S     D    + GS  T  D+F       +   +W+    + Y +        +L T N+T+L+ K          +  ++S D   + + Y     Y +S  A Y ++++  +EV+ E+ P  V  + LQ A W   G  L +++ NN+YY   P   S  + +TS+  +   +  GV DWLYEEE+L    A WWSP G ++AFL+ ND  V N  +  +     L    I+  YPKV  +                   NP VK  + +L+   +    +P    E  +YYI  ++W+ +D + + W NR QN + L+L     TG+     +  H  T++ WI+   + N EP+ F +    F +   I  G+   + +I  ++   T +++ IR  + +  ++ T I+ +D    T+Y+ +     S   HLY+ + +   +  C++C    P+C++     +     V+  C GP VP   + LL+    + +   L +  + ++ + ++ +P
Sbjct:    5 KPGCLLLREAKEKLLHFLHTEHLATETVCDFADVGPDRNWKGIGISLLVIAAVLSVIGLSIFLLSK----DDGSKALGSHLTVDDLFLKEFQVHTPEAQWVSAVEIIYKSRDGNVMKADLHT-NQTELLMKN-TTFATFKASKFAVSPDLNYVLLTYDIKKVYHYSFLASYVIYNLHTREVH-ELNPPEVSDSVLQFASWGVQGQQLIYIFENNIYYQ--PEVKSSSLRLTSS-GRDGLVFNGVPDWLYEEEVLHSPVAHWWSPKGSSLAFLTINDTLVPNMLLPRF--TGTLYPRGIHYPYPKVGQV-------------------NPTVKLSVVSLDGSSHTKELLPPSSLEKSEYYISMIRWVTEDCVAVRWLNRAQNTSILTLCYIH-TGE----CIRKHVMTSDKWID---RQNEEPV-FSQDGTTFFMTLPIKHGSHGSFHHITMMSEQGTGAEVNIRH-LTSGSWEVTKILAYDESLNTVYYLSTEGGISYR-HLYRVSTVDPFHRECLTCFLFKPHCSFYDASLSPDSQTVLLHCAGPGVPKTTVHLLSN---ITRHMTLDSGLEFRESLRQRRLP 543          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Sea Lamprey
Match: DPP10 (dipeptidyl peptidase like 10 [Source:HGNC Symbol;Acc:HGNC:20823])

HSP 1 Score: 137.887 bits (346), Expect = 3.446e-34
Identity = 144/568 (25.35%), Postives = 256/568 (45.07%), Query Frame = 1
Query:  220 NVNDLKALPTEEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGPV--PQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKA--KNPVVKPYIYNLNSKRYYAISI--PEGIPE-DYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFI-IENRITSGTEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGDKTIYFSAILANDSKELHLYKANITTGNF--VCVSCKN-PNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAMP 1890
             V DL A   +E+ ++  +N++WKG+ IA+LVI+ +  LI+ +I   +P      N+     +  F D F+ +   +    +WI    + Y   +     ++++      L+   +L + N   +  ++S D + + + Y     YR S TA +TV+ ++ +E + ++ P    +  LQ A W    H + +VYNN+LY    P   S  I +TS   +   +  G++DWLYEEE+L  S A W SP G  +AF S ND  V   EI  Y        +  + +YP                    PKA   NP V+ ++ +LNS       +  PE + + ++YI  V W+ +  L + W +R QN + L+   N  +G   E     H++++  W   L      P+  P  K+ F+ +  +      + ++   +L          ++I + D++ T ++     +   +     +     HLY    T G+F   C+SC   PNC+++   F+    + +  C GP+VP   +      G      IL NNT+L+ ++A++  P
Sbjct:    4 RVCDLCAC-MQELSSNESNNRNWKGMAIALLVIVFVCSLIVASIVLLTPAENASLNQAKISLEDLFSDDFQLQEPDV----KWISASEVIYRTMEGHLVKMDVKENESVTLLENNFL-KMNLLNSKFAMSPDRSFILLAYDIRQVYRFSYTALFTVYSLQTREFH-DVLPAGEERERLQLAGWCSHAHQMVYVYNNDLYLK--PDLQSAPIQITST-GKVGSVYNGISDWLYEEEVLHSSVAHWCSPDGSRLAFASINDSNVPLAEIPQYTGAV----YPTSRKYP-------------------YPKAGQNNPRVRLFLADLNSPSPATTELFPPETLKQREFYIPMVAWVMNS-LAVNWLSRAQNFSILTFC-NASSGVCSER----HKESSEAW---LSGQTEAPLFSPDGKRFFLPLAAKQGGRGSFHHLGMFSLQERRGHDV--RFITSGDWEVTALLAHHPTQRKLYYLSTEDGPTNRHLYSVE-TGGSFERQCLSCGVIPNCSFHHVSFSPSTRYFLLFCDGPTVPMVTVHSTDNPGSFH---ILENNTELRGMLAQRQTP 523          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Sea Lamprey
Match: DPP10 (dipeptidyl peptidase like 10 [Source:HGNC Symbol;Acc:HGNC:20823])

HSP 1 Score: 110.153 bits (274), Expect = 1.472e-25
Identity = 92/342 (26.90%), Postives = 150/342 (43.86%), Query Frame = 1
Query:  889 GVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAK--NPVVKPYIYNLNSKRY-YAISIPEGI-PEDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFI-IENRITSGTEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGDKTIYFSAILANDSKELHLYKANITTGNF--VCVSCKN-PNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAMP 1890
            G+ADWLYEEEIL      WWSP G  +A+++ N+  V + +I ++             RYP                    PKA   NP V+ ++  L    +   ++ PE     DYY+  V W     + + W NR QN + L++  +  TG   E     H + +  W   L + +  P+      K F+ +  +  +  ++ +IA   L     ++A  K+I + +++ T I+ +D  +   +     +  K   LY A  TTG F   C+SC   P C Y    F+      +  CLGPSVP   +  +++   +     L NNT L++ +A K MP
Sbjct:   33 GIADWLYEEEILHSHKTHWWSPDGTRLAYITINETTVPSMDIPLFTAALYPGSR----RYP-------------------YPKAGQPNPRVRLFVVTLYGLTHTQELNPPEAFRSRDYYVSMVHWATGTRIAVNWVNRAQNFSILTVC-DAATGACIER----HREMSEAW---LPRQDEAPVFSRDGSKFFLPVPAKQGARGDFHHIAMFALQTGIERIAT-KFITSGNWEVTKILAYDERQQKVYFLSTEDSPKRRQLYSAE-TTGTFNRQCLSCDLIPGCMYYRTIFSPGSSHFVLHCLGPSVPKITVHTMSD---INNYMTLENNTLLREAVATKLMP 338          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002387.1 (pep scaffold:Pmarinus_7.0:GL477790:26893:33618:1 gene:ENSPMAG00000002164.1 transcript:ENSPMAT00000002387.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 8.111e-8
Identity = 56/228 (24.56%), Postives = 93/228 (40.79%), Query Frame = 1
Query:  643 HSANYRHSSTAQYTVFDVKKKEVNVEIGPVPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSK--RYYAISIPEGIPEDYYICFVKWIDDDHLLIGWANREQNEAWLSLA 1320
            +S  +R+S  A Y ++D+  K   VE  P+P   +Q   WSP+ H LA+V          P      + VT++   S Q+  G+ DW+YE E         W          S+   K+ +   ++       + +  +       + ++         AG    A NP VK ++ N+     +    ++PE    D Y+  V W   D L + W +R QN + LSL 
Sbjct:   32 YSKLWRYSYYASYHIYDLANKRF-VEDSPLPHE-IQYITWSPSDHNLAYV--YENNIYLKPNLTGPAVNVTTSGAYS-QVYNGIPDWVYEGEAAHPRCRRQWR--------RSYLAPKISDLGTQLVWHGPSGDSYLRDPTEAAACWCLQ---------AG----APNPKVKLFVVNVADPDTKTQITAVPEIADRDNYLGMVTWATSDRLCVQWLSRHQNYSVLSLC 233          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Yeast
Match: STE13 (Dipeptidyl aminopeptidase; Golgi integral membrane protein that cleaves on the carboxyl side of repeating -X-Ala- sequences, required for maturation of alpha factor, transcription is induced by a-factor [Source:SGD;Acc:S000005745])

HSP 1 Score: 65.4698 bits (158), Expect = 1.617e-11
Identity = 97/412 (23.54%), Postives = 159/412 (38.59%), Query Frame = 1
Query:  649 ANYRHSSTAQYTVFDV-----------KKKEVNVEIGPVPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQ------SPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPEDYYICFVKWIDDDHLLIGWANREQN----EAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKI---FIIENRITSGTEYRNIAELNLSYTPSKLAIRKWIVTAD----FDF-TDIVYFDGDKTIYFSAILANDSKELHLYKANIT--TGNFVCVSCKNPNCTYNTFDF--NKKGGFVIHSCLGPSVP 1785
            + +RHSS   Y + D+           +K + N E+G    + L  A +SP  + + FVY           +N  L  V S + +      S  I     DW+YEEE+L    A+WW+P      F  FND  V +  +  Y   +E       ++YPK                   P  +NP    ++ NL +   Y+I+   G  +D  +   KWI  D       +R       + +   +   LT ++  S +       NGWI   K   S P   P  K++   +I  +  + G  +        +  P +L    W VT +    +++ TD ++F  ++    S          HLY  ++T  T      S +NP+  Y+ +DF  +    + I   LGP  P
Sbjct:  261 SEFRHSSKGFYWIKDLNTGNIEPILPPEKSDDNYELG---LSKLSYAHFSPAYNYIYFVYE----------NNLFLQQVNSGVAKKVTEDGSKDIFNAKPDWIYEEEVLASDQAIWWAPDDSKAVFARFNDTSVDDIRLNRYTNMNEAYLSDTKIKYPK-------------------PGFQNPQFDLFLVNLQNGIIYSINT--GGQKDSILYNGKWISPDTFRFEITDRNSKILDVKVYDIPSSQMLTVRNTNSNLF------NGWIEKTKDILSIPPK-PELKRMDYGYIDIHADSRGFSHLFYYPTVFAKEPIQLTKGNWEVTGNGIVGYEYETDTIFFTANEIGVMSQ---------HLYSISLTDSTTQNTFQSLQNPSDKYDFYDFELSSSARYAISKKLGPDTP 622          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Yeast
Match: DAP2 (Dipeptidyl aminopeptidase; synthesized as a glycosylated precursor; localizes to the vacuolar membrane; similar to Ste13p [Source:SGD;Acc:S000001070])

HSP 1 Score: 61.2326 bits (147), Expect = 3.150e-10
Identity = 50/167 (29.94%), Postives = 83/167 (49.70%), Query Frame = 1
Query:  577 KNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGPVPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVY-GEQDELNGHFINVRYPK 1074
            +N +  S + S D   + I      N+RHS+   Y V+D K      EIG      +  A WSP  + +A+V +NN+Y     +    +  VT++   S  +  G  DW+YEEE+     A WWSP+G  +AFL  ++ +V  + I  Y  ++ ++     +++YPK
Sbjct:  138 QNLTVESITASPDLKRLLIRTNSVQNWRHSTFGSYFVYD-KSSSSFEEIG----NEVALAIWSPNSNDIAYVQDNNIYIYS-AISKKTIRAVTND--GSSFLFNGKPDWVYEEEVFEDDKAAWWSPTGDYLAFLKIDESEVGEFIIPYYVQDEKDIYPEMRSIKYPK 296          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Nematostella
Match: EDO48902 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHS0])

HSP 1 Score: 103.605 bits (257), Expect = 8.588e-23
Identity = 114/510 (22.35%), Postives = 211/510 (41.37%), Query Frame = 1
Query:  403 SKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKK--EVNVEIGPVPQAPLQNAEWSPTGHTLAFVXXXXXX---XXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNS------KRYYAISIPEGIPE-DYYICFVKWIDDDHLLIGWANREQNEAWLSL------AQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKLAIR----KWIVTADFDFTDIVYFDGDKTIYFSAILANDSKELHLYKANITTGNFVCVSCKNPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQ 1866
             KFT  D+F  +        +W+  D                 +  +T+++    L+         +LS D T++F     +  YR+SS A Y V+D+ K   E  V  G V    +Q+  W+P  + L +V  N+++       PL  +  +   +N     +I  GV DW+Y+EE+L    A+++SP  + +A++ FND +V++Y    YG    +      + YPK                   P   NP V+  + +L             + +P G  + ++Y+  V W   +   + W NR QN +   +        N + G        + E+   GW++      + P +F + +  ++I      G    N A ++L+    +L ++    + + +  ++ T I+ FD +  I +         + H+Y   + +     ++ K+  C Y   DF+K  G+ + +C GP VP +  L  ++ G     R L NN  LK+
Sbjct:  311 GKFTLDDVFSGKYQPKFPSVKWLSDDTYRSFGPGGSIITTEAFSGAQTEVVSAKSLEALGGE--GYTLSPDKTMLFFAKNKTMEYRYSSFADYFVYDIAKNKYEKIVTSGGVQ---IQHVRWAPDRNALVYVVENDMHYIDDVRLPLPEAHRL---TNDGDRLRIFNGVPDWVYQEEVLNTDYAMYFSPDSKYLAYMQFNDTRVKDYVYPWYGSAKNIYPSQRKIAYPK-------------------PGTPNPTVRVKVIDLTRITKGLLPPAAELPVPAGFDKIEHYVVNVGWSTTNKFTVQWLNRFQNHSQTDICSVDAGGMNCIKG--------HEEQVKGGWVD---DKYTTP-LFTKDESAYVILYPFMQG---ENGAFIHLALV--QLGLKDHSIRALTSGAWEVTKILGFDKENGIVYFESTETGPTQRHIYSFELASNTKKSLT-KDLACNYFKADFSKDAGWCVLTCQGPDVP-WTNLRNSKTGAA---RALENNDKLKK 771          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Medaka
Match: dpp6a (dipeptidyl aminopeptidase-like protein 6 [Source:NCBI gene;Acc:101155808])

HSP 1 Score: 168.703 bits (426), Expect = 1.087e-43
Identity = 145/520 (27.88%), Postives = 234/520 (45.00%), Query Frame = 1
Query:  253 EIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEV-NVEIGPVPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPED-----YYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGDKTIYFSAILANDSKELHLYKANITTGNF--VCVSCKNPN-CTYNTFDFNKKGGFVIHSCLGPSVP 1785
            E+V SNP  ++WKGI IA+LVIL+I  LI+ ++   +P    + ++ +  SK T GD+FR          +WI  + L Y N   +   L++ +  +T L+     +   AS     +S D   + + Y  +  Y+HS TA Y +  ++  E  N+    V  A LQ A W P    L F++ NN+YY    + +  +  V+S   +   I  G++DWLYEEEI     A WWSP G  +A+ + ND  V   E+ ++       G      YPK                      +NPV+  ++ NLN   +   +I    P+D     +Y+  VKW     L I W NR QN + L+L +   TG   +     HE  + GW   L + + EP+      K+F        G        ++ S   +     + I + D+D T ++ ++ D  + +     +  K  HLY A+ T G+F   C++C  P+ C Y +  F+    + +  C GP +P
Sbjct:   18 ELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTP---GEDDRLALKSKVTVGDLFRKEFRVHDPDAKWISNNELLYRNRDGDVVRLSVDSNEQTILVHNKKFEMYKAS--KYEVSPDLKYVLLAYNAAPVYQHSYTAFYIICSLETPETWNLNPPEVRNAQLQFAGWGPKDQQLIFIFENNIYYRSE-VKSRSIRLVSSG--KEGVIFNGLSDWLYEEEIFHSHVAHWWSPDGARLAYATINDTLVPKMELPMFTGSPYPTGK--EYHYPKAG-------------------EENPVISLHVVNLNGPLH---TIEMRRPDDPRIGEFYVTMVKWATTTKLAINWLNRAQNISILTLCEA-TTGVCTKK----HEDESEGW---LHRQDEEPLFSKDGLKLFFTRAIPQGGRGKFFHISMSTSQPNTSTDTLQSITSGDWDVTQVLAYNEDNQLIYFLSTEDGPKRRHLYSAD-TFGSFNRRCLTCGLPDSCGYISGSFSYNMSYFLLRCRGPDIP 496          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Medaka
Match: dpp6a (dipeptidyl aminopeptidase-like protein 6 [Source:NCBI gene;Acc:101155808])

HSP 1 Score: 168.703 bits (426), Expect = 1.227e-43
Identity = 145/520 (27.88%), Postives = 234/520 (45.00%), Query Frame = 1
Query:  253 EIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEV-NVEIGPVPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPED-----YYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGDKTIYFSAILANDSKELHLYKANITTGNF--VCVSCKNPN-CTYNTFDFNKKGGFVIHSCLGPSVP 1785
            E+V SNP  ++WKGI IA+LVIL+I  LI+ ++   +P    + ++ +  SK T GD+FR          +WI  + L Y N   +   L++ +  +T L+     +   AS     +S D   + + Y  +  Y+HS TA Y +  ++  E  N+    V  A LQ A W P    L F++ NN+YY    + +  +  V+S   +   I  G++DWLYEEEI     A WWSP G  +A+ + ND  V   E+ ++       G      YPK                      +NPV+  ++ NLN   +   +I    P+D     +Y+  VKW     L I W NR QN + L+L +   TG   +     HE  + GW   L + + EP+      K+F        G        ++ S   +     + I + D+D T ++ ++ D  + +     +  K  HLY A+ T G+F   C++C  P+ C Y +  F+    + +  C GP +P
Sbjct:   18 ELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTP---GEDDRLALKSKVTVGDLFRKEFRVHDPDAKWISNNELLYRNRDGDVVRLSVDSNEQTILVHNKKFEMYKAS--KYEVSPDLKYVLLAYNAAPVYQHSYTAFYIICSLETPETWNLNPPEVRNAQLQFAGWGPKDQQLIFIFENNIYYRSE-VKSRSIRLVSSG--KEGVIFNGLSDWLYEEEIFHSHVAHWWSPDGARLAYATINDTLVPKMELPMFTGSPYPTGK--EYHYPKAG-------------------EENPVISLHVVNLNGPLH---TIEMRRPDDPRIGEFYVTMVKWATTTKLAINWLNRAQNISILTLCEA-TTGVCTKK----HEDESEGW---LHRQDEEPLFSKDGLKLFFTRAIPQGGRGKFFHISMSTSQPNTSTDTLQSITSGDWDVTQVLAYNEDNQLIYFLSTEDGPKRRHLYSAD-TFGSFNRRCLTCGLPDSCGYISGSFSYNMSYFLLRCRGPDIP 496          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Medaka
Match: dpp6a (dipeptidyl aminopeptidase-like protein 6 [Source:NCBI gene;Acc:101155808])

HSP 1 Score: 168.703 bits (426), Expect = 1.420e-43
Identity = 145/521 (27.83%), Postives = 234/521 (44.91%), Query Frame = 1
Query:  250 EEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEV-NVEIGPVPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPED-----YYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGDKTIYFSAILANDSKELHLYKANITTGNF--VCVSCKNPN-CTYNTFDFNKKGGFVIHSCLGPSVP 1785
             E+V SNP  ++WKGI IA+LVIL+I  LI+ ++   +P    + ++ +  SK T GD+FR          +WI  + L Y N   +   L++ +  +T L+     +   AS     +S D   + + Y  +  Y+HS TA Y +  ++  E  N+    V  A LQ A W P    L F++ NN+YY    + +  +  V+S   +   I  G++DWLYEEEI     A WWSP G  +A+ + ND  V   E+ ++       G      YPK                      +NPV+  ++ NLN   +   +I    P+D     +Y+  VKW     L I W NR QN + L+L +   TG   +     HE  + GW   L + + EP+      K+F        G        ++ S   +     + I + D+D T ++ ++ D  + +     +  K  HLY A+ T G+F   C++C  P+ C Y +  F+    + +  C GP +P
Sbjct:   28 RELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTP---GEDDRLALKSKVTVGDLFRKEFRVHDPDAKWISNNELLYRNRDGDVVRLSVDSNEQTILVHNKKFEMYKAS--KYEVSPDLKYVLLAYNAAPVYQHSYTAFYIICSLETPETWNLNPPEVRNAQLQFAGWGPKDQQLIFIFENNIYYRSE-VKSRSIRLVSSG--KEGVIFNGLSDWLYEEEIFHSHVAHWWSPDGARLAYATINDTLVPKMELPMFTGSPYPTGK--EYHYPKAG-------------------EENPVISLHVVNLNGPLH---TIEMRRPDDPRIGEFYVTMVKWATTTKLAINWLNRAQNISILTLCEA-TTGVCTKK----HEDESEGW---LHRQDEEPLFSKDGLKLFFTRAIPQGGRGKFFHISMSTSQPNTSTDTLQSITSGDWDVTQVLAYNEDNQLIYFLSTEDGPKRRHLYSAD-TFGSFNRRCLTCGLPDSCGYISGSFSYNMSYFLLRCRGPDIP 507          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Medaka
Match: dpp6a (dipeptidyl aminopeptidase-like protein 6 [Source:NCBI gene;Acc:101155808])

HSP 1 Score: 168.703 bits (426), Expect = 2.086e-43
Identity = 145/521 (27.83%), Postives = 235/521 (45.11%), Query Frame = 1
Query:  250 EEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEV-NVEIGPVPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPED-----YYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGDKTIYFSAILANDSKELHLYKANITTGNF--VCVSCKNPN-CTYNTFDFNKKGGFVIHSCLGPSVP 1785
            +E+V SNP  ++WKGI IA+LVIL+I  LI+ ++   +P    + ++ +  SK T GD+FR          +WI  + L Y N   +   L++ +  +T L+     +   AS     +S D   + + Y  +  Y+HS TA Y +  ++  E  N+    V  A LQ A W P    L F++ NN+YY    + +  +  V+S   +   I  G++DWLYEEEI     A WWSP G  +A+ + ND  V   E+ ++       G      YPK                      +NPV+  ++ NLN   +   +I    P+D     +Y+  VKW     L I W NR QN + L+L +   TG   +     HE  + GW   L + + EP+      K+F        G        ++ S   +     + I + D+D T ++ ++ D  + +     +  K  HLY A+ T G+F   C++C  P+ C Y +  F+    + +  C GP +P
Sbjct:  147 QELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPG---EDDRLALKSKVTVGDLFRKEFRVHDPDAKWISNNELLYRNRDGDVVRLSVDSNEQTILVHNKKFEMYKAS--KYEVSPDLKYVLLAYNAAPVYQHSYTAFYIICSLETPETWNLNPPEVRNAQLQFAGWGPKDQQLIFIFENNIYYRSE-VKSRSIRLVSSG--KEGVIFNGLSDWLYEEEIFHSHVAHWWSPDGARLAYATINDTLVPKMELPMFTGSPYPTGK--EYHYPKAG-------------------EENPVISLHVVNLNGPLH---TIEMRRPDDPRIGEFYVTMVKWATTTKLAINWLNRAQNISILTLCEA-TTGVCTKK----HEDESEGW---LHRQDEEPLFSKDGLKLFFTRAIPQGGRGKFFHISMSTSQPNTSTDTLQSITSGDWDVTQVLAYNEDNQLIYFLSTEDGPKRRHLYSAD-TFGSFNRRCLTCGLPDSCGYISGSFSYNMSYFLLRCRGPDIP 626          
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Medaka
Match: dpp6a (dipeptidyl aminopeptidase-like protein 6 [Source:NCBI gene;Acc:101155808])

HSP 1 Score: 168.318 bits (425), Expect = 2.249e-43
Identity = 145/520 (27.88%), Postives = 234/520 (45.00%), Query Frame = 1
Query:  253 EIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEV-NVEIGPVPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPED-----YYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGDKTIYFSAILANDSKELHLYKANITTGNF--VCVSCKNPN-CTYNTFDFNKKGGFVIHSCLGPSVP 1785
            E+V SNP  ++WKGI IA+LVIL+I  LI+ ++   +P    + ++ +  SK T GD+FR          +WI  + L Y N   +   L++ +  +T L+     +   AS     +S D   + + Y  +  Y+HS TA Y +  ++  E  N+    V  A LQ A W P    L F++ NN+YY    + +  +  V+S   +   I  G++DWLYEEEI     A WWSP G  +A+ + ND  V   E+ ++       G      YPK                      +NPV+  ++ NLN   +   +I    P+D     +Y+  VKW     L I W NR QN + L+L +   TG   +     HE  + GW   L + + EP+      K+F        G        ++ S   +     + I + D+D T ++ ++ D  + +     +  K  HLY A+ T G+F   C++C  P+ C Y +  F+    + +  C GP +P
Sbjct:   56 ELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPG---EDDRLALKSKVTVGDLFRKEFRVHDPDAKWISNNELLYRNRDGDVVRLSVDSNEQTILVHNKKFEMYKAS--KYEVSPDLKYVLLAYNAAPVYQHSYTAFYIICSLETPETWNLNPPEVRNAQLQFAGWGPKDQQLIFIFENNIYYRSE-VKSRSIRLVSSG--KEGVIFNGLSDWLYEEEIFHSHVAHWWSPDGARLAYATINDTLVPKMELPMFTGSPYPTGK--EYHYPKAG-------------------EENPVISLHVVNLNGPLH---TIEMRRPDDPRIGEFYVTMVKWATTTKLAINWLNRAQNISILTLCEA-TTGVCTKK----HEDESEGW---LHRQDEEPLFSKDGLKLFFTRAIPQGGRGKFFHISMSTSQPNTSTDTLQSITSGDWDVTQVLAYNEDNQLIYFLSTEDGPKRRHLYSAD-TFGSFNRRCLTCGLPDSCGYISGSFSYNMSYFLLRCRGPDIP 534          
BLAST of Dipeptidyl peptidase 4 vs. Planmine SMEST
Match: SMESG000018885.1 (SMESG000018885.1)

HSP 1 Score: 1108.21 bits (2865), Expect = 0.000e+0
Identity = 552/572 (96.50%), Postives = 553/572 (96.68%), Query Frame = 1
Query:  175 MDMNEEKSGTALLNQNVNDLKALPTEEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGPVPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPEDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGDKTIYFSAILANDSKELHLYKANITTGNFVCVSCKNPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAMP 1890
            MDMNEEKSGTALLNQNVNDLKALPTEEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSP    DANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGPVPQAPLQNAEWSPTGHTLAFVYNNNLYYNENPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPK               AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPEDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKLAIRKWI+TADFDFTDIVYFDGDKTIYFSAILANDSKELHLYKANITTGNFVCVSCKNPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAMP
Sbjct:    1 MDMNEEKSGTALLNQNVNDLKALPTEEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSP----DANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGPVPQAPLQNAEWSPTGHTLAFVYNNNLYYNENPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPK---------------AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPEDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKLAIRKWIITADFDFTDIVYFDGDKTIYFSAILANDSKELHLYKANITTGNFVCVSCKNPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAMP 553          
BLAST of Dipeptidyl peptidase 4 vs. Planmine SMEST
Match: SMESG000018885.1 (SMESG000018885.1)

HSP 1 Score: 1103.2 bits (2852), Expect = 0.000e+0
Identity = 550/570 (96.49%), Postives = 551/570 (96.67%), Query Frame = 1
Query:  181 MNEEKSGTALLNQNVNDLKALPTEEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGPVPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPEDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDGDKTIYFSAILANDSKELHLYKANITTGNFVCVSCKNPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAMP 1890
            MNEEKSGTALLNQNVNDLKALPTEEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSP    DANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGPVPQAPLQNAEWSPTGHTLAFVYNNNLYYNENPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPK               AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPEDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKLAIRKWI+TADFDFTDIVYFDGDKTIYFSAILANDSKELHLYKANITTGNFVCVSCKNPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAMP
Sbjct:    1 MNEEKSGTALLNQNVNDLKALPTEEIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSP----DANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGPVPQAPLQNAEWSPTGHTLAFVYNNNLYYNENPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPK---------------AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPEDYYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKLAIRKWIITADFDFTDIVYFDGDKTIYFSAILANDSKELHLYKANITTGNFVCVSCKNPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILINNTDLKQLIARKAMP 551          
BLAST of Dipeptidyl peptidase 4 vs. Planmine SMEST
Match: SMESG000050507.1 (SMESG000050507.1)

HSP 1 Score: 110.538 bits (275), Expect = 8.254e-25
Identity = 128/564 (22.70%), Postives = 239/564 (42.38%), Query Frame = 1
Query:  229 DLKALPTE--EIVASNPSNKSWKGIVIAILVILMISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIGKDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTLMFIYYKHSANYRHSSTAQYT-----VFDVKKKEVNVEIGPVPQAPLQNAEWSPTGHTLAFVXXXXXXXXXXPLDNSKLICVTSNLTQSPQISYGVADWLYEEEILRVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPKVNFIVKINLMF*VN*AGSVPKAKNPVVKPYIYNLNSKRYYAISIPEGIPED-YYICFVKWIDDDHLLIGWANREQNEAWLSLAQNWLTGKDPESWVIYHEKTTNGWINMLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKLAIRKWIVTADFDFTDIVYFDG-DKTIYFSAILANDSKELHLYKANITTGNFVCVSCKNPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILIN-NTDLKQLIARKAMP 1890
            D+  LP E  E++  + +  S+ G VIA+LVI+ + GLI +A Y T P   ++ ++T      +F DIF+ +   + M ++W    LL Y N   +   + +   N+ + I      +         +S D T  F  Y +  +  H     +T     + +   K   ++I         +  W PT  ++   +  N+YY+ NP   S   C++  L Q+    YG     Y + I + + A WW   G+ +AFLS  ++  +   ++++ +   L   F N+ Y K               AG  P   N  +  Y+  + S+R ++ ++ +  P   +Y+  V+W     L+I   + +QN A    A  +    + E +V+  +   +GWI+M +  N  P+       I I     TS T Y       +S       I KW+   +   + +  +D   K +Y+ ++  N +  L +Y  NI +    C+SC+  +C  ++  F+      +H C      +++++ L          I ++ N D  + +  K+MP
Sbjct:   29 DVIKLPEELVELIKEDDNKSSYIGGVIAVLVIIFLLGLIAIATYLTMPPPKNNDHQTP----ISFSDIFKIQKDFL-MEFQWKEGALL-YRNSSGDLYKITVSNHNQINTIL---FLQNGFFRQDMEISNDLTAWF--YPNDVSKNHDGPKIFTYELVHIINGSHKSQTLQINETNDNYFNSVAWGPTSKSMIIAFQKNIYYSNNPFIQSSFTCISCPLNQNRL--YGHFVGYYADRIFKTNKAYWWDKDGKYLAFLSLVEKPDKLVPVEIF-QFKSLYSEFRNLSYSK---------------AGLSPAPYNCEI--YVIEIRSQRIFSFNLTKSAPFSLFYVVHVQWFGSSALIISLLSHQQNGA----AILFCPLSNVECFVVVDQIFGSGWIDMEEYQNILPLEDQHSLAIAI----TTSDTFYARRHLAIVSINNQSKNIIKWLSMGNRYVSQLTAYDPFSKDVYYLSLDINATTSL-VYSTNIESMRSECISCQIVSCNRSSAYFSSNVSVFLHECSDMKPKSYHIIYLNSNNFNHSISIKLDWNKDFYEYLLNKSMP 552          
The following BLAST results are available for this feature:
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DPP61.617e-4329.50dipeptidyl peptidase like 6 [Source:HGNC Symbol;Ac... [more]
DPP62.218e-4329.55dipeptidyl peptidase like 6 [Source:HGNC Symbol;Ac... [more]
DPP62.578e-4329.32dipeptidyl peptidase like 6 [Source:HGNC Symbol;Ac... [more]
DPP102.127e-3928.34dipeptidyl peptidase like 10 [Source:HGNC Symbol;A... [more]
DPP103.094e-3928.40dipeptidyl peptidase like 10 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dpf-21.634e-1727.43Dipeptidyl peptidase family member 2 [Source:UniP... [more]
dpf-21.634e-1727.43Dipeptidyl peptidase family member 2 [Source:UniP... [more]
dpf-19.944e-1423.48Dipeptidyl peptidase family member 1 [Source:UniP... [more]
dpf-11.029e-1323.48Dipeptidyl peptidase family member 1 [Source:UniP... [more]
dpf-11.036e-1323.55Dipeptidyl peptidase family member 1 [Source:UniP... [more]
back to top
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ome4.678e-2526.01gene:FBgn0259175 transcript:FBtr0333043[more]
ome5.990e-2526.01gene:FBgn0259175 transcript:FBtr0299650[more]
ome7.681e-2526.01gene:FBgn0259175 transcript:FBtr0299649[more]
CG110348.552e-2525.84gene:FBgn0031741 transcript:FBtr0306841[more]
CG110348.552e-2525.84gene:FBgn0031741 transcript:FBtr0342609[more]
back to top
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dpp6a3.286e-4628.74dipeptidyl-peptidase 6a [Source:ZFIN;Acc:ZDB-GENE-... [more]
dpp6a1.438e-4528.63dipeptidyl-peptidase 6a [Source:ZFIN;Acc:ZDB-GENE-... [more]
dpp6b8.966e-4329.09dipeptidyl-peptidase 6b [Source:ZFIN;Acc:ZDB-GENE-... [more]
dpp6b2.010e-4229.37dipeptidyl-peptidase 6b [Source:ZFIN;Acc:ZDB-GENE-... [more]
dpp41.918e-3727.17dipeptidyl-peptidase 4 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dpp63.668e-4730.89dipeptidyl-peptidase 6 [Source:NCBI gene;Acc:10012... [more]
dpp65.287e-4730.95dipeptidyl-peptidase 6 [Source:NCBI gene;Acc:10012... [more]
dpp66.018e-4730.89dipeptidyl-peptidase 6 [Source:NCBI gene;Acc:10012... [more]
dpp68.240e-4330.11dipeptidyl-peptidase 6 [Source:NCBI gene;Acc:10012... [more]
dpp61.574e-4030.12dipeptidyl-peptidase 6 [Source:NCBI gene;Acc:10012... [more]
back to top
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dpp62.397e-4328.77dipeptidylpeptidase 6 [Source:MGI Symbol;Acc:MGI:9... [more]
Dpp64.171e-4328.90dipeptidylpeptidase 6 [Source:MGI Symbol;Acc:MGI:9... [more]
Dpp68.453e-4328.93dipeptidylpeptidase 6 [Source:MGI Symbol;Acc:MGI:9... [more]
Dpp69.835e-4328.88dipeptidylpeptidase 6 [Source:MGI Symbol;Acc:MGI:9... [more]
Dpp107.085e-3928.44dipeptidylpeptidase 10 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Dipeptidyl peptidase 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5IS50|DPP6_PANTR2.140e-4329.37Dipeptidyl aminopeptidase-like protein 6 OS=Pan tr... [more]
sp|P42658|DPP6_HUMAN1.238e-4229.32Dipeptidyl aminopeptidase-like protein 6 OS=Homo s... [more]
sp|Q9Z218|DPP6_MOUSE1.677e-4228.77Dipeptidyl aminopeptidase-like protein 6 OS=Mus mu... [more]
sp|P46101|DPP6_RAT8.427e-4228.42Dipeptidyl aminopeptidase-like protein 6 OS=Rattus... [more]
sp|P42659|DPP6_BOVIN1.636e-4028.47Dipeptidyl aminopeptidase-like protein 6 OS=Bos ta... [more]
back to top
BLAST of Dipeptidyl peptidase 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7YGX22.327e-8132.17Dipeptidyl peptidase 4 OS=Clonorchis sinensis OX=7... [more]
A0A074ZWG59.991e-8031.38Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A3R7G5061.942e-7731.70Dipeptidyl aminopeptidase-like protein 6 OS=Clonor... [more]
A0A095BWJ21.264e-7532.22Dipeptidyl aminopeptidase-like protein 6 (Fragment... [more]
A0A4E0RJE57.122e-7332.24Subfamily S9B unassigned peptidase (S09 family) OS... [more]
back to top
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DPP101.591e-4128.37dipeptidyl peptidase like 10 [Source:NCBI gene;Acc... [more]
DPP105.271e-4128.34dipeptidyl peptidase like 10 [Source:NCBI gene;Acc... [more]
DPP103.497e-3527.88dipeptidyl peptidase like 10 [Source:NCBI gene;Acc... [more]
dpp6a9.707e-3527.97dipeptidyl-peptidase 6a [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSAMXT00000056368.13.945e-3425.51inactive dipeptidyl peptidase 10-like [Source:NCBI... [more]
back to top
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
DPP103.446e-3425.35dipeptidyl peptidase like 10 [Source:HGNC Symbol;A... [more]
DPP101.472e-2526.90dipeptidyl peptidase like 10 [Source:HGNC Symbol;A... [more]
ENSPMAT00000002387.18.111e-824.56pep scaffold:Pmarinus_7.0:GL477790:26893:33618:1 g... [more]
back to top
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
STE131.617e-1123.54Dipeptidyl aminopeptidase; Golgi integral membrane... [more]
DAP23.150e-1029.94Dipeptidyl aminopeptidase; synthesized as a glycos... [more]
back to top
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO489028.588e-2322.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dipeptidyl peptidase 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dpp6a1.087e-4327.88dipeptidyl aminopeptidase-like protein 6 [Source:N... [more]
dpp6a1.227e-4327.88dipeptidyl aminopeptidase-like protein 6 [Source:N... [more]
dpp6a1.420e-4327.83dipeptidyl aminopeptidase-like protein 6 [Source:N... [more]
dpp6a2.086e-4327.83dipeptidyl aminopeptidase-like protein 6 [Source:N... [more]
dpp6a2.249e-4327.88dipeptidyl aminopeptidase-like protein 6 [Source:N... [more]
back to top
BLAST of Dipeptidyl peptidase 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000018885.10.000e+096.50SMESG000018885.1[more]
SMESG000018885.10.000e+096.49SMESG000018885.1[more]
SMESG000050507.18.254e-2522.70SMESG000050507.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020315 ID=SMED30020315|Name=Dipeptidyl peptidase 4|organism=Schmidtea mediterranea sexual|type=transcript|length=1965bp
GTCAGAAAATACACACACACCGGCAAGATTACGATTTGCGAGAATTTGAT
TGGCTGTTGAAGAATTCTATTAGTTAGTAGTAATTGAAATTTATCGATTT
TTAAATTTGAGAAAAATTTTTACAAGTTTAAATTTGTTAAATAAAAATCT
GTCAGAAATTTTATATTGTTAATTATGGACATGAATGAAGAAAAGAGTGG
CACAGCTCTTTTAAATCAAAATGTTAACGATCTAAAAGCTTTACCAACAG
AAGAAATTGTTGCCAGCAATCCTTCAAATAAAAGCTGGAAGGGCATTGTT
ATAGCGATATTAGTAATTTTGATGATCTCCGGCCTAATCATTCTAGCTAT
TTATTGCACATCGCCAGAACTTTTTCACGATGCAAATAAAACAAGTTATG
GTTCCAAATTTACATTCGGAGACATTTTTCGGAGTCGAGCTCTTCATATA
TCAATGGTATATGAATGGATTGGAAAAGATCTCTTGAGTTATGTTAATGA
AAAAAATGAAAGGAAGCTTCTTAACTTACAAACAAAAAATGAAACAGATT
TAATATGGAAACCATATTTAGATGAAAAAAATGCCTCACCAACCTCATGC
AGCTTAAGCCGGGATGGGACACTAATGTTCATTTATTACAAACATAGCGC
AAATTATCGACATAGCTCCACTGCTCAATATACAGTCTTTGATGTAAAGA
AAAAAGAAGTGAACGTTGAAATAGGACCAGTCCCACAGGCACCACTTCAA
AACGCAGAATGGTCACCAACCGGTCACACTTTGGCCTTTGTGTATAATAA
TAATTTATATTACAATGAAAATCCTCTGGATAATTCAAAATTGATATGTG
TTACGTCAAATCTAACCCAAAGTCCTCAAATTAGTTATGGGGTTGCCGAC
TGGCTTTACGAAGAGGAAATCCTCCGAGTGAGCACTGCTTTATGGTGGTC
ACCGTCTGGACAAAACATAGCATTTTTGTCATTTAACGATGAGAAGGTTC
AAAATTATGAAATCAAAGTTTATGGGGAACAGGATGAATTAAATGGACAC
TTCATTAATGTCCGTTATCCTAAAGTTAATTTTATTGTAAAAATTAATTT
AATGTTTTAAGTAAATTAGGCTGGATCTGTTCCAAAGGCAAAAAATCCAG
TTGTCAAACCATACATTTATAATTTAAACAGCAAAAGATATTATGCTATT
TCAATTCCTGAAGGCATACCTGAGGATTATTATATATGCTTTGTGAAATG
GATTGATGATGATCATTTATTAATTGGTTGGGCTAACCGTGAGCAAAATG
AAGCATGGCTTTCTTTAGCACAGAATTGGTTGACAGGCAAAGATCCAGAA
TCTTGGGTGATATACCATGAAAAAACCACAAATGGATGGATAAATATGTT
GAAACAGTCAAACAGTGAGCCTATAATGTTTCCGAGAAAGAAAAAGATAT
TTATCATTGAAAATCGAATCACTTCTGGAACTGAGTACCGAAATATTGCT
GAATTGAATTTGTCATATACCCCTTCAAAATTGGCAATTAGGAAGTGGAT
CGTCACGGCGGATTTCGATTTCACGGATATTGTGTATTTTGATGGAGATA
AAACGATATATTTCTCCGCTATCCTTGCAAATGATTCTAAAGAACTTCAT
TTATATAAAGCAAATATCACGACTGGAAATTTTGTCTGCGTATCATGTAA
AAATCCAAACTGTACGTATAACACGTTTGACTTTAACAAAAAAGGAGGAT
TTGTTATTCATTCATGTCTTGGACCGTCCGTACCAACATTTTACTTGCTA
CTACTCACTGAAAAAGGAATTTTACAACAAGATCGAATTTTGATCAACAA
CACAGACCTCAAGCAGTTGATTGCTAGAAAAGCGATGCCAAAAGTGCAAT
ATCAGAAGAAACAAAAATGATGCTTCCAGTGACTTTAAATAAAATTCATG
TTACGCAATATCCGT
back to top

protein sequence of SMED30020315-orf-1

>SMED30020315-orf-1 ID=SMED30020315-orf-1|Name=SMED30020315-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=312bp
MDMNEEKSGTALLNQNVNDLKALPTEEIVASNPSNKSWKGIVIAILVILM
ISGLIILAIYCTSPELFHDANKTSYGSKFTFGDIFRSRALHISMVYEWIG
KDLLSYVNEKNERKLLNLQTKNETDLIWKPYLDEKNASPTSCSLSRDGTL
MFIYYKHSANYRHSSTAQYTVFDVKKKEVNVEIGPVPQAPLQNAEWSPTG
HTLAFVYNNNLYYNENPLDNSKLICVTSNLTQSPQISYGVADWLYEEEIL
RVSTALWWSPSGQNIAFLSFNDEKVQNYEIKVYGEQDELNGHFINVRYPK
VNFIVKINLMF*
back to top

protein sequence of SMED30020315-orf-2

>SMED30020315-orf-2 ID=SMED30020315-orf-2|Name=SMED30020315-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=175bp
MLKQSNSEPIMFPRKKKIFIIENRITSGTEYRNIAELNLSYTPSKLAIRK
WIVTADFDFTDIVYFDGDKTIYFSAILANDSKELHLYKANITTGNFVCVS
CKNPNCTYNTFDFNKKGGFVIHSCLGPSVPTFYLLLLTEKGILQQDRILI
NNTDLKQLIARKAMPKVQYQKKQK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003104enteric muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR038554Peptidase_S9B_N_sf
IPR002469Peptidase_S9B_N
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
Vocabulary: molecular function
TermDefinition
GO:0008236serine-type peptidase activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002469Dipeptidylpeptidase IV, N-terminal domainPFAMPF00930DPPIV_Ncoord: 145..301
e-value: 2.2E-41
score: 141.8
IPR038554Dipeptidylpeptidase IV, N-terminal domain superfamilyGENE3DG3DSA:2.140.10.30coord: 77..306
e-value: 2.4E-56
score: 193.1
NoneNo IPR availablePANTHERPTHR11731:SF110ACTA1 PROTEIN-RELATEDcoord: 24..301
NoneNo IPR availablePANTHERPTHR11731PROTEASE FAMILY S9B,C DIPEPTIDYL-PEPTIDASE IV-RELATEDcoord: 24..301
NoneNo IPR availableSUPERFAMILYSSF82171DPP6 N-terminal domain-likecoord: 114..299
NoneNo IPR availableTMHMMTMhelixcoord: 40..62