Terminal nucleotidyltransferase 5C

Overview
NameTerminal nucleotidyltransferase 5C
Smed IDSMED30020310
Length (bp)1616
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Terminal nucleotidyltransferase 5C (SMED30020310) t-SNE clustered cells

Violin plots show distribution of expression levels for Terminal nucleotidyltransferase 5C (SMED30020310) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Terminal nucleotidyltransferase 5C (SMED30020310) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Terminal nucleotidyltransferase 5C (SMED30020310) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020310

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30020310SMESG000041951.1 SmedASXL_009068SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30020310SMESG000041951.1 dd_Smed_v6_11571_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30020310SMESG000041951.1 OX_Smed_1.0.11621ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Human
Match: TENT5C (terminal nucleotidyltransferase 5C [Source:HGNC Symbol;Acc:HGNC:24712])

HSP 1 Score: 272.322 bits (695), Expect = 8.964e-86
Identity = 153/327 (46.79%), Postives = 208/327 (63.61%), Query Frame = 2
Query:  269 YQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILRNNRQSCHN-KIIP----ESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFD-KGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLIN 1231
            + +L +DQ+ +L EVL + + +       PT+ I LK  +Q +R   +   +K+ D+RLNG AA +V+  D      DLDLI  + +     E   +R  VL S+L    +  +  KI P    E+Y+ K V+V      D WSLISL +  G N  VELK V ++RR+FEFSVDSFQI LDSLL F+D     IS HF+PTV+ ES++G F EA  HL+ RLI T+ PEEIRGGGLLKY  LL+ D+ P +  ++ +LERYMCSRFFIDFPD+ +Q+ KL +YL NHF ++ + + +YL  L  VV+ STVCLM HER QTL+LI+
Sbjct:   14 FSVLNWDQVSRLHEVLTEVVPIHGR-GNFPTLEITLKDIVQTVRSRLEEAGIKVHDVRLNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEA-EFQLVRDVVLCSLLNFLPEGVNKLKISPVTLKEAYVQKLVKV--CTDTDRWSLISLSNKNGKN--VELKFVDSIRRQFEFSVDSFQIILDSLLFFYDCSNNPISEHFHPTVIGESMYGDFEEAFDHLQNRLIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIKTLERYMCSRFFIDFPDILEQQRKLETYLQNHFAEEERSKYDYLMILRRVVNESTVCLMGHERRQTLNLIS 334          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Human
Match: TENT5D (terminal nucleotidyltransferase 5D [Source:HGNC Symbol;Acc:HGNC:28399])

HSP 1 Score: 260.766 bits (665), Expect = 2.172e-81
Identity = 144/338 (42.60%), Postives = 212/338 (62.72%), Query Frame = 2
Query:  254 ISKNRYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILR-----NNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFF-DKGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDV 1249
            +S+ R+  L +DQ+  L +VL++ I +       PT+ +  K  +  ++       + ++D RLNG  ASY++ S    SY DLD+I  +++  G +E   ++ AVL+ +L        ++     I+ ++Y+ K V+V +    D WSLISL ++ G N  +ELK V ++RR+FEFSVDSFQI LD +L F+ DK  +++   YP VVAES++G F EA +HL+ +LI T KPEEIRGGGLLKYC LL+  + P    ++ +LERYMCSRFFIDFP +E+Q+ K+ SYL NHF  +   + +YL TL  VV+ STVCLM++ER Q L LI  +   V
Sbjct:    1 MSEIRFTNLTWDQVITLDQVLDEVIPIHGK-GNFPTMEVKPKDIIHVVKDQLIGQGIIVKDARLNGSVASYILASHNGISYKDLDVIFGVELP-GNEEFQVVKDAVLDCLLDFLPKDVKKEKLSPDIMKDAYVQKLVKVCNGH--DCWSLISLSNNTGKN--LELKFVSSLRRQFEFSVDSFQIVLDPMLDFYSDKNAKLTKESYPVVVAESMYGDFQEAMTHLQHKLICTRKPEEIRGGGLLKYCSLLVHGFKPACMSEIKNLERYMCSRFFIDFPHIEEQQKKIESYLHNHFIGEGMTKYDYLMTLHGVVNESTVCLMSYERRQILHLITMMALKV 332          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Human
Match: TENT5D (terminal nucleotidyltransferase 5D [Source:HGNC Symbol;Acc:HGNC:28399])

HSP 1 Score: 260.766 bits (665), Expect = 2.172e-81
Identity = 144/338 (42.60%), Postives = 212/338 (62.72%), Query Frame = 2
Query:  254 ISKNRYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILR-----NNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFF-DKGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDV 1249
            +S+ R+  L +DQ+  L +VL++ I +       PT+ +  K  +  ++       + ++D RLNG  ASY++ S    SY DLD+I  +++  G +E   ++ AVL+ +L        ++     I+ ++Y+ K V+V +    D WSLISL ++ G N  +ELK V ++RR+FEFSVDSFQI LD +L F+ DK  +++   YP VVAES++G F EA +HL+ +LI T KPEEIRGGGLLKYC LL+  + P    ++ +LERYMCSRFFIDFP +E+Q+ K+ SYL NHF  +   + +YL TL  VV+ STVCLM++ER Q L LI  +   V
Sbjct:    1 MSEIRFTNLTWDQVITLDQVLDEVIPIHGK-GNFPTMEVKPKDIIHVVKDQLIGQGIIVKDARLNGSVASYILASHNGISYKDLDVIFGVELP-GNEEFQVVKDAVLDCLLDFLPKDVKKEKLSPDIMKDAYVQKLVKVCNGH--DCWSLISLSNNTGKN--LELKFVSSLRRQFEFSVDSFQIVLDPMLDFYSDKNAKLTKESYPVVVAESMYGDFQEAMTHLQHKLICTRKPEEIRGGGLLKYCSLLVHGFKPACMSEIKNLERYMCSRFFIDFPHIEEQQKKIESYLHNHFIGEGMTKYDYLMTLHGVVNESTVCLMSYERRQILHLITMMALKV 332          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Human
Match: TENT5A (terminal nucleotidyltransferase 5A [Source:HGNC Symbol;Acc:HGNC:18345])

HSP 1 Score: 256.529 bits (654), Expect = 4.580e-79
Identity = 143/325 (44.00%), Postives = 203/325 (62.46%), Query Frame = 2
Query:  275 ILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSIL-----RNNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYE-ISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLIN 1231
            +L ++Q+ +L  +L + I +       PT+ +   L ++ +R+      + + D+RLNG AAS+V+  D    Y DLDLI   D++ G  E   ++  VL+ +L       N++      + E+Y+ K V+V +    D WSLISL ++ G N  VELK V ++RR+FEFSVDSFQIKLDSLL F++     ++  F+PT++ ESV+G F EA  HL  ++I T  PEEIRGGGLLKYC LL+  + P +D ++ +L+RYMCSRFFIDF D+ +Q+ KL SYL NHF      +  YL TL  VV+ STVCLM HER QTL+LI 
Sbjct:   65 VLNWEQVQRLDGILSETIPIHGR-GNFPTLELQPSLIVKVVRRRLAEKRIGVRDVRLNGSAASHVLHQDSGLGYKDLDLIFCADLR-GEGEFQTVKDVVLDCLLDFLPEGVNKEKITPLTLKEAYVQKMVKVCND--SDRWSLISLSNNSGKN--VELKFVDSLRRQFEFSVDSFQIKLDSLLLFYECSENPMTETFHPTIIGESVYGDFQEAFDHLCNKIIATRNPEEIRGGGLLKYCNLLVRGFRPASD-EIKTLQRYMCSRFFIDFSDIGEQQRKLESYLQNHFVGLEDRKYEYLMTLHGVVNESTVCLMGHERRQTLNLIT 382          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Human
Match: TENT5A (terminal nucleotidyltransferase 5A [Source:HGNC Symbol;Acc:HGNC:18345])

HSP 1 Score: 256.144 bits (653), Expect = 9.734e-79
Identity = 143/325 (44.00%), Postives = 203/325 (62.46%), Query Frame = 2
Query:  275 ILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSIL-----RNNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYE-ISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLIN 1231
            +L ++Q+ +L  +L + I +       PT+ +   L ++ +R+      + + D+RLNG AAS+V+  D    Y DLDLI   D++ G  E   ++  VL+ +L       N++      + E+Y+ K V+V +    D WSLISL ++ G N  VELK V ++RR+FEFSVDSFQIKLDSLL F++     ++  F+PT++ ESV+G F EA  HL  ++I T  PEEIRGGGLLKYC LL+  + P +D ++ +L+RYMCSRFFIDF D+ +Q+ KL SYL NHF      +  YL TL  VV+ STVCLM HER QTL+LI 
Sbjct:   84 VLNWEQVQRLDGILSETIPIHGR-GNFPTLELQPSLIVKVVRRRLAEKRIGVRDVRLNGSAASHVLHQDSGLGYKDLDLIFCADLR-GEGEFQTVKDVVLDCLLDFLPEGVNKEKITPLTLKEAYVQKMVKVCND--SDRWSLISLSNNSGKN--VELKFVDSLRRQFEFSVDSFQIKLDSLLLFYECSENPMTETFHPTIIGESVYGDFQEAFDHLCNKIIATRNPEEIRGGGLLKYCNLLVRGFRPASD-EIKTLQRYMCSRFFIDFSDIGEQQRKLESYLQNHFVGLEDRKYEYLMTLHGVVNESTVCLMGHERRQTLNLIT 401          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Celegans
Match: pqn-44 (Prion-like-(Q/N-rich)-domain-bearing protein [Source:UniProtKB/TrEMBL;Acc:Q86NJ5])

HSP 1 Score: 223.016 bits (567), Expect = 9.318e-67
Identity = 145/382 (37.96%), Postives = 206/382 (53.93%), Query Frame = 2
Query:  263 NRYQILPYDQICKLQEVLEQKISL--ASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDE--MPKIRSAVLNSILRNNRQSCHNKIIPES---------YIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDD---------------------------------SKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDVWNRAQTP 1270
            +R  IL   Q+ +L+ VLE+++ +    N P + T  INL   ++ +R++  ++ V+  D+RLNGGAAS+V  SD  FSY DLDLI  + +   +DE    +I  A+ +S+    R+   + I  E          YI K ++V  S   D WSL SL + YG  R +ELK V  MRR+FEFSVDSFQI LD LL   D+  +        +  ES++G   +A +HL +RLI T KPEEIRGGGLLKYC L+I  Y      +   LERYMCSRFFIDFPD+  Q++KL +YL +HF                                     + + ++L  L  V+  STVCLM HER  +L++I+ + + +  +  TP
Sbjct:   45 SRTMILAKGQMKRLRAVLEERVEIHGRGNFPTISTKLINL---IRCLRQHMGSVQVEARDVRLNGGAASFVASSD-DFSYADLDLIFPIQIDEESDENVEKQIFDAIRDSVFMTIRELMPDNIGKEKFDFETLKDVYIRKMIKV--STDNDKWSLFSLNNEYG--RCIELKFVNKMRRQFEFSVDSFQIHLDPLLNELDECEQ------KKITIESMYGDVQQAMTHLHERLIDTVKPEEIRGGGLLKYCHLIIRGYKAAKPWNCRKLERYMCSRFFIDFPDLISQENKLRNYLDSHFGTSFNGATYDQWSSSGSDTDSEASTSQATTSSLLVTGQAKYDFLMLLYRVIDESTVCLMAHERNMSLNMIDRVAFQLSMQCYTP 412          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Celegans
Match: pqn-44 (Prion-like-(Q/N-rich)-domain-bearing protein [Source:UniProtKB/TrEMBL;Acc:Q86NJ5])

HSP 1 Score: 223.016 bits (567), Expect = 9.318e-67
Identity = 145/382 (37.96%), Postives = 206/382 (53.93%), Query Frame = 2
Query:  263 NRYQILPYDQICKLQEVLEQKISL--ASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDE--MPKIRSAVLNSILRNNRQSCHNKIIPES---------YIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDD---------------------------------SKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDVWNRAQTP 1270
            +R  IL   Q+ +L+ VLE+++ +    N P + T  INL   ++ +R++  ++ V+  D+RLNGGAAS+V  SD  FSY DLDLI  + +   +DE    +I  A+ +S+    R+   + I  E          YI K ++V  S   D WSL SL + YG  R +ELK V  MRR+FEFSVDSFQI LD LL   D+  +        +  ES++G   +A +HL +RLI T KPEEIRGGGLLKYC L+I  Y      +   LERYMCSRFFIDFPD+  Q++KL +YL +HF                                     + + ++L  L  V+  STVCLM HER  +L++I+ + + +  +  TP
Sbjct:   45 SRTMILAKGQMKRLRAVLEERVEIHGRGNFPTISTKLINL---IRCLRQHMGSVQVEARDVRLNGGAASFVASSD-DFSYADLDLIFPIQIDEESDENVEKQIFDAIRDSVFMTIRELMPDNIGKEKFDFETLKDVYIRKMIKV--STDNDKWSLFSLNNEYG--RCIELKFVNKMRRQFEFSVDSFQIHLDPLLNELDECEQ------KKITIESMYGDVQQAMTHLHERLIDTVKPEEIRGGGLLKYCHLIIRGYKAAKPWNCRKLERYMCSRFFIDFPDLISQENKLRNYLDSHFGTSFNGATYDQWSSSGSDTDSEASTSQATTSSLLVTGQAKYDFLMLLYRVIDESTVCLMAHERNMSLNMIDRVAFQLSMQCYTP 412          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Celegans
Match: pqn-44 (Prion-like-(Q/N-rich)-domain-bearing protein [Source:UniProtKB/TrEMBL;Acc:Q86NJ5])

HSP 1 Score: 223.016 bits (567), Expect = 1.296e-66
Identity = 145/382 (37.96%), Postives = 206/382 (53.93%), Query Frame = 2
Query:  263 NRYQILPYDQICKLQEVLEQKISL--ASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDE--MPKIRSAVLNSILRNNRQSCHNKIIPES---------YIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDD---------------------------------SKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDVWNRAQTP 1270
            +R  IL   Q+ +L+ VLE+++ +    N P + T  INL   ++ +R++  ++ V+  D+RLNGGAAS+V  SD  FSY DLDLI  + +   +DE    +I  A+ +S+    R+   + I  E          YI K ++V  S   D WSL SL + YG  R +ELK V  MRR+FEFSVDSFQI LD LL   D+  +        +  ES++G   +A +HL +RLI T KPEEIRGGGLLKYC L+I  Y      +   LERYMCSRFFIDFPD+  Q++KL +YL +HF                                     + + ++L  L  V+  STVCLM HER  +L++I+ + + +  +  TP
Sbjct:   61 SRTMILAKGQMKRLRAVLEERVEIHGRGNFPTISTKLINL---IRCLRQHMGSVQVEARDVRLNGGAASFVASSD-DFSYADLDLIFPIQIDEESDENVEKQIFDAIRDSVFMTIRELMPDNIGKEKFDFETLKDVYIRKMIKV--STDNDKWSLFSLNNEYG--RCIELKFVNKMRRQFEFSVDSFQIHLDPLLNELDECEQ------KKITIESMYGDVQQAMTHLHERLIDTVKPEEIRGGGLLKYCHLIIRGYKAAKPWNCRKLERYMCSRFFIDFPDLISQENKLRNYLDSHFGTSFNGATYDQWSSSGSDTDSEASTSQATTSSLLVTGQAKYDFLMLLYRVIDESTVCLMAHERNMSLNMIDRVAFQLSMQCYTP 428          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Celegans
Match: pqn-44 (Prion-like-(Q/N-rich)-domain-bearing protein [Source:UniProtKB/TrEMBL;Acc:Q86NJ5])

HSP 1 Score: 223.402 bits (568), Expect = 1.404e-66
Identity = 145/382 (37.96%), Postives = 206/382 (53.93%), Query Frame = 2
Query:  263 NRYQILPYDQICKLQEVLEQKISL--ASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDE--MPKIRSAVLNSILRNNRQSCHNKIIPES---------YIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDD---------------------------------SKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDVWNRAQTP 1270
            +R  IL   Q+ +L+ VLE+++ +    N P + T  INL   ++ +R++  ++ V+  D+RLNGGAAS+V  SD  FSY DLDLI  + +   +DE    +I  A+ +S+    R+   + I  E          YI K ++V  S   D WSL SL + YG  R +ELK V  MRR+FEFSVDSFQI LD LL   D+  +        +  ES++G   +A +HL +RLI T KPEEIRGGGLLKYC L+I  Y      +   LERYMCSRFFIDFPD+  Q++KL +YL +HF                                     + + ++L  L  V+  STVCLM HER  +L++I+ + + +  +  TP
Sbjct:   74 SRTMILAKGQMKRLRAVLEERVEIHGRGNFPTISTKLINL---IRCLRQHMGSVQVEARDVRLNGGAASFVASSD-DFSYADLDLIFPIQIDEESDENVEKQIFDAIRDSVFMTIRELMPDNIGKEKFDFETLKDVYIRKMIKV--STDNDKWSLFSLNNEYG--RCIELKFVNKMRRQFEFSVDSFQIHLDPLLNELDECEQ------KKITIESMYGDVQQAMTHLHERLIDTVKPEEIRGGGLLKYCHLIIRGYKAAKPWNCRKLERYMCSRFFIDFPDLISQENKLRNYLDSHFGTSFNGATYDQWSSSGSDTDSEASTSQATTSSLLVTGQAKYDFLMLLYRVIDESTVCLMAHERNMSLNMIDRVAFQLSMQCYTP 441          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Celegans
Match: pqn-44 (Prion-like-(Q/N-rich)-domain-bearing protein [Source:UniProtKB/TrEMBL;Acc:Q86NJ5])

HSP 1 Score: 223.016 bits (567), Expect = 1.469e-66
Identity = 146/382 (38.22%), Postives = 206/382 (53.93%), Query Frame = 2
Query:  263 NRYQILPYDQICKLQEVLEQKISL--ASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDE--MPKIRSAVLNSILRNNRQSCHNKIIPES---------YIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDD---------------------------------SKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDVWNRAQTP 1270
            +R  IL   Q+ +L+ VLE+++ +    N P + T  INL   ++ +R++  ++ V+  D+RLNGGAAS+V  SD  FSY DLDLI  + +   +DE    +I  A+ +S+    R+   + I  E          YI K ++V  S   D WSL SL + YG  R +ELK V  MRR+FEFSVDSFQI LD LL   D+     C     +  ES++G   +A +HL +RLI T KPEEIRGGGLLKYC L+I  Y      +   LERYMCSRFFIDFPD+  Q++KL +YL +HF                                     + + ++L  L  V+  STVCLM HER  +L++I+ + + +  +  TP
Sbjct:   69 SRTMILAKGQMKRLRAVLEERVEIHGRGNFPTISTKLINL---IRCLRQHMGSVQVEARDVRLNGGAASFVASSD-DFSYADLDLIFPIQIDEESDENVEKQIFDAIRDSVFMTIRELMPDNIGKEKFDFETLKDVYIRKMIKV--STDNDKWSLFSLNNEYG--RCIELKFVNKMRRQFEFSVDSFQIHLDPLLNELDE-----CE-QKKITIESMYGDVQQAMTHLHERLIDTVKPEEIRGGGLLKYCHLIIRGYKAAKPWNCRKLERYMCSRFFIDFPDLISQENKLRNYLDSHFGTSFNGATYDQWSSSGSDTDSEASTSQATTSSLLVTGQAKYDFLMLLYRVIDESTVCLMAHERNMSLNMIDRVAFQLSMQCYTP 436          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Fly
Match: CG46385 (gene:FBgn0286778 transcript:FBtr0474227)

HSP 1 Score: 283.108 bits (723), Expect = 1.437e-88
Identity = 161/354 (45.48%), Postives = 229/354 (64.69%), Query Frame = 2
Query:  239 GNLKKI---SKNRYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDA------LDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILRNNRQS-CHNKI----IPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFD-KGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHF--PDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDV 1249
            G+L+ +      R  +L ++Q+ KL +V+++K+++       PT+ + LK  +  +R+  +A        V ++D+RLNGGAAS+V+ S+    YNDLDLI ++++ +      +++ AVLN++L    +  C  +I    + E+Y+ K V+V ++  GD WSLISLG+S  G++ VELK V  MRR+FEFSVDSFQI LDSLL F+D     IS +FYPTVV ESV+G F EA  HL+++LI T +PEEIRGGGLLKYC LL+ +Y   +   + +LERYMCSRFFIDFPD+  Q  KL +YL NHF   D+  ++  YL  L  VV  STVCLM HER Q+L LI ++   V
Sbjct:   36 GSLESVDTGGTQRLAVLSFEQVSKLHDVMDEKVAIHGR-GNFPTLEVKLKDLVNLVRRKLEAEVNAGGAGVLVKDIRLNGGAASHVLASEDQ-PYNDLDLIFAIELSS-PRVFDRVKVAVLNTLLDLMPEGVCKRRIYTCSLKEAYVGKMVKVNNNNDGDRWSLISLGNS-PGHKNVELKFVDTMRRQFEFSVDSFQIVLDSLLLFYDCAALPISENFYPTVVGESVYGDFQEALYHLQKKLISTRQPEEIRGGGLLKYCNLLVRNYKAVDSQLIKTLERYMCSRFFIDFPDINTQTTKLEAYLRNHFWGVDEEPLQYQYLMHLREVVEMSTVCLMGHERRQSLHLIQSLAAQV 385          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Fly
Match: CG46385 (gene:FBgn0286778 transcript:FBtr0474226)

HSP 1 Score: 283.108 bits (723), Expect = 1.437e-88
Identity = 161/354 (45.48%), Postives = 229/354 (64.69%), Query Frame = 2
Query:  239 GNLKKI---SKNRYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDA------LDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILRNNRQS-CHNKI----IPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFD-KGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHF--PDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDV 1249
            G+L+ +      R  +L ++Q+ KL +V+++K+++       PT+ + LK  +  +R+  +A        V ++D+RLNGGAAS+V+ S+    YNDLDLI ++++ +      +++ AVLN++L    +  C  +I    + E+Y+ K V+V ++  GD WSLISLG+S  G++ VELK V  MRR+FEFSVDSFQI LDSLL F+D     IS +FYPTVV ESV+G F EA  HL+++LI T +PEEIRGGGLLKYC LL+ +Y   +   + +LERYMCSRFFIDFPD+  Q  KL +YL NHF   D+  ++  YL  L  VV  STVCLM HER Q+L LI ++   V
Sbjct:   36 GSLESVDTGGTQRLAVLSFEQVSKLHDVMDEKVAIHGR-GNFPTLEVKLKDLVNLVRRKLEAEVNAGGAGVLVKDIRLNGGAASHVLASEDQ-PYNDLDLIFAIELSS-PRVFDRVKVAVLNTLLDLMPEGVCKRRIYTCSLKEAYVGKMVKVNNNNDGDRWSLISLGNS-PGHKNVELKFVDTMRRQFEFSVDSFQIVLDSLLLFYDCAALPISENFYPTVVGESVYGDFQEALYHLQKKLISTRQPEEIRGGGLLKYCNLLVRNYKAVDSQLIKTLERYMCSRFFIDFPDINTQTTKLEAYLRNHFWGVDEEPLQYQYLMHLREVVEMSTVCLMGHERRQSLHLIQSLAAQV 385          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Fly
Match: CG46385 (gene:FBgn0286778 transcript:FBtr0474225)

HSP 1 Score: 282.722 bits (722), Expect = 4.451e-88
Identity = 161/354 (45.48%), Postives = 229/354 (64.69%), Query Frame = 2
Query:  239 GNLKKI---SKNRYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDA------LDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILRNNRQS-CHNKI----IPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFD-KGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHF--PDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDV 1249
            G+L+ +      R  +L ++Q+ KL +V+++K+++       PT+ + LK  +  +R+  +A        V ++D+RLNGGAAS+V+ S+    YNDLDLI ++++ +      +++ AVLN++L    +  C  +I    + E+Y+ K V+V ++  GD WSLISLG+S  G++ VELK V  MRR+FEFSVDSFQI LDSLL F+D     IS +FYPTVV ESV+G F EA  HL+++LI T +PEEIRGGGLLKYC LL+ +Y   +   + +LERYMCSRFFIDFPD+  Q  KL +YL NHF   D+  ++  YL  L  VV  STVCLM HER Q+L LI ++   V
Sbjct:   67 GSLESVDTGGTQRLAVLSFEQVSKLHDVMDEKVAIHGR-GNFPTLEVKLKDLVNLVRRKLEAEVNAGGAGVLVKDIRLNGGAASHVLASEDQ-PYNDLDLIFAIELSS-PRVFDRVKVAVLNTLLDLMPEGVCKRRIYTCSLKEAYVGKMVKVNNNNDGDRWSLISLGNS-PGHKNVELKFVDTMRRQFEFSVDSFQIVLDSLLLFYDCAALPISENFYPTVVGESVYGDFQEALYHLQKKLISTRQPEEIRGGGLLKYCNLLVRNYKAVDSQLIKTLERYMCSRFFIDFPDINTQTTKLEAYLRNHFWGVDEEPLQYQYLMHLREVVEMSTVCLMGHERRQSLHLIQSLAAQV 416          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Fly
Match: CG46385 (gene:FBgn0286778 transcript:FBtr0474229)

HSP 1 Score: 283.878 bits (725), Expect = 2.198e-86
Identity = 161/354 (45.48%), Postives = 229/354 (64.69%), Query Frame = 2
Query:  239 GNLKKI---SKNRYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDA------LDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILRNNRQS-CHNKI----IPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFD-KGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHF--PDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDV 1249
            G+L+ +      R  +L ++Q+ KL +V+++K+++       PT+ + LK  +  +R+  +A        V ++D+RLNGGAAS+V+ S+    YNDLDLI ++++ +      +++ AVLN++L    +  C  +I    + E+Y+ K V+V ++  GD WSLISLG+S  G++ VELK V  MRR+FEFSVDSFQI LDSLL F+D     IS +FYPTVV ESV+G F EA  HL+++LI T +PEEIRGGGLLKYC LL+ +Y   +   + +LERYMCSRFFIDFPD+  Q  KL +YL NHF   D+  ++  YL  L  VV  STVCLM HER Q+L LI ++   V
Sbjct:   67 GSLESVDTGGTQRLAVLSFEQVSKLHDVMDEKVAIHGR-GNFPTLEVKLKDLVNLVRRKLEAEVNAGGAGVLVKDIRLNGGAASHVLASEDQ-PYNDLDLIFAIELSS-PRVFDRVKVAVLNTLLDLMPEGVCKRRIYTCSLKEAYVGKMVKVNNNNDGDRWSLISLGNS-PGHKNVELKFVDTMRRQFEFSVDSFQIVLDSLLLFYDCAALPISENFYPTVVGESVYGDFQEALYHLQKKLISTRQPEEIRGGGLLKYCNLLVRNYKAVDSQLIKTLERYMCSRFFIDFPDINTQTTKLEAYLRNHFWGVDEEPLQYQYLMHLREVVEMSTVCLMGHERRQSLHLIQSLAAQV 416          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Fly
Match: CG46385 (gene:FBgn0286778 transcript:FBtr0474224)

HSP 1 Score: 283.493 bits (724), Expect = 1.514e-85
Identity = 159/342 (46.49%), Postives = 224/342 (65.50%), Query Frame = 2
Query:  266 RYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDA------LDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILRNNRQS-CHNKI----IPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFD-KGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHF--PDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDV 1249
            R  +L ++Q+ KL +V+++K+++       PT+ + LK  +  +R+  +A        V ++D+RLNGGAAS+V+ S+    YNDLDLI ++++ +      +++ AVLN++L    +  C  +I    + E+Y+ K V+V ++  GD WSLISLG+S  G++ VELK V  MRR+FEFSVDSFQI LDSLL F+D     IS +FYPTVV ESV+G F EA  HL+++LI T +PEEIRGGGLLKYC LL+ +Y   +   + +LERYMCSRFFIDFPD+  Q  KL +YL NHF   D+  ++  YL  L  VV  STVCLM HER Q+L LI ++   V
Sbjct:  396 RLAVLSFEQVSKLHDVMDEKVAIHGR-GNFPTLEVKLKDLVNLVRRKLEAEVNAGGAGVLVKDIRLNGGAASHVLASEDQ-PYNDLDLIFAIELSS-PRVFDRVKVAVLNTLLDLMPEGVCKRRIYTCSLKEAYVGKMVKVNNNNDGDRWSLISLGNS-PGHKNVELKFVDTMRRQFEFSVDSFQIVLDSLLLFYDCAALPISENFYPTVVGESVYGDFQEALYHLQKKLISTRQPEEIRGGGLLKYCNLLVRNYKAVDSQLIKTLERYMCSRFFIDFPDINTQTTKLEAYLRNHFWGVDEEPLQYQYLMHLREVVEMSTVCLMGHERRQSLHLIQSLAAQV 733          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Zebrafish
Match: tent5c (terminal nucleotidyltransferase 5C [Source:NCBI gene;Acc:327154])

HSP 1 Score: 264.233 bits (674), Expect = 6.015e-83
Identity = 144/325 (44.31%), Postives = 212/325 (65.23%), Query Frame = 2
Query:  275 ILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILR-----NNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYE-ISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLIN 1231
            +L ++Q+ +L +VL + + +       PT+ + LK  +Q +R   +   + ++D+RLNG  AS+V+  D  +SY DLD+I  +D+    +E   I+  VL+++L       N++      + E+Y+ K V+V      D WSLISL ++ G N  VELK V ++RR+FEFSVDSFQI LDS+L+++D     +S HF+PTVV ES++G F EA  HL  + I T++PEEIRGGGLLKYC LL+ ++ P +  +  +LERYMCSRFFIDFPD+ +Q+ KL +YL +HF  + + + NYL  L  VV+ STVCLM HER QTL+LI+
Sbjct:   20 VLTWEQVSRLNDVLTEAVPVHGR-GNFPTLEVRLKDIVQIVRNRLELRGIMVKDVRLNGSTASHVLVQDIGWSYKDLDVIFRVDLPR-EEEFQLIKDVVLSTLLDFLPEGVNKEKITPMTLKEAYVQKLVKVYTD--QDRWSLISLSNNNGRN--VELKFVDSIRRQFEFSVDSFQIILDSVLSYYDLSENPMSQHFHPTVVGESMYGDFVEALGHLTNKTIATKRPEEIRGGGLLKYCNLLVREFKPTDPDEFKALERYMCSRFFIDFPDIVEQQRKLEAYLQSHFIGEERNKYNYLMILRRVVNESTVCLMGHERRQTLNLIS 338          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Zebrafish
Match: TENT5A (terminal nucleotidyltransferase 5Aa [Source:NCBI gene;Acc:100330676])

HSP 1 Score: 254.988 bits (650), Expect = 2.170e-79
Identity = 140/326 (42.94%), Postives = 204/326 (62.58%), Query Frame = 2
Query:  269 YQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSIL-----RNNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYE-ISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLI 1228
            + +L ++Q+ +L  +L + I +       PT+++  +  +  +R+      + + D+RLNG AAS+V+  D    Y DLDLI  +++K G  E   +++ VL+ +L       N++      + E+Y+ K V+V +    D WSLISL ++ G N  VELK V ++RR+FEFSVDSFQIKLDSLL F++     ++  F+PT++ ESV+G F  A  HL  ++I T  PEEIRGGGLLKYC LL+  +   ++ ++ SL+RYMCSRFFIDF D+ +Q+ KL SYL NHF      + +YL TL  VV+ STVCLM HER QTL LI
Sbjct:   13 FSVLSWEQVQRLDLILTETIPIHGR-GNFPTLQMKPRQIVTAVRRRMREKSIHVRDVRLNGSAASHVLHGDSGLGYKDLDLIFRVELK-GETEFQIVKNIVLDCLLDFLPDGVNKEKITPLTLKEAYVQKMVKVCND--SDRWSLISLSNNRGKN--VELKFVDSLRRQFEFSVDSFQIKLDSLLLFYECSENPMAKTFHPTIIGESVYGDFAAALDHLRNKIICTRNPEEIRGGGLLKYCHLLVRGFRAASESEMKSLQRYMCSRFFIDFSDISEQQRKLESYLQNHFVGLEDRKYDYLTTLHSVVNESTVCLMGHERRQTLGLI 332          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Zebrafish
Match: tent5ab (terminal nucleotidyltransferase 5Ab [Source:ZFIN;Acc:ZDB-GENE-071004-35])

HSP 1 Score: 253.832 bits (647), Expect = 5.730e-79
Identity = 144/329 (43.77%), Postives = 204/329 (62.01%), Query Frame = 2
Query:  263 NRYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILR-----NNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYE-ISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLIN 1231
            N   +L ++Q+ +L  +L + I +       PT+ +  +  ++ +R   +   + + ++RLNG AAS+V+  D    Y DLDLI   D+K G  E   ++  VL+S+L       N++      + E+Y+ K V+V +    D WSLISL ++ G N  VELK V ++RR+FEFSVDSFQI+LDSLL F++     ++  F+P++V ESV+G F  A  HL+++LI T  PEEIRGGGLLKYC LL+  +   ++ ++  LERYMCSRFFIDF DV +Q+ KL SYL NHF      +  YL TL  VV+ STVCLM HER QTLSLI 
Sbjct:    6 NNLCVLNWEQVKRLDAILTESIPIHGKW-NFPTLEMKPRDIVKVVRCRMEERKIHVREVRLNGSAASHVLHEDSGLGYKDLDLIFCADLK-GEVEFQTVKDIVLDSLLDFLPEGVNKEKITPVTLKEAYVQKMVKVCND--SDRWSLISLSNNSGKN--VELKFVDSLRRQFEFSVDSFQIRLDSLLLFYECSENPMAETFHPSIVGESVYGDFSVALDHLQRKLICTRNPEEIRGGGLLKYCHLLVRGFRAASEAEMKLLERYMCSRFFIDFSDVAEQRRKLESYLQNHFVGLENRKYEYLTTLHSVVNESTVCLMGHERRQTLSLIT 328          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Zebrafish
Match: tent5ab (terminal nucleotidyltransferase 5Ab [Source:ZFIN;Acc:ZDB-GENE-071004-35])

HSP 1 Score: 253.832 bits (647), Expect = 5.730e-79
Identity = 144/329 (43.77%), Postives = 204/329 (62.01%), Query Frame = 2
Query:  263 NRYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILR-----NNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYE-ISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLIN 1231
            N   +L ++Q+ +L  +L + I +       PT+ +  +  ++ +R   +   + + ++RLNG AAS+V+  D    Y DLDLI   D+K G  E   ++  VL+S+L       N++      + E+Y+ K V+V +    D WSLISL ++ G N  VELK V ++RR+FEFSVDSFQI+LDSLL F++     ++  F+P++V ESV+G F  A  HL+++LI T  PEEIRGGGLLKYC LL+  +   ++ ++  LERYMCSRFFIDF DV +Q+ KL SYL NHF      +  YL TL  VV+ STVCLM HER QTLSLI 
Sbjct:    6 NNLCVLNWEQVKRLDAILTESIPIHGKW-NFPTLEMKPRDIVKVVRCRMEERKIHVREVRLNGSAASHVLHEDSGLGYKDLDLIFCADLK-GEVEFQTVKDIVLDSLLDFLPEGVNKEKITPVTLKEAYVQKMVKVCND--SDRWSLISLSNNSGKN--VELKFVDSLRRQFEFSVDSFQIRLDSLLLFYECSENPMAETFHPSIVGESVYGDFSVALDHLQRKLICTRNPEEIRGGGLLKYCHLLVRGFRAASEAEMKLLERYMCSRFFIDFSDVAEQRRKLESYLQNHFVGLENRKYEYLTTLHSVVNESTVCLMGHERRQTLSLIT 328          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Zebrafish
Match: tent5bb (terminal nucleotidyltransferase 5Bb [Source:ZFIN;Acc:ZDB-GENE-060503-431])

HSP 1 Score: 251.906 bits (642), Expect = 4.288e-78
Identity = 144/335 (42.99%), Postives = 204/335 (60.90%), Query Frame = 2
Query:  266 RYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILR-----NNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYE--ISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDV 1249
            R  +L ++Q+ +L  +L + + +       PT+ +  +  +Q +R   +   VK+ D++LNG AASYV+  D    Y DLDLI  L + +       ++  VL+ +L       +R       + E+Y+ K V+V +    D WSLISL ++ G N  VELK V ++RR+FEFSVDSFQI LDSLL  FD+  E  +S  F+PTV+ ES++G F EA  HL  ++I T  PEEIRGGGLLKYC LL+  + P ++  + +L+RYMCSRFFIDF D+ +Q+ KL +YL NHF      R + L TL  VV  STVCLM HER QTL+LI+++   V
Sbjct:   12 RCCVLSWEQVQRLDSILGECVPIHGR-GNFPTLSVQPRHIVQVVRARLEERGVKVRDVKLNGSAASYVLHQDTGLGYKDLDLIFGLSLTDD-KTFRLVKDVVLDCLLEFLPAGVSRDRITALTLKEAYVQKLVKVCND--TDRWSLISLSNNTGKN--VELKFVDSLRRQFEFSVDSFQIGLDSLL-LFDRCSETPMSESFHPTVLGESMYGDFEEALGHLHAKIIATHSPEEIRGGGLLKYCHLLVRGFRPASEAQMKTLQRYMCSRFFIDFSDINEQQRKLEAYLQNHFNGMEHKRYDCLVTLHRVVDESTVCLMGHERRQTLALISSLALRV 339          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Xenopus
Match: tent5b (terminal nucleotidyltransferase 5B [Source:NCBI gene;Acc:549960])

HSP 1 Score: 265.003 bits (676), Expect = 6.225e-83
Identity = 146/348 (41.95%), Postives = 209/348 (60.06%), Query Frame = 2
Query:  266 RYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSIL-----RNNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFD-KGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDVWNRAQTPLHIEIFN 1291
            R+ +L + Q+ +L  +L + + +       PT+    +  +Q +R   +   + + ++RLNG AASYV+  D    Y DLDLI  +D+K G D    ++ AVLN +L       N++      + E+Y+ K V+V      D WSLISL ++ G N  +ELK V ++RR+FEFSVDSFQI LDS+L F       +S  F+PTV  ES++G F EA  HL  R+I T  PEEIRGGGLLKYC LL+  + P +++D+ +++RYMCSR+FIDFPD+ +Q+ KL  YL +HF      R +YL TL  VV+ STVCLM HER QTL+LI ++   V +    P  +  F 
Sbjct:   14 RFSVLSWPQVRRLDAILCESVPIHGR-GNFPTLSCRPRDLVQVVRSRLEQKGILVHNVRLNGSAASYVLHHDSGLGYKDLDLIFMVDLK-GPDAFQVVKHAVLNCLLDFLPSGVNKEKITPMTLKEAYVQKLVKV--CTESDRWSLISLSNNSGKN--MELKFVDSLRRQFEFSVDSFQIILDSMLMFSQCSENPMSQSFHPTVTGESMYGDFEEAMDHLRNRIIATRNPEEIRGGGLLKYCNLLVRGFRPKSEVDMKTMQRYMCSRYFIDFPDIREQQRKLKCYLQDHFVGMEDKRYDYLMTLHQVVNESTVCLMGHERRQTLALIASLAVHVLSEQNHPQAVPTFT 355          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Xenopus
Match: ttk (TTK protein kinase [Source:Xenbase;Acc:XB-GENE-953775])

HSP 1 Score: 261.536 bits (667), Expect = 1.258e-81
Identity = 147/338 (43.49%), Postives = 207/338 (61.24%), Query Frame = 2
Query:  236 KGNLKKISKNRYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILR-----NNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFD-KGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLIN 1231
            KGN   +S     +L ++Q+ +L   L + + +       PT++I LK  +Q++R   +   +K+ D+RLNG AAS+V+  D    Y DLDLI  + + +   E   ++  V+  +L       N++      + E+Y+ K V+V      D WSLISL +  G N  +ELK V ++RR+FEFSVDSFQI LDSLL + D     +S HF+PTV+ ES++G F  A  HL  +LI T+ PEEIRGGGL+KY  LL+ D+ P +   + SLERYMCSRFFIDF D+ +Q+ KL SYL NHF  + K + +YL  L  VV+ STVCLM HER QTL+LI+
Sbjct:    5 KGNSSDVSSKSRSVLTWEQVSRLNSFLTEVVPIHGR-GNFPTLKITLKDIVQKVRSRLEEAGIKVRDVRLNGSAASHVLVKDNGLGYKDLDLIFGVSLSSEA-EFQLVKDVVIGLLLNFLPEGVNKEKISPLTLKEAYVQKLVKVFTD--ADRWSLISLSNKDGRN--IELKFVTSIRRQFEFSVDSFQIILDSLLFYHDCSENPMSEHFHPTVIGESMYGDFEAAFHHLRNKLISTKNPEEIRGGGLMKYSNLLVRDFKPADKEQIKSLERYMCSRFFIDFSDIFEQQRKLESYLQNHFMGEEKSKYDYLMILRRVVNESTVCLMGHERRQTLNLIS 336          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Xenopus
Match: TENT5D (terminal nucleotidyltransferase 5D [Source:HGNC Symbol;Acc:HGNC:28399])

HSP 1 Score: 259.61 bits (662), Expect = 7.219e-81
Identity = 147/328 (44.82%), Postives = 207/328 (63.11%), Query Frame = 2
Query:  266 RYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILR-----NNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFF-DKGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLIN 1231
            R+  L +DQI  L +VL + I +       PT+ +  K  +  +R+      + ++D+RLNG  AS+++      S  DLD+I  +++  G  E   ++  VL+S+L       N++      + E+Y+ K V+V  S   D WSLISL ++ G N  VELK V ++RR+FEFSVDSFQI LDS+L+ + D   E+    +PTVVAES++G F EA  HL  +LI T  PEEIRGGGLLKY  LL+ D+ P ++ ++ SLERYMCSRFFIDFPDV +Q+ K+ SYL NHF  + K + +YL TL  VV+ STVCLM+HER QTL++I 
Sbjct:   11 RFSNLTWDQIIILDQVLTEVIPIHGR-GNFPTMEVKPKDIIHVVREQLLKKKIIVKDIRLNGSTASHILIKQNGTSCKDLDIIFGVELP-GEQEFQTVKEIVLDSLLDFLPKCVNKEKITALTMKEAYVQKMVKV--STDHDRWSLISLSNNSGKN--VELKFVNSLRRQFEFSVDSFQIILDSILSVYTDDKNELKQDSHPTVVAESMYGDFMEAMEHLRCKLIATRNPEEIRGGGLLKYSNLLVRDFKPASEAEIKSLERYMCSRFFIDFPDVTEQQRKIESYLRNHFIGEEKSKYDYLMTLRSVVNESTVCLMSHERRQTLNMIT 332          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Xenopus
Match: TENT5A (terminal nucleotidyltransferase 5A [Source:NCBI gene;Acc:100490270])

HSP 1 Score: 258.07 bits (658), Expect = 2.566e-80
Identity = 140/325 (43.08%), Postives = 204/325 (62.77%), Query Frame = 2
Query:  275 ILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILR-----NNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYE-ISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLIN 1231
            +L ++Q+ +L  +L + I +       PT+ +     ++ +R   +   +++ D+RLNG AAS+++  D    Y DLDLI   D++ G  E   ++  VL+ +L       N++      + E+Y+ K V+V +    D WSLISL +++G N  VELK + ++RR+FEFSVDSFQIKLDSLL F++     ++  F+PT++ ESV+G F EA  HL  ++I T  PEEIRGGGLLKYC LL+  +   ++ ++ SL+RYMCSRFFIDF D+ +Q+ KL SYL NHF      + +YL TL  VV+ STVCLM HER QTLSLI 
Sbjct:   24 VLSWEQVQRLDAILTETIPIHGR-GNFPTLEMKPSQIVKVVRSRLEEKGIRVRDVRLNGSAASHILHEDSGLGYKDLDLIFCTDLR-GEAEFQTVKDVVLDCLLDFLPEGVNKEKITPLTLKEAYVQKMVKVCND--SDRWSLISLSNNHGKN--VELKFMDSLRRQFEFSVDSFQIKLDSLLLFYECSQNPMTETFHPTIIGESVYGDFQEAFDHLCNKIIATRNPEEIRGGGLLKYCNLLVRGFRAASETEMKSLQRYMCSRFFIDFSDIGEQQRKLESYLQNHFVGLEDRKYDYLMTLHGVVNESTVCLMGHERRQTLSLIT 342          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Mouse
Match: Tent5c (terminal nucleotidyltransferase 5C [Source:MGI Symbol;Acc:MGI:1921895])

HSP 1 Score: 275.018 bits (702), Expect = 5.081e-87
Identity = 154/327 (47.09%), Postives = 209/327 (63.91%), Query Frame = 2
Query:  269 YQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILRNNRQSCHN-KIIP----ESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFD-KGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLIN 1231
            + +L +DQ+ +L EVL + + +       PT+ I LK  +Q +R   +   + ++D+RLNG AA +V+  D      DLDLI  + +     E   +R  VL S+L    +  +  KI P    E+Y+ K V+V      D WSLISL +  G N  VELK V ++RR+FEFSVDSFQI LDSLL F+D  G  IS HF+PTV+ ES++G F EA  HL+ RLI T+ PEEIRGGGLLKY  LL+ D+ P +  ++ +LERYMCSRFFIDFPD+ +Q+ KL +YL NHF D+ + + +YL  L  VV+ STVCLM HER QTL+LI+
Sbjct:   14 FSVLNWDQVSRLHEVLTEVVPIHGR-GNFPTLEITLKDIVQTVRGRLEEAGINVQDVRLNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEA-EFQLVRDVVLCSLLNFLPEGVNKLKISPVTLKEAYVQKLVKV--CTDTDRWSLISLSNKNGRN--VELKFVDSIRRQFEFSVDSFQIILDSLLFFYDCSGNPISEHFHPTVIGESMYGDFEEAFDHLQNRLIATKNPEEIRGGGLLKYSNLLVRDFRPADQEEIKTLERYMCSRFFIDFPDILEQQRKLETYLQNHFSDEERSKYDYLMILRRVVNESTVCLMGHERRQTLNLIS 334          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Mouse
Match: Tent5a (terminal nucleotidyltransferase 5A [Source:MGI Symbol;Acc:MGI:2670964])

HSP 1 Score: 260.381 bits (664), Expect = 6.616e-81
Identity = 143/325 (44.00%), Postives = 207/325 (63.69%), Query Frame = 2
Query:  275 ILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSIL-----RNNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYE-ISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLIN 1231
            +L ++Q+ +L  +L + I +       PT+ +   L ++ +R+  +   + + D+RLNG AAS+V+  D    Y DLDLI   D++ G +E   ++  VL+ +L       N++      + E+Y+ K V+V +    D WSLISL ++ G N  VELK V ++RR+FEFSVDSFQIKLDSLL F++     ++  F+PT++ ESV+G FHEA  HL  ++I T  PEEIRGGGLLKYC LL+  + P ++ ++ +L+RYMCSRFFIDF D+ +Q+ KL SYL NHF      + +YL TL  VV+ STVCLM HER QTL+LI 
Sbjct:   51 VLNWEQVQRLDGILSETIPIHGR-GNFPTLELQPSLIVKVVRRRLEEKGIGVRDVRLNGSAASHVLHQDSGLGYKDLDLIFCADLR-GEEEFQTVKDVVLDCLLDFLPEGVNKEKITPLTLKEAYVQKMVKVCND--SDRWSLISLSNNSGKN--VELKFVDSLRRQFEFSVDSFQIKLDSLLLFYECSENPMTETFHPTIIGESVYGDFHEAFDHLCNKIIATRNPEEIRGGGLLKYCNLLVRGFRPASE-EIKTLQRYMCSRFFIDFSDIGEQQRKLESYLQNHFVGLEDRKYDYLMTLHGVVNESTVCLMGHERRQTLNLIT 368          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Mouse
Match: Tent5a (terminal nucleotidyltransferase 5A [Source:MGI Symbol;Acc:MGI:2670964])

HSP 1 Score: 260.381 bits (664), Expect = 1.214e-80
Identity = 143/325 (44.00%), Postives = 207/325 (63.69%), Query Frame = 2
Query:  275 ILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSIL-----RNNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYE-ISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLIN 1231
            +L ++Q+ +L  +L + I +       PT+ +   L ++ +R+  +   + + D+RLNG AAS+V+  D    Y DLDLI   D++ G +E   ++  VL+ +L       N++      + E+Y+ K V+V +    D WSLISL ++ G N  VELK V ++RR+FEFSVDSFQIKLDSLL F++     ++  F+PT++ ESV+G FHEA  HL  ++I T  PEEIRGGGLLKYC LL+  + P ++ ++ +L+RYMCSRFFIDF D+ +Q+ KL SYL NHF      + +YL TL  VV+ STVCLM HER QTL+LI 
Sbjct:   70 VLNWEQVQRLDGILSETIPIHGR-GNFPTLELQPSLIVKVVRRRLEEKGIGVRDVRLNGSAASHVLHQDSGLGYKDLDLIFCADLR-GEEEFQTVKDVVLDCLLDFLPEGVNKEKITPLTLKEAYVQKMVKVCND--SDRWSLISLSNNSGKN--VELKFVDSLRRQFEFSVDSFQIKLDSLLLFYECSENPMTETFHPTIIGESVYGDFHEAFDHLCNKIIATRNPEEIRGGGLLKYCNLLVRGFRPASE-EIKTLQRYMCSRFFIDFSDIGEQQRKLESYLQNHFVGLEDRKYDYLMTLHGVVNESTVCLMGHERRQTLNLIT 387          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Mouse
Match: Tent5d (terminal nucleotidyltransferase 5D [Source:MGI Symbol;Acc:MGI:2685223])

HSP 1 Score: 253.062 bits (645), Expect = 1.509e-78
Identity = 146/335 (43.58%), Postives = 208/335 (62.09%), Query Frame = 2
Query:  254 ISKNRYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSIL-----RNNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFD----KGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLIN 1231
            +S+ R+  L +D I  L  VL + I +       PT+ +  K  +  ++       + ++D RLNG  ASY++ S    SY DLD+I  +D+ +  +E   ++ AVL+ +         ++    K + E+Y+ K V++ ++   D WSLISL ++ G N  VELK V ++RR+FEFSVDSFQI LDS+L F+     K  + SC   P VVAES++G F EA  HL+ +LI T KPEEIRGGGLLKY  LL+ D+ P    ++ +LERYMCSRFFIDFPDV +Q+ K+ SYL NHF  ++K + +YL TL  VV+ STVCLM +ER QTL++I 
Sbjct:    1 MSEIRFSNLTWDHIVTLDRVLHEVIPIHGR-GNFPTLEVKPKDIIHIVKDQLIKQGIVVKDTRLNGSTASYILASHNGISYKDLDIIFGVDIPSD-EEFHVVKDAVLSCLFDFLPKGVKKEKITLKTMKEAYVQKMVKICNNH--DRWSLISLSNNNGKN--VELKFVNSLRRQFEFSVDSFQILLDSMLDFYSVPNAKLTKESC---PVVVAESMYGDFQEAMIHLKYKLISTRKPEEIRGGGLLKYSNLLVRDFKPACQTEIKTLERYMCSRFFIDFPDVAEQQKKIESYLHNHFIGEAKNKYDYLMTLHGVVNQSTVCLMGYERRQTLNMIT 326          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Mouse
Match: Tent5d (terminal nucleotidyltransferase 5D [Source:MGI Symbol;Acc:MGI:2685223])

HSP 1 Score: 253.062 bits (645), Expect = 1.509e-78
Identity = 146/335 (43.58%), Postives = 208/335 (62.09%), Query Frame = 2
Query:  254 ISKNRYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSIL-----RNNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFD----KGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLIN 1231
            +S+ R+  L +D I  L  VL + I +       PT+ +  K  +  ++       + ++D RLNG  ASY++ S    SY DLD+I  +D+ +  +E   ++ AVL+ +         ++    K + E+Y+ K V++ ++   D WSLISL ++ G N  VELK V ++RR+FEFSVDSFQI LDS+L F+     K  + SC   P VVAES++G F EA  HL+ +LI T KPEEIRGGGLLKY  LL+ D+ P    ++ +LERYMCSRFFIDFPDV +Q+ K+ SYL NHF  ++K + +YL TL  VV+ STVCLM +ER QTL++I 
Sbjct:    1 MSEIRFSNLTWDHIVTLDRVLHEVIPIHGR-GNFPTLEVKPKDIIHIVKDQLIKQGIVVKDTRLNGSTASYILASHNGISYKDLDIIFGVDIPSD-EEFHVVKDAVLSCLFDFLPKGVKKEKITLKTMKEAYVQKMVKICNNH--DRWSLISLSNNNGKN--VELKFVNSLRRQFEFSVDSFQILLDSMLDFYSVPNAKLTKESC---PVVVAESMYGDFQEAMIHLKYKLISTRKPEEIRGGGLLKYSNLLVRDFKPACQTEIKTLERYMCSRFFIDFPDVAEQQKKIESYLHNHFIGEAKNKYDYLMTLHGVVNQSTVCLMGYERRQTLNMIT 326          
BLAST of Terminal nucleotidyltransferase 5C vs. UniProt/SwissProt
Match: sp|Q5XIV0|TET5C_RAT (Terminal nucleotidyltransferase 5C OS=Rattus norvegicus OX=10116 GN=Tent5c PE=2 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 2.267e-86
Identity = 154/327 (47.09%), Postives = 209/327 (63.91%), Query Frame = 2
Query:  269 YQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILRNNRQSCHN-KIIP----ESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFD-KGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLIN 1231
            + +L +DQ+ +L EVL + + +       PT+ I LK  +Q +R   +   +K++D+RLNG AA +V+  D      DLDLI  + +     E   +R  VL S+L    +  +  KI P    E+Y+ K V+V      D WSLISL +  G N  VELK V ++RR+FEFSVDSFQI LDSLL F+D     +S HF+PTVV ES++G F EA  HL+ RLI T+ PEEIRGGGLLKY  LL+ D+ P +  ++ +LERYMCSRFFIDFPD+ +Q+ KL +YL NHF D+ + + +YL  L  VV+ STVCLM HER QTL+LI+
Sbjct:   14 FSVLNWDQVSRLHEVLTEVVPIHGR-GNFPTLEITLKDIVQTVRSRLEEAGIKVQDVRLNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEA-EFQLVRDVVLCSLLNFLPEGVNKLKISPVTLKEAYVQKLVKV--CTDTDRWSLISLSNKNGRN--VELKFVDSIRRQFEFSVDSFQIILDSLLFFYDCSSNPVSEHFHPTVVGESMYGDFEEAFDHLQNRLIATKNPEEIRGGGLLKYSNLLVRDFRPADQEEIKTLERYMCSRFFIDFPDILEQQRKLETYLQNHFADEERSKYDYLMILRRVVNESTVCLMGHERRQTLNLIS 334          
BLAST of Terminal nucleotidyltransferase 5C vs. UniProt/SwissProt
Match: sp|Q5SSF7|TET5C_MOUSE (Terminal nucleotidyltransferase 5C OS=Mus musculus OX=10090 GN=Tent5c PE=1 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 3.554e-86
Identity = 154/327 (47.09%), Postives = 209/327 (63.91%), Query Frame = 2
Query:  269 YQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILRNNRQSCHN-KIIP----ESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFD-KGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLIN 1231
            + +L +DQ+ +L EVL + + +       PT+ I LK  +Q +R   +   + ++D+RLNG AA +V+  D      DLDLI  + +     E   +R  VL S+L    +  +  KI P    E+Y+ K V+V      D WSLISL +  G N  VELK V ++RR+FEFSVDSFQI LDSLL F+D  G  IS HF+PTV+ ES++G F EA  HL+ RLI T+ PEEIRGGGLLKY  LL+ D+ P +  ++ +LERYMCSRFFIDFPD+ +Q+ KL +YL NHF D+ + + +YL  L  VV+ STVCLM HER QTL+LI+
Sbjct:   14 FSVLNWDQVSRLHEVLTEVVPIHGR-GNFPTLEITLKDIVQTVRGRLEEAGINVQDVRLNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEA-EFQLVRDVVLCSLLNFLPEGVNKLKISPVTLKEAYVQKLVKV--CTDTDRWSLISLSNKNGRN--VELKFVDSIRRQFEFSVDSFQIILDSLLFFYDCSGNPISEHFHPTVIGESMYGDFEEAFDHLQNRLIATKNPEEIRGGGLLKYSNLLVRDFRPADQEEIKTLERYMCSRFFIDFPDILEQQRKLETYLQNHFSDEERSKYDYLMILRRVVNESTVCLMGHERRQTLNLIS 334          
BLAST of Terminal nucleotidyltransferase 5C vs. UniProt/SwissProt
Match: sp|Q4R8X4|TET5C_MACFA (Terminal nucleotidyltransferase 5C OS=Macaca fascicularis OX=9541 GN=TENT5C PE=2 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 2.241e-85
Identity = 153/327 (46.79%), Postives = 209/327 (63.91%), Query Frame = 2
Query:  269 YQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILRNNRQSCHN-KIIP----ESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFD-KGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLIN 1231
            + +L +DQ+ +L EVL + + +       PT+ I LK  +Q +R   +   +K++D+RLNG AA +V+  D      DLDLI  + +     E   +R  VL S+L    +  +  KI P    E+Y+ K V+V      D WSLISL +  G N  VELK V ++RR+FEFSVDSFQI LDSLL F+D     IS HF+PTV+ ES++G F EA  HL+ RLI T+ PEEIRGGGLLKY  LL+ D+ P +  ++ +LERYMCSRFFIDFPD+ +Q+ KL +YL NHF ++ + + +YL  L  VV+ STVCLM HER QTL+LI+
Sbjct:   14 FSVLNWDQVSRLHEVLTEVVPIHGR-GNFPTLEITLKDIVQTVRSRLEEAGIKVQDVRLNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEA-EFQLVRDVVLCSLLNFLPEGVNKLKISPVTLKEAYVQKLVKV--CTDTDRWSLISLSNKNGKN--VELKFVDSIRRQFEFSVDSFQIILDSLLFFYDCSNNPISEHFHPTVIGESMYGDFEEAFDHLQNRLIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIETLERYMCSRFFIDFPDILEQQRKLETYLQNHFAEEERSKYDYLMILRRVVNESTVCLMGHERRQTLNLIS 334          
BLAST of Terminal nucleotidyltransferase 5C vs. UniProt/SwissProt
Match: sp|Q5VWP2|TET5C_HUMAN (Terminal nucleotidyltransferase 5C OS=Homo sapiens OX=9606 GN=TENT5C PE=1 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 4.305e-85
Identity = 153/327 (46.79%), Postives = 208/327 (63.61%), Query Frame = 2
Query:  269 YQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILRNNRQSCHN-KIIP----ESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFD-KGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLIN 1231
            + +L +DQ+ +L EVL + + +       PT+ I LK  +Q +R   +   +K+ D+RLNG AA +V+  D      DLDLI  + +     E   +R  VL S+L    +  +  KI P    E+Y+ K V+V      D WSLISL +  G N  VELK V ++RR+FEFSVDSFQI LDSLL F+D     IS HF+PTV+ ES++G F EA  HL+ RLI T+ PEEIRGGGLLKY  LL+ D+ P +  ++ +LERYMCSRFFIDFPD+ +Q+ KL +YL NHF ++ + + +YL  L  VV+ STVCLM HER QTL+LI+
Sbjct:   14 FSVLNWDQVSRLHEVLTEVVPIHGR-GNFPTLEITLKDIVQTVRSRLEEAGIKVHDVRLNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEA-EFQLVRDVVLCSLLNFLPEGVNKLKISPVTLKEAYVQKLVKV--CTDTDRWSLISLSNKNGKN--VELKFVDSIRRQFEFSVDSFQIILDSLLFFYDCSNNPISEHFHPTVIGESMYGDFEEAFDHLQNRLIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIKTLERYMCSRFFIDFPDILEQQRKLETYLQNHFAEEERSKYDYLMILRRVVNESTVCLMGHERRQTLNLIS 334          
BLAST of Terminal nucleotidyltransferase 5C vs. UniProt/SwissProt
Match: sp|Q7ZUP1|TET5C_DANRE (Terminal nucleotidyltransferase 5C OS=Danio rerio OX=7955 GN=tent5c PE=2 SV=1)

HSP 1 Score: 265.388 bits (677), Expect = 1.748e-82
Identity = 145/331 (43.81%), Postives = 214/331 (64.65%), Query Frame = 2
Query:  275 ILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILR-----NNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYE-ISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDV 1249
            +L ++Q+ +L +VL + + +       PT+ + LK  +Q +R   +   + ++D+RLNG  AS+V+  D  +SY DLD+I  +D+    +E   I+  VL+++L       N++      + E+Y+ K V+V      D WSLISL ++ G N  VELK V ++RR+FEFSVDSFQI LDS+L+++D     +S HF+PTVV ES++G F EA  HL  + I T++PEEIRGGGLLKYC LL+ ++ P +  +  +LERYMCSRFFIDFPD+ +Q+ KL +YL +HF  + + + NYL  L  VV+ STVCLM HER QTL+LI+   + V
Sbjct:   17 VLTWEQVSRLNDVLTEAVPVHGR-GNFPTLEVRLKDIVQMVRNRLELRGIMVKDVRLNGSTASHVLVQDIGWSYKDLDVIFRVDLPR-EEEFQLIKDVVLSTLLDFLPEGVNKEKITPMTLKEAYVQKLVKVYTD--QDRWSLISLSNNNGRN--VELKFVDSIRRQFEFSVDSFQIILDSVLSYYDLSENPMSQHFHPTVVGESMYGDFVEALGHLTNKTIATKRPEEIRGGGLLKYCNLLVREFKPTDPDEFKALERYMCSRFFIDFPDIVEQQRKLEAYLQSHFIGEERNKYNYLMILRRVVNESTVCLMGHERRQTLNLISLTAFRV 341          
BLAST of Terminal nucleotidyltransferase 5C vs. TrEMBL
Match: R7TL68 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_128073 PE=4 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 2.545e-101
Identity = 182/412 (44.17%), Postives = 257/412 (62.38%), Query Frame = 2
Query:  263 NRYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSIL--------RNNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFD-KGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDVWNRAQTPLHIE----------------IFNDPEQWALDHVFYGTSCCLSPNHGMLSC---PTSVIHTPSDHSPT 1414
            NRYQ+L Y+Q+ +L EV+E  + +       PT+ I LK  +Q ++       VK++D+RLNGG AS+++G + S  YNDLDLI  L+M + T+++ K+++AVLNS+         R    SC  K   E+Y+ K V+V +    D WSLISL ++ G N  V+LK V  M+R+FEFSVDSFQI LDSLLTF+D     +S HFYPTVVAESV+G+F+ A  HL ++LI T  PEEIRGGGLLKYC LL+ +YAP +++D+ SLERYMCSRFFIDFPD+ +Q+ KL +YL NHF  D +++ +YL TL  VV +ST+CLM HER QTL+LI      +  + +   + +                +++      +D V+YGTS     N+ +  C    TS + +   + PT
Sbjct:    8 NRYQVLCYEQVSRLHEVMEDTVPVHGR-GNFPTLDIQLKQLVQVVQNKLREDGVKVKDIRLNGGCASFILGCEASTCYNDLDLIFGLEMTS-TNDLQKVKTAVLNSLFDFLPDGVSREKMTSCSLK---EAYVQKMVKVCND--ADRWSLISLSNNRGRN--VDLKFVDTMKRQFEFSVDSFQIILDSLLTFYDISQTPMSEHFYPTVVAESVFGNFNVALYHLNKKLIATRNPEEIRGGGLLKYCNLLVREYAPADEVDIKSLERYMCSRFFIDFPDIGQQRVKLENYLANHFIGDDQMKYDYLMTLYSVVDDSTICLMGHERRQTLNLIQQQASHILIQQEQKAYYKQLQMQQFDQQNFSSCPVYDQQSNLIIDQVYYGTS-----NYQLSPCSSGATSPVSSSDQYYPT 405          
BLAST of Terminal nucleotidyltransferase 5C vs. TrEMBL
Match: A0A0B6Y0U5 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF7623 PE=4 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 1.543e-99
Identity = 174/410 (42.44%), Postives = 253/410 (61.71%), Query Frame = 2
Query:  251 KISKNRYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVL--------NSILRNNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFD-KGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDVW----NRAQTP-LHIEIFNDPEQWALDHVFYGTSCCLSPNHGMLSCPTSVIHTPSDHSPTEPTACPAF 1438
            +++ NR+Q+L Y+Q+ +L EV+E  I +       PT+++ LK  +Q ++    A  V++ D+R+NGGAASY++G+  +  +ND+DLI  +D+ N  +E+ KIR+ VL        + I ++   SC    + E+Y+ K V+V +   GD WSLISL  S+   + VELK V  M+R+FEFSVDSFQI LDSLL+F+D     ++ HFYPT+VAES++G F EA  HL+ +LI T  PEEIRGGGLLKYC LL+  Y P N++++ ++ERYMCSRFFIDF D+ +Q  KL +YL+NHF  D  ++  YL TL  VV  ST+CLM HER QTL+LI+ + Y V+     +AQ   + +   +      +D VFYG       ++   + PT         S +    CP F
Sbjct:   12 QVNSNRFQVLCYEQVARLHEVMEDAIPIHGR-GNFPTLKVKLKDLVQVVKDKLTADGVRVRDIRINGGAASYILGTTNAPEFNDVDLIFGVDLSN-QNELQKIRNCVLGCLENFLPSGISKDKINSCS---LKEAYVQKMVKVCNE-HGDRWSLISL--SHKTRKNVELKFVDKMKRQFEFSVDSFQIILDSLLSFYDISEASMTEHFYPTIVAESLYGDFSEAWYHLDNKLIATRNPEEIRGGGLLKYCNLLVRGYTPANEINIRTMERYMCSRFFIDFSDINQQHQKLEAYLVNHFNGDDDMKYEYLTTLYQVVDESTICLMGHERRQTLNLIHQLAYQVYMAQERKAQVKCIELHQLDQLNNLVIDQVFYGPFDTSGSSNQYYNYPTPFSSYHQIGSSSSCPYCPQF 413          
BLAST of Terminal nucleotidyltransferase 5C vs. TrEMBL
Match: A0A2T7P3E6 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_10506 PE=4 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 2.905e-99
Identity = 173/371 (46.63%), Postives = 238/371 (64.15%), Query Frame = 2
Query:  260 KNRYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSIL--------RNNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYE-ISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDVW----NRAQTP-LHIEIFNDPEQWALDHVFYG 1330
            +NR+Q+L YDQ+ +L EV+E  + +       PT+ + L+  +Q ++K   A  V++ D+RLNGGAASY++ S     +NDLDLI  +D+ N  +E+ K+R+ VL  +L        ++   SC  K   E+Y+ K V+V +   GD WSLISL +    N  VELK V  M+R+FEFSVDSFQ+ LDSLLTF+D     +S HFYPTVVAESV+G F EA  HL  ++I T  PEEIRGGGLLKYC LL++ + P +D+D+ ++ERYMCSRFFIDF D+ +Q+ KL SYL NHF  D  ++ +YL TL  VV  ST+CLM HER QTL+LI+ + Y V      +AQ   + +   +      +D VFYG
Sbjct:    7 RNRFQVLCYDQVLRLHEVMEDVVPIHGR-GNFPTLHVKLRELVQVVQKKLVAEGVQVRDVRLNGGAASYILDSASCQEFNDLDLIFGVDLSNH-NELQKVRNCVLECLLDFLPEGVSKDKMSSCSLK---EAYVQKMVKVCNE-HGDRWSLISLSNKTRKN--VELKFVDKMKRQFEFSVDSFQVILDSLLTFYDVSQAPMSEHFYPTVVAESVYGDFSEAWYHLNNKIIATRNPEEIRGGGLLKYCYLLVKSFTPADDIDIRTMERYMCSRFFIDFSDINQQRQKLESYLANHFSGDESMKYHYLMTLYRVVDESTICLMGHERRQTLNLIHQLAYQVLMTQERKAQVKCIELHELDQLNNLVIDQVFYG 369          
BLAST of Terminal nucleotidyltransferase 5C vs. TrEMBL
Match: A0A183MQP9 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS18374 PE=4 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 6.937e-99
Identity = 178/391 (45.52%), Postives = 253/391 (64.71%), Query Frame = 2
Query:  230 TAKGNLKKI-SKNRYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLN---SILRNNR--QSCHNKIIP------ESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDK--GYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPD-DSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDV--------WNRAQTPLHIEIFNDPEQWALDHVFYGT 1333
            + K N  ++ S NR+QIL Y+++ KL  VL + I + S  PG PTI + L    +++R N  A  + I ++RLNGGAASY+IG +    YND+D++IS+D+ + +    K++SAVLN   S L  ++  +      IP      ESY++KQ R + S   D WSL+SLG     ++++E K V  M+R+FEF+VDSFQI LDSLLTF++   G  I+ HFYPT+VAESV GSF EA  HLE +LI T +PE IRGGGLLKYC+LL+  Y P   +DV +LERYM SRFFIDF D+  QK KL ++L NHF + +  +++NYL+ L  VVS ST+CLM+HE +QTL+LI  ++  +        +NR+   L +E F + +   LD +++GT
Sbjct:  141 SPKSNKPEVKSGNRFQILSYERVTKLHYVLSKTIPIHSRYPGFPTIMVKLHDLFREVRGNLKAAGIPIRNIRLNGGAASYIIGQEDYPVYNDIDVLISVDLSSNSSTFQKVKSAVLNALISFLPEDKIIEPFQQHNIPNGFSLRESYVYKQFR-KFSQDDDCWSLLSLGFPSSDSKVIEFKFVDRMKRQFEFTVDSFQIVLDSLLTFYESNSGKSITPHFYPTIVAESVSGSFSEAFYHLENKLIATTEPEMIRGGGLLKYCRLLVSGYKPAEGVDVYTLERYMSSRFFIDFQDLSSQKVKLEAFLANHFAEHEISLKINYLRILYQVVSGSTICLMSHEHFQTLNLIGELLRYLMYYYCYYHFNRSS--LSLEWFAEKQNLVLDKIYFGT 528          
BLAST of Terminal nucleotidyltransferase 5C vs. TrEMBL
Match: A0A210QHP4 (Protein FAM46C OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07927 PE=4 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 7.766e-99
Identity = 183/401 (45.64%), Postives = 254/401 (63.34%), Query Frame = 2
Query:  263 NRYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSIL-----RNNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFD-KGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDVW----NRAQTP-LHIEIFNDPEQWALDHVFYGTSCCLSPNHGMLSCPTSVIHTPSDHSPTEPTACP 1432
            NR+Q L Y+Q+ +L EV+E+ + +       PT+ I LK  +Q +R+      V ++D+RLNGGAASY+ G+D   SYNDLDLI  +D+ N  +E+ KI++ VL  +L       N++   +  + E+Y+ K V+V +   GD WSLISL ++ G N  VELK V  M+R+FEFSVDSFQI LDSLLTF++     +S +FYPTVVAESV+G F EA  HL ++LI T  PEEIRGGGLLKYC LL   Y P  ++D+ ++ERYMCSRFFIDF D+ +Q+ KL SYL NHF  + +++ +YL TL  VV  ST+CLM HER QTL+LI+ + Y V      RA    L I+ F+      +D VF+      SPN+G  +   +++ T S       ++CP
Sbjct:   60 NRFQGLCYEQVVRLHEVMEEVVPIHGR-GNFPTMDIKLKDLVQVVREKLRTDGVSVKDVRLNGGAASYIFGTDNVRSYNDLDLIFGVDLSN-HNELQKIKNCVLGCLLDFLPDGVNKEKMSSCSLKEAYVQKMVKVCNE-HGDRWSLISLSNNKGKN--VELKFVDKMKRQFEFSVDSFQIILDSLLTFYEVSAAPMSENFYPTVVAESVYGDFCEAWYHLNKKLISTRNPEEIRGGGLLKYCNLLTRTYTPVENIDIRAMERYMCSRFFIDFSDLNQQRQKLESYLNNHFSGEEELKHDYLMTLYRVVDESTICLMGHERRQTLNLIHQLAYQVLMDQERRAHIKYLEIQQFDQLNSLTIDQVFFHGP--FSPNNG--NQYFNILPTSSVFQINGSSSCP 451          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Cavefish
Match: tent5c (terminal nucleotidyltransferase 5C [Source:NCBI gene;Acc:103030177])

HSP 1 Score: 270.011 bits (689), Expect = 2.649e-85
Identity = 146/331 (44.11%), Postives = 214/331 (64.65%), Query Frame = 2
Query:  275 ILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILR-----NNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFD-KGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDV 1249
            +L +DQ+ +L EVL + + +       PT+ + LK  +Q +R   +   ++++D+RLNG  AS+V+  D  + Y DLD+I  +D+     +   I+  VL ++L       N++      + E+Y+ K V+V      D WSLISL ++ G N  VELK V ++RR+FEFSVDSFQI LDSLL+++D     +S HF+PTV+ ESV+G F  A  HL+ ++I T++PEEIRGGGLLKYC LL+ D+ P ++ +  +LERYMCSRFFIDFPD+ +Q+ KL +YL +HF  + K + +YL  L  VV+ STVCLM HER QTL+LI+   + V
Sbjct:   15 VLTWDQVSRLNEVLTEAVPVHGR-GNFPTLEVRLKDIVQMVRNRLEQRGIQVKDVRLNGSTASHVLVKDIGWCYKDLDIIFRVDLPQEA-QFQLIKDVVLGTLLDFLPEGVNKEKITPMTLKEAYVQKLVKVYTE--QDRWSLISLSNNNGRN--VELKFVDSIRRQFEFSVDSFQIILDSLLSYYDFSETPMSQHFHPTVLGESVYGDFAVALDHLKNKMIATKRPEEIRGGGLLKYCNLLVRDFRPTDEEEFKALERYMCSRFFIDFPDIGEQQRKLEAYLQSHFVGEEKSKYDYLMILRRVVNESTVCLMGHERRQTLNLISLTAFRV 339          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Cavefish
Match: tent5ab (protein FAM46A-like [Source:NCBI gene;Acc:103042328])

HSP 1 Score: 261.536 bits (667), Expect = 7.661e-82
Identity = 148/346 (42.77%), Postives = 206/346 (59.54%), Query Frame = 2
Query:  230 TAKGNLKKISKNRYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSIL-----RNNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFD-KGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDV 1249
            T +G   + ++    +L ++Q+ +L  +L + I +       PT+ +  +  ++ +R       + + ++RLNG AAS+V+  D    Y DLDLI   D+K G  E   ++  VL+S+L       N++      + E+Y+ K V+V +    D WSLISL ++ G N  VELK V ++RR+FEFSVDSFQI+LDSLL F++     ++  F+P++V ESV+G F EA  HL  RLI T  PEEIRGGGLLKYC LL+  +   +   +  LERYMCSRFFIDFPD  +Q+ KL SYL NHF      +  YL TL  VVS STVCLM HER Q LSLI  +   V
Sbjct:    6 TTEGARAEEARGSLSVLSWEQVQRLDALLAESIPIHGRW-NFPTLHMKPRDIVRVVRARLRERHIDVREVRLNGSAASHVLHEDSGLGYKDLDLIFRADLK-GEREFQTVKEIVLHSLLDFLPAGVNKEKITPLTLKEAYVQKMVKVYND--SDRWSLISLSNNSGKN--VELKFVDSLRRQFEFSVDSFQIRLDSLLLFYECSENPMAETFHPSIVGESVYGDFEEALEHLRHRLICTRNPEEIRGGGLLKYCHLLVRGFRAASPSHMKQLERYMCSRFFIDFPDASEQRRKLESYLQNHFVGLEDRKYEYLSTLHGVVSESTVCLMGHERRQALSLITMLAVRV 345          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Cavefish
Match: tent5ba (protein FAM46A-like [Source:NCBI gene;Acc:103046783])

HSP 1 Score: 256.529 bits (654), Expect = 5.340e-80
Identity = 148/346 (42.77%), Postives = 215/346 (62.14%), Query Frame = 2
Query:  233 AKGNLKKISKNRYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSIL-----RNNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYE--ISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDV 1249
            + G++ + S+ R  +L ++Q+ +L  ++ + + +       PT+ +  +  +Q +R+  +   V + D+RLNG AAS+V+  D    Y DLDLI  + + +       ++  VL+S+L       +++      + E+Y+ K V+V +    D WSLISL ++ G N  VELK V ++RR+FEFSVDSFQI LDSLL  FD+  E  +S  F+PTVV ESV+G F EA SHL  ++I T  PEEIRGGGLLKYC LL+  + P ++ ++ SL+RYMCSRFFIDFPD+ +Q+ KL SYL NHF      R + L  L  VV+ STVCLM HER QTL+LI+ +   V
Sbjct:    2 SPGDVSEQSR-RLCVLSWEQVQRLDSIIGEPVPIHGR-GNFPTLSVQPRQIVQVVRERLEQQGVTVRDVRLNGSAASHVLHQDTGLGYKDLDLIFGVSLSD-DQAFRLVKDVVLDSLLDFLPEGVSKERITALTLKEAYVQKLVKVCND--TDRWSLISLSNNTGKN--VELKFVDSLRRQFEFSVDSFQIGLDSLL-LFDRCSETPMSESFHPTVVGESVYGDFEEAHSHLRDKIISTRNPEEIRGGGLLKYCHLLVRGFQPRSEAEMKSLQRYMCSRFFIDFPDIGEQQRKLESYLQNHFAGMEHKRYDCLVRLYHVVNESTVCLMGHERRQTLNLISTLALRV 339          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Cavefish
Match: tent5bb (protein FAM46A-like [Source:NCBI gene;Acc:103036989])

HSP 1 Score: 255.758 bits (652), Expect = 9.370e-80
Identity = 149/350 (42.57%), Postives = 213/350 (60.86%), Query Frame = 2
Query:  221 MSYTAKGNLKKISKNRYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILR-----NNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYE--ISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDV 1249
            MS  A+G+  ++S+ R+ +L ++Q+ +L  +L + + +       PT+ +  +  +Q +R   +   V + D++LNG AAS+V+  D    Y DLDLI  L + +       ++  VL+S+L       +R+      + E+Y+ K V+V +    D WSLISL ++ G N  VELK V ++RR+FEFSVDSFQI LDSLL  FD+  E  +S  F+PTV+ ES++G F EA  HL  + I T  PEEIRGGGLLKYC LL+  + P ++  + +L+RYMCSRFFIDFPD+ +Q  KL +YL NHF      R   L TL  VV  STVCLM HER QTL+LI+ +   V
Sbjct:    1 MSSAAEGS--ELSR-RFCVLSWEQVQRLDSILGESVPIHGR-GNFPTLSVQPRQIVQVVRARLEERGVAVRDVKLNGSAASHVLHQDTGLGYKDLDLIFGLSLTD-DKTFRLVKDVVLDSLLEFLPVGVSRERISALTLKEAYVQKLVKVCND--TDRWSLISLSNNTGKN--VELKFVDSLRRQFEFSVDSFQIGLDSLL-LFDRCSETPMSESFHPTVLGESMYGDFEEALGHLRSKTIATRSPEEIRGGGLLKYCHLLVRGFRPVSESQIKTLQRYMCSRFFIDFPDIGEQHRKLEAYLQNHFNGIEHKRYECLVTLRRVVDESTVCLMGHERRQTLALISALALRV 340          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Cavefish
Match: tent5d (terminal nucleotidyltransferase 5D [Source:ZFIN;Acc:ZDB-GENE-091118-44])

HSP 1 Score: 246.514 bits (628), Expect = 3.255e-76
Identity = 148/362 (40.88%), Postives = 209/362 (57.73%), Query Frame = 2
Query:  266 RYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILR-----NNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLL-TFFDKGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDVW---NRAQTPLHIEIFNDPEQWALDHVF 1324
            R+  L  +Q+  L +VL + I +       PT+ I  K  +  +R+   +  +K+ D+RLNG  AS+V+  +   SY DLD+I  +++    D    I+  VL  +L       N+       + E+Y+ K V+V      D WSLISL ++ G N  +ELK V ++RR+FEFSVDSFQI LD++L     +  + S      VVAES++G F +A  HL  RLI T  PEEIRGGGLLKY  LL+ D+ P ++ ++ +LERYMCSRFFIDFPDV +Q+ K+ SYL NHF  + K + +YL TL  VV+ STVCLM HER QTL++I  +   V    N      ++  F  P  +  DH F
Sbjct:    9 RFHNLTQEQVETLDQVLTEIIPIHGR-GNFPTLEIKPKDIIHVVRERLVSKSIKVRDVRLNGSTASHVLVKENGTSYKDLDIIFGVELSKQED-FQIIKEVVLGCLLDFLPQGVNKDKITALTMKEAYVQKMVKVFTEH--DRWSLISLSNNSGKN--MELKFVSSLRRQFEFSVDSFQIILDTMLDVATQENGQHSDETLSVVVAESMYGDFEQAMDHLRYRLIATRNPEEIRGGGLLKYSNLLVRDFKPASETEIKTLERYMCSRFFIDFPDVNEQQRKIESYLRNHFIGEEKSKYDYLMTLRRVVNESTVCLMGHERRQTLNMITILALKVLGEQNIIPNTNNVTCFYQPAPYMADHNF 364          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Sea Lamprey
Match: tent5ab (terminal nucleotidyltransferase 5Ab [Source:ZFIN;Acc:ZDB-GENE-071004-35])

HSP 1 Score: 140.584 bits (353), Expect = 2.832e-39
Identity = 82/192 (42.71%), Postives = 118/192 (61.46%), Query Frame = 2
Query:  395 IRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSIL-----RNNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFD-KGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRG 952
            +R   +   + + D+RLNG AAS+V+  D   SY DLDLI  + +  G  E   ++  VL+ +L       +++    + + E+Y+ K V+V +    D WSLISL ++ G N  VELK V ++RR+FEFSVDSFQI LDSLL F++   + +S  F+P+V+ ES++G F EA  HL  RLI T  PEEIRG
Sbjct:   11 VRGRLEERGIAVRDVRLNGSAASHVLHHDSGLSYKDLDLIFGVGL-TGEAEFQLVKEVVLDCLLDFLPEGVSKEKIGPQTLKEAYVQKMVKVCND--TDRWSLISLSNNSGKN--VELKFVDSLRRQFEFSVDSFQIVLDSLLLFYECSEHAMSERFHPSVLGESMYGDFGEALEHLRGRLIATRNPEEIRG 197          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Nematostella
Match: EDO30295 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T168])

HSP 1 Score: 277.33 bits (708), Expect = 7.081e-89
Identity = 153/339 (45.13%), Postives = 218/339 (64.31%), Query Frame = 2
Query:  260 KNRYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSIL--------RNNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYEISC-----HFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNI 1237
            +++ Q+L Y+Q+ +L  VL Q + +       PT+ ++L+  +  +       +++I D+RLNG  ASY++  D + +YND+DLI  +++K+ T  + +I+S VL+S+L        +    SC    + E+Y+ K V+V +    D WSLISL ++ G N  +ELK V  MRR+FEFSVDSFQ+ LDSLL F    Y++SC     +F+PTVVAESV+G    A  HL+ +LI T  PEEIRGGGLLKYC LL+ +Y P N  ++  LERYMCSRFFIDF D+E Q+ KL SYL NHF  ++  + +YL  L  +V+NSTVCLM HER QTL LI+ +
Sbjct:    4 ESKSQVLTYEQVHRLDNVLNQVVQVHGR-GNFPTLDVHLRELINVVSSGLKDENLRIRDIRLNGSTASYILSRDSNTAYNDIDLIFGVEIKSHT-HLQQIKSVVLSSLLNFLPNGVSKEKMSSC---TLKEAYVQKMVKVSND--NDRWSLISLSNNDGKN--IELKFVDTMRRQFEFSVDSFQVNLDSLLGF----YKLSCVPMKPNFFPTVVAESVYGDIKVALFHLDNQLIATRNPEEIRGGGLLKYCNLLVRNYRPENMDELRLLERYMCSRFFIDFGDLESQRQKLESYLANHFIGENDTKYDYLSILYTIVANSTVCLMGHERRQTLRLISTL 329          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Medaka
Match: tent5ab (putative nucleotidyltransferase FAM46A [Source:NCBI gene;Acc:101158158])

HSP 1 Score: 264.233 bits (674), Expect = 9.345e-83
Identity = 155/378 (41.01%), Postives = 225/378 (59.52%), Query Frame = 2
Query:  275 ILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILR-----NNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFD-KGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDVW---NRAQTPLHIEIFNDPEQWALDHVFYGTSCCLSPNHGMLSCPTS 1381
            +L ++Q+ +L  +L   I +       PT+ +  +  ++ +R   +   + + ++RLNG AASYV+  D    + DLDLI   ++K G  E   ++  VL+S+L       N++      + E+Y+ K V+V +    D WSLISL ++ G N  VELK V ++RR+FEFSVDSFQI+LDSLL F++   + ++  F+PT++ ESV+G F  A  HL +RLI T  PEEIRGGGLLKYC LL+  +   +D ++  L+RYMCSRFFIDFPDV +Q+ KL SYL NHF D    + +YL TL  VV  STVCLM HER QTLSLI+++   V    N      ++  F  P  +  D  F  ++  ++    + SCP S
Sbjct:   23 VLNWEQVQRLDTILTSSIPIHGRW-SFPTLEVKPRDIVKVVRSRMEEKRIHVREVRLNGSAASYVLHEDSGLGWKDLDLIFCAELK-GEMEFQIVKELVLDSLLDFFPEGVNKEKITPVTLKEAYVQKMVKVCND--SDRWSLISLSNNRGKN--VELKFVDSLRRQFEFSVDSFQIRLDSLLLFYECSEHSMAATFHPTILGESVYGDFPTALDHLRKRLICTRSPEEIRGGGLLKYCHLLVRGFRAASDTEMKLLQRYMCSRFFIDFPDVNEQRRKLESYLHNHFVDLEDRKYDYLATLYEVVQESTVCLMGHERRQTLSLISSLALRVLAEQNAIPNAANVTCFYQPAPFVSDGNF--SNYYIAQVQPVYSCPPS 392          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Medaka
Match: tent5ba (terminal nucleotidyltransferase 5B [Source:NCBI gene;Acc:101173494])

HSP 1 Score: 256.144 bits (653), Expect = 8.691e-80
Identity = 149/360 (41.39%), Postives = 213/360 (59.17%), Query Frame = 2
Query:  266 RYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSIL-----RNNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYE--ISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDVW---NRAQTPLHIEIFNDPEQWALD 1315
            R+ +L +DQ+ +L  +L + + +       PT+ +  +  +Q +R       + ++D+RLNG AAS+V+       Y DLDLI  + +K+       ++  VL+ +L       +++      + E+Y+ K V+V +    D WSLISL ++ G N  VELK V ++RR+FEFSVDSFQI LDSLL  FD+  E  +S  F+PTV+ ESV+G F EA  HL +R I T  PEEIRGGGLLKYC LL+  + P ++ D+  ++RYMCSRFFIDFPD+ +Q+ KL +YL NHF      R   L TL  VV+ STVCLM HER QTLSLI+ +   V    N   T  ++  +  P  +  D
Sbjct:   10 RFCVLSWDQVRRLDSILAESVPIHGR-GNFPTLSVQPRQIVQVVRARLQERGICVKDVRLNGSAASHVLHQGNGLGYKDLDLIFGVSLKDD-QAFRLVKDVVLDCLLDFLPPGVSKERITALTLKEAYVQKLVKVCND--TDRWSLISLSNNTGKN--VELKFVDSLRRQFEFSVDSFQICLDSLL-LFDRCSETPMSESFHPTVIGESVYGDFSEALDHLCRRTIATRSPEEIRGGGLLKYCHLLVRGFTPSSEADMKQMQRYMCSRFFIDFPDIGEQQRKLEAYLQNHFVGMEHKRYECLMTLHQVVNESTVCLMGHERRQTLSLISMLALKVLAEQNAIPTVTNVTCYYQPAPYVQD 362          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Medaka
Match: TENT5A (terminal nucleotidyltransferase 5A [Source:NCBI gene;Acc:101158475])

HSP 1 Score: 253.062 bits (645), Expect = 1.727e-78
Identity = 144/322 (44.72%), Postives = 202/322 (62.73%), Query Frame = 2
Query:  284 YDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILRNNRQSCHNK--IIP----ESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYE-ISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLI 1228
            +DQ+ +L  +L + I +       PT+++  +  ++ +R   +   + + D+RLNG AAS+++  D    + DLDLI   DMK G  E   ++  VL+ +L +    C NK  I P    E+Y+ K V+V +    D WSLISL ++ G N  VELK V ++RR+FEFSVDSFQIKLDSLL F++     ++  F+PT++ ESV+G   EA  HL  ++I T  PEEIRGGGLLKYC LL+  +   ++ ++ SL+RYMCSRFFIDF D+ +Q+ KL SYL NHF      + +YL TL  VV+ STVCLM HER QTL LI
Sbjct:   29 WDQVQRLDAILTETIPIHGR-GNFPTLQMQPRQIVKVVRSRMEEKRIHVRDVRLNGSAASHILHDDSGLGFKDLDLIFCADMK-GESEFQTVKDIVLDCLL-DFLPDCVNKEKITPLTLKEAYVQKMVKVCND--SDRWSLISLSNNRGKN--VELKFVDSLRRQFEFSVDSFQIKLDSLLLFYECSENPMTETFHPTIMGESVYGDISEALDHLRHKIICTRNPEEIRGGGLLKYCHLLVRGFRAASESEMKSLQRYMCSRFFIDFSDIGEQQRKLESYLQNHFVGLEDRKYDYLMTLHGVVNESTVCLMGHERRQTLGLI 343          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Medaka
Match: TENT5A (terminal nucleotidyltransferase 5A [Source:NCBI gene;Acc:101158475])

HSP 1 Score: 253.062 bits (645), Expect = 1.727e-78
Identity = 144/322 (44.72%), Postives = 202/322 (62.73%), Query Frame = 2
Query:  284 YDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILRNNRQSCHNK--IIP----ESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYE-ISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLI 1228
            +DQ+ +L  +L + I +       PT+++  +  ++ +R   +   + + D+RLNG AAS+++  D    + DLDLI   DMK G  E   ++  VL+ +L +    C NK  I P    E+Y+ K V+V +    D WSLISL ++ G N  VELK V ++RR+FEFSVDSFQIKLDSLL F++     ++  F+PT++ ESV+G   EA  HL  ++I T  PEEIRGGGLLKYC LL+  +   ++ ++ SL+RYMCSRFFIDF D+ +Q+ KL SYL NHF      + +YL TL  VV+ STVCLM HER QTL LI
Sbjct:   29 WDQVQRLDAILTETIPIHGR-GNFPTLQMQPRQIVKVVRSRMEEKRIHVRDVRLNGSAASHILHDDSGLGFKDLDLIFCADMK-GESEFQTVKDIVLDCLL-DFLPDCVNKEKITPLTLKEAYVQKMVKVCND--SDRWSLISLSNNRGKN--VELKFVDSLRRQFEFSVDSFQIKLDSLLLFYECSENPMTETFHPTIMGESVYGDISEALDHLRHKIICTRNPEEIRGGGLLKYCHLLVRGFRAASESEMKSLQRYMCSRFFIDFSDIGEQQRKLESYLQNHFVGLEDRKYDYLMTLHGVVNESTVCLMGHERRQTLGLI 343          
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Medaka
Match: tent5bb (putative nucleotidyltransferase FAM46A [Source:NCBI gene;Acc:101172962])

HSP 1 Score: 253.062 bits (645), Expect = 1.874e-78
Identity = 146/335 (43.58%), Postives = 201/335 (60.00%), Query Frame = 2
Query:  266 RYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILRNNRQS-CHNKI----IPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYE--ISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDV 1249
            R  +L +DQ+ +L  +L + + +       PT+ +  +  +Q +    +   V + D+RLNG AAS+V+  D    Y DLDLI  L + +       I+  VL+ ++    +  C  +I    + E+Y+ K V+V +    D WSLISL ++ G N  VELK V +MRR+FEFSVDSFQI LDSLL  FD+  E  +S  F+PTV  ES++G F EA  HL  + I T  PEEIRGGGLLKYC LL+  + P ++  +  ++RYMCSRFFIDFPD+ +Q+ KL +YL NHF      R  YL TL  VV  STVCLM HER QTL+LI+ +   V
Sbjct:   26 RLSVLSWDQVRRLDSILGESVPIHGR-GNFPTLSVQPRQIVQVVMARLEEEGVVVRDVRLNGSAASHVLHQDNGLGYKDLDLIFGLSLTDD-KTFRLIKDVVLDCLVDFLPEGVCRERITALALKEAYVQKLVKVCND--TDRWSLISLSNNTGKN--VELKFVDSMRRQFEFSVDSFQITLDSLL-LFDRCSETAMSETFHPTVQGESMYGDFQEALHHLRSKTIATRSPEEIRGGGLLKYCHLLVRGFHPSSESQMKQMQRYMCSRFFIDFPDINEQQRKLEAYLQNHFAGIEHKRYEYLVTLRRVVDESTVCLMGHERRQTLALISALAIRV 353          
BLAST of Terminal nucleotidyltransferase 5C vs. Planmine SMEST
Match: SMESG000041951.1 (SMESG000041951.1)

HSP 1 Score: 848.581 bits (2191), Expect = 0.000e+0
Identity = 407/408 (99.75%), Postives = 408/408 (100.00%), Query Frame = 2
Query:  221 MSYTAKGNLKKISKNRYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILRNNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDVWNRAQTPLHIEIFNDPEQWALDHVFYGTSCCLSPNHGMLSCPTSVIHTPSDHSPTEPTACPAFSE 1444
            MSYTAKGNLKKISKNRYQILPYDQICKLQEVLEQK+SLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILRNNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDVWNRAQTPLHIEIFNDPEQWALDHVFYGTSCCLSPNHGMLSCPTSVIHTPSDHSPTEPTACPAFSE
Sbjct:    1 MSYTAKGNLKKISKNRYQILPYDQICKLQEVLEQKVSLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILRNNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDVWNRAQTPLHIEIFNDPEQWALDHVFYGTSCCLSPNHGMLSCPTSVIHTPSDHSPTEPTACPAFSE 408          
BLAST of Terminal nucleotidyltransferase 5C vs. Planmine SMEST
Match: SMESG000078143.1 (SMESG000078143.1)

HSP 1 Score: 273.478 bits (698), Expect = 1.549e-86
Identity = 146/365 (40.00%), Postives = 230/365 (63.01%), Query Frame = 2
Query:  248 KKISKNRYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAVLNSILRNNRQSCH---NKIIPESYIHKQVRVQDSFSGDFWSLISLGS-SYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDVWNRAQTPLHIEIFNDPEQWALDHVFYG 1330
            ++ SKN+ QI+ Y+QI KL ++L   + ++  I    ++ + L   + ++++  +  D+ I+D+RL GGAAS+VI  +  F YND+D++ S+D     D M KIRS+V ++I     +S H   + + PE YI KQV +Q   + D+WSL SLG  +   N IVELK   +  R++E SVDSFQI LD  L F  +   ++   YP VV ES WGS  +A  HL  + I+ E PE+IRGGGLLKYCKLL+  + PH DLD  S+++YMCSRFFIDFP +  Q  K++SY+ NHF  + ++ +++L  L  +V+NS+V  ++ +R +++ LIN++I  +W  +   + +  F+D ++W++  + YG
Sbjct:    5 RRGSKNQLQIMKYEQIVKLFKLLNDDLIISCEIDSEQSLVLTLTEIIIEMKEVLEKEDISIKDIRLIGGAASHVIAYNHDFPYNDIDVVFSIDSCTNLDVMNKIRSSVFSAIGNLISKSDHLQQSDLYPERYIKKQVCIQSPKAKDYWSLFSLGCVTNNNNNIVELKFASSTERQYECSVDSFQIVLDPALHFILQHNTVARCLYPIVVVESTWGSIKDALQHLYNKHIVLEYPEQIRGGGLLKYCKLLVNGFQPHPDLDENSVKKYMCSRFFIDFPFLTNQHAKIVSYMTNHFQPNHELYISFLNHLADIVANSSV-YIDIDRLRSVFLINSLIQQIWTESLPKISLVQFDDRKKWSVGEIVYG 368          
BLAST of Terminal nucleotidyltransferase 5C vs. Planmine SMEST
Match: SMESG000016756.1 (SMESG000016756.1)

HSP 1 Score: 270.011 bits (689), Expect = 1.081e-83
Identity = 154/391 (39.39%), Postives = 241/391 (61.64%), Query Frame = 2
Query:  224 SYTAKGNLKKISKNRYQILPYDQICKLQEVLEQKISLAS-NIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLDMKNGTDEMPKIRSAV-------LNSILRNNRQSC-HN-----KIIPESYIHKQVRV---QDSFSGDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFF--DKGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFPDDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDVWNRAQTPLHIEIFND--PEQWALDHVFYGT 1333
            S +    +  +  NR+Q+L Y+Q+ +L  V+E+ + L   +   LP I ++L+  L +I++    +DV I+D+RL+G AA  ++  + +  + +L++I ++ + + T  M KI++ +       L   L +  +S  HN     ++I ++YI K  RV   Q+S S D WSLISLG+   GN  VELK +  M+R++EF++DSFQI LD++L F+   K   I+ + +PTVVAESV GSF EA  HL++ +I T+ PEEI GGGLLKYC LL   +  ++ +D+ + E+YMCSRFFID+PD+  Q+ KL S+L +    + +I++N L  L  VVS+STVCLM HER QTL +IN++  ++ +  +        +D   + W LD VFYGT
Sbjct:   51 SSSTVSKIDSVGPNRFQVLSYEQVKRLHRVIEKPLKLKPVSHSVLPVIEVSLRALLGEIKRKLKEVDVVIKDVRLDGTAAGCILNLNPNDDFRELNVIFTVSLHDMTS-MQKIKNTIFSLLIDLLKKTLNSKPESLKHNFLINEELIKDNYIQKMTRVLCNQESNS-DCWSLISLGTLEIGNETVELKFIDKMKRQYEFTIDSFQIVLDTMLAFYTVSKCSSITPNLFPTVVAESVSGSFQEAFKHLKENIISTKNPEEILGGGLLKYCGLLAVGFQQNSAMDIRATEKYMCSRFFIDYPDINVQRQKLESFLDSLVDSNYEIKINLLNVLYEVVSHSTVCLMTHERRQTLQMINSLSQNILSEIEIKKSTVQLDDLSSQNWVLDQVFYGT 439          
BLAST of Terminal nucleotidyltransferase 5C vs. Planmine SMEST
Match: SMESG000003588.1 (SMESG000003588.1)

HSP 1 Score: 251.136 bits (640), Expect = 1.042e-77
Identity = 160/427 (37.47%), Postives = 240/427 (56.21%), Query Frame = 2
Query:  221 MSYTAKGNLKKISKNRYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLD----------MKNGTDEMPKIRSAVLNSILRNNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSS--YG-GNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYEISC-------HFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFP-DDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNI------IYDVWNRAQTPLHIEIFNDPEQWALDHVFYGTSCCLSP-NHGMLSCPTSVIHTPSDHSPTE 1417
            M  TA       S+++  +L Y Q+ +L  +L +   +  +   LP I + +K F+  ++   +     + D+RLNGG A+ V+   Q + YND+D++I LD            +    + ++ S +L  +L     +  ++ +  SYIHK VR+Q+S +GD WSL+ LG+S  +G  +R ++LK  + M+R+FEFS+DSFQI LDSLL F++     S        +FYPTV   S W +  +A +HL  R I+T +PE IRGGGLLKYCKLL+++++  +   V  LERYMCSRFFID+ D++ Q   + SYL NHF  DDS+    +L+TL+ V+S+S++CLMN ER QTL LI+ I      +YD      +    E       W++D V Y     LS   +   S  +S   TPSD SP E
Sbjct:    1 MMMTATDCRSSDSESKNSVLKYSQVRRLDAILNETFVICGD-SRLPIICVTIKDFILAVKHKLEDYQFPMVDIRLNGGGAAAVLDPLQLYKYNDIDILIILDGSHMDNDDIYFNDTIKAVLEVISDLLQPMLEPTASAFKSQKL--SYIHKLVRIQNSNNGDSWSLLGLGASGRFGYRSRRIDLKFTHRMKRQFEFSIDSFQIVLDSLLIFYEAVRRFSSSVVCTNKNFYPTVSVISKWPNLSDALNHLGNRYIITSQPEHIRGGGLLKYCKLLVQNFSVPDLSKVAKLERYMCSRFFIDYIDLKSQHKAIFSYLQNHFQLDDSQ---PFLETLKRVISDSSICLMNQERQQTLYLIDQIAMEISSLYDAHPNEGSGTEFE-------WSIDKVTYADQVDLSTCKYRSYSTISSQWSTPSDMSPIE 414          
BLAST of Terminal nucleotidyltransferase 5C vs. Planmine SMEST
Match: SMESG000003588.1 (SMESG000003588.1)

HSP 1 Score: 249.98 bits (637), Expect = 2.140e-77
Identity = 157/415 (37.83%), Postives = 237/415 (57.11%), Query Frame = 2
Query:  257 SKNRYQILPYDQICKLQEVLEQKISLASNIPGLPTIRINLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIISLD----------MKNGTDEMPKIRSAVLNSILRNNRQSCHNKIIPESYIHKQVRVQDSFSGDFWSLISLGSS--YG-GNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFDKGYEISC-------HFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKYCKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFP-DDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNI------IYDVWNRAQTPLHIEIFNDPEQWALDHVFYGTSCCLSP-NHGMLSCPTSVIHTPSDHSPTE 1417
            S+++  +L Y Q+ +L  +L +   +  +   LP I + +K F+  ++   +     + D+RLNGG A+ V+   Q + YND+D++I LD            +    + ++ S +L  +L     +  ++ +  SYIHK VR+Q+S +GD WSL+ LG+S  +G  +R ++LK  + M+R+FEFS+DSFQI LDSLL F++     S        +FYPTV   S W +  +A +HL  R I+T +PE IRGGGLLKYCKLL+++++  +   V  LERYMCSRFFID+ D++ Q   + SYL NHF  DDS+    +L+TL+ V+S+S++CLMN ER QTL LI+ I      +YD      +    E       W++D V Y     LS   +   S  +S   TPSD SP E
Sbjct:   11 SESKNSVLKYSQVRRLDAILNETFVICGD-SRLPIICVTIKDFILAVKHKLEDYQFPMVDIRLNGGGAAAVLDPLQLYKYNDIDILIILDGSHMDNDDIYFNDTIKAVLEVISDLLQPMLEPTASAFKSQKL--SYIHKLVRIQNSNNGDSWSLLGLGASGRFGYRSRRIDLKFTHRMKRQFEFSIDSFQIVLDSLLIFYEAVRRFSSSVVCTNKNFYPTVSVISKWPNLSDALNHLGNRYIITSQPEHIRGGGLLKYCKLLVQNFSVPDLSKVAKLERYMCSRFFIDYIDLKSQHKAIFSYLQNHFQLDDSQ---PFLETLKRVISDSSICLMNQERQQTLYLIDQIAMEISSLYDAHPNEGSGTEFE-------WSIDKVTYADQVDLSTCKYRSYSTISSQWSTPSDMSPIE 412          
The following BLAST results are available for this feature:
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TENT5C8.964e-8646.79terminal nucleotidyltransferase 5C [Source:HGNC Sy... [more]
TENT5D2.172e-8142.60terminal nucleotidyltransferase 5D [Source:HGNC Sy... [more]
TENT5D2.172e-8142.60terminal nucleotidyltransferase 5D [Source:HGNC Sy... [more]
TENT5A4.580e-7944.00terminal nucleotidyltransferase 5A [Source:HGNC Sy... [more]
TENT5A9.734e-7944.00terminal nucleotidyltransferase 5A [Source:HGNC Sy... [more]
back to top
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pqn-449.318e-6737.96Prion-like-(Q/N-rich)-domain-bearing protein [Sou... [more]
pqn-449.318e-6737.96Prion-like-(Q/N-rich)-domain-bearing protein [Sou... [more]
pqn-441.296e-6637.96Prion-like-(Q/N-rich)-domain-bearing protein [Sou... [more]
pqn-441.404e-6637.96Prion-like-(Q/N-rich)-domain-bearing protein [Sou... [more]
pqn-441.469e-6638.22Prion-like-(Q/N-rich)-domain-bearing protein [Sou... [more]
back to top
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG463851.437e-8845.48gene:FBgn0286778 transcript:FBtr0474227[more]
CG463851.437e-8845.48gene:FBgn0286778 transcript:FBtr0474226[more]
CG463854.451e-8845.48gene:FBgn0286778 transcript:FBtr0474225[more]
CG463852.198e-8645.48gene:FBgn0286778 transcript:FBtr0474229[more]
CG463851.514e-8546.49gene:FBgn0286778 transcript:FBtr0474224[more]
back to top
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tent5c6.015e-8344.31terminal nucleotidyltransferase 5C [Source:NCBI ge... [more]
TENT5A2.170e-7942.94terminal nucleotidyltransferase 5Aa [Source:NCBI g... [more]
tent5ab5.730e-7943.77terminal nucleotidyltransferase 5Ab [Source:ZFIN;A... [more]
tent5ab5.730e-7943.77terminal nucleotidyltransferase 5Ab [Source:ZFIN;A... [more]
tent5bb4.288e-7842.99terminal nucleotidyltransferase 5Bb [Source:ZFIN;A... [more]
back to top
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tent5b6.225e-8341.95terminal nucleotidyltransferase 5B [Source:NCBI ge... [more]
ttk1.258e-8143.49TTK protein kinase [Source:Xenbase;Acc:XB-GENE-953... [more]
TENT5D7.219e-8144.82terminal nucleotidyltransferase 5D [Source:HGNC Sy... [more]
TENT5A2.566e-8043.08terminal nucleotidyltransferase 5A [Source:NCBI ge... [more]
back to top
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tent5c5.081e-8747.09terminal nucleotidyltransferase 5C [Source:MGI Sym... [more]
Tent5a6.616e-8144.00terminal nucleotidyltransferase 5A [Source:MGI Sym... [more]
Tent5a1.214e-8044.00terminal nucleotidyltransferase 5A [Source:MGI Sym... [more]
Tent5d1.509e-7843.58terminal nucleotidyltransferase 5D [Source:MGI Sym... [more]
Tent5d1.509e-7843.58terminal nucleotidyltransferase 5D [Source:MGI Sym... [more]
back to top
BLAST of Terminal nucleotidyltransferase 5C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5XIV0|TET5C_RAT2.267e-8647.09Terminal nucleotidyltransferase 5C OS=Rattus norve... [more]
sp|Q5SSF7|TET5C_MOUSE3.554e-8647.09Terminal nucleotidyltransferase 5C OS=Mus musculus... [more]
sp|Q4R8X4|TET5C_MACFA2.241e-8546.79Terminal nucleotidyltransferase 5C OS=Macaca fasci... [more]
sp|Q5VWP2|TET5C_HUMAN4.305e-8546.79Terminal nucleotidyltransferase 5C OS=Homo sapiens... [more]
sp|Q7ZUP1|TET5C_DANRE1.748e-8243.81Terminal nucleotidyltransferase 5C OS=Danio rerio ... [more]
back to top
BLAST of Terminal nucleotidyltransferase 5C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7TL682.545e-10144.17Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A0B6Y0U51.543e-9942.44Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A2T7P3E62.905e-9946.63Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A183MQP96.937e-9945.52Uncharacterized protein OS=Schistosoma margrebowie... [more]
A0A210QHP47.766e-9945.64Protein FAM46C OS=Mizuhopecten yessoensis OX=6573 ... [more]
back to top
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tent5c2.649e-8544.11terminal nucleotidyltransferase 5C [Source:NCBI ge... [more]
tent5ab7.661e-8242.77protein FAM46A-like [Source:NCBI gene;Acc:10304232... [more]
tent5ba5.340e-8042.77protein FAM46A-like [Source:NCBI gene;Acc:10304678... [more]
tent5bb9.370e-8042.57protein FAM46A-like [Source:NCBI gene;Acc:10303698... [more]
tent5d3.255e-7640.88terminal nucleotidyltransferase 5D [Source:ZFIN;Ac... [more]
back to top
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tent5ab2.832e-3942.71terminal nucleotidyltransferase 5Ab [Source:ZFIN;A... [more]
back to top
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO302957.081e-8945.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Terminal nucleotidyltransferase 5C vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tent5ab9.345e-8341.01putative nucleotidyltransferase FAM46A [Source:NCB... [more]
tent5ba8.691e-8041.39terminal nucleotidyltransferase 5B [Source:NCBI ge... [more]
TENT5A1.727e-7844.72terminal nucleotidyltransferase 5A [Source:NCBI ge... [more]
TENT5A1.727e-7844.72terminal nucleotidyltransferase 5A [Source:NCBI ge... [more]
tent5bb1.874e-7843.58putative nucleotidyltransferase FAM46A [Source:NCB... [more]
back to top
BLAST of Terminal nucleotidyltransferase 5C vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041951.10.000e+099.75SMESG000041951.1[more]
SMESG000078143.11.549e-8640.00SMESG000078143.1[more]
SMESG000016756.11.081e-8339.39SMESG000016756.1[more]
SMESG000003588.11.042e-7737.47SMESG000003588.1[more]
SMESG000003588.12.140e-7737.83SMESG000003588.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020310 ID=SMED30020310|Name=Terminal nucleotidyltransferase 5C|organism=Schmidtea mediterranea sexual|type=transcript|length=1616bp
AGGATTCAGTATTTCAGCACACATTCACATTGTCCATATGAAATCAAGGC
AGGCAGCGAACAAAGGGAAAGAAAATATTGACTAATTGAGAACAACCAAT
CAGCATCAACTGTAATATCTATTAATGAGGAATGAATCTTTTTATATCAC
TTTATTTCTCCCACTGAATCTATTTGCCTTCCTCAGAACTGTTTTTTTAT
TTCTATAACGTTTCAAGATTATGTCGTATACTGCTAAAGGAAATTTGAAA
AAAATATCAAAGAATCGCTATCAAATTCTCCCATATGATCAGATTTGCAA
ATTACAAGAAGTACTTGAGCAAAAAATATCCCTCGCAAGCAATATTCCTG
GATTACCTACTATTCGAATAAATCTTAAGCTATTTCTCCAACAAATTAGA
AAAAACTTCGATGCTTTGGATGTTAAAATTGAGGATATGCGATTAAATGG
AGGCGCTGCTTCATATGTTATCGGTTCTGATCAATCGTTTTCCTACAATG
ATCTCGATTTAATTATATCTTTGGATATGAAAAATGGAACAGATGAAATG
CCAAAAATCAGATCGGCGGTGTTAAACTCAATTTTGAGAAACAACCGACA
GTCATGTCACAATAAAATCATTCCAGAAAGTTATATCCATAAACAGGTTC
GTGTTCAAGATTCATTTAGCGGAGACTTTTGGTCACTGATCTCTCTAGGA
AGTAGTTATGGAGGAAACAGAATTGTTGAATTGAAATTAGTCTATAATAT
GCGCAGGAAGTTTGAATTTTCAGTGGATTCATTCCAAATCAAATTAGACA
GTTTGTTGACTTTCTTTGACAAAGGTTACGAAATCAGTTGCCACTTTTAT
CCAACTGTCGTTGCAGAATCTGTTTGGGGAAGTTTCCATGAAGCAAAATC
TCATCTTGAGCAAAGACTGATTATGACTGAGAAACCGGAAGAAATTAGAG
GTGGCGGATTATTAAAATATTGCAAACTTCTTATTGAAGATTATGCTCCC
CATAATGATCTCGACGTGGTTTCCCTTGAAAGGTACATGTGTTCAAGGTT
CTTTATTGATTTTCCCGATGTAGAGAAACAAAAGCACAAATTACTATCCT
ATTTAATTAATCACTTTCCAGATGATAGTAAAATTCGAGTCAATTACTTG
CAAACCTTGGAAGTTGTCGTATCCAATTCCACAGTTTGTCTCATGAATCA
TGAAAGATATCAAACTTTATCACTTATCAATAATATCATTTATGACGTTT
GGAATCGAGCCCAAACTCCGCTACATATAGAAATTTTTAATGACCCTGAA
CAGTGGGCATTAGATCATGTATTTTATGGTACATCTTGTTGTTTGAGTCC
CAATCACGGGATGCTATCGTGTCCAACTTCGGTAATTCATACTCCAAGTG
ACCATAGTCCCACTGAGCCCACTGCTTGTCCGGCGTTTTCGGAATAAATA
TCCATTAATTATAAATATTTATATCAAAGTATTTTCTTGTAAATTTTGTA
TCAATATTGTCTATAAGTTGTGGTTTCTGTGTTCCATTTGTGATATGTTC
ATTATTTTTGTTATTCAGATATATTACACTAATAAGCTGTATAAAATGAT
TTATATTCCTTAAAAT
back to top

protein sequence of SMED30020310-orf-1

>SMED30020310-orf-1 ID=SMED30020310-orf-1|Name=SMED30020310-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=409bp
MSYTAKGNLKKISKNRYQILPYDQICKLQEVLEQKISLASNIPGLPTIRI
NLKLFLQQIRKNFDALDVKIEDMRLNGGAASYVIGSDQSFSYNDLDLIIS
LDMKNGTDEMPKIRSAVLNSILRNNRQSCHNKIIPESYIHKQVRVQDSFS
GDFWSLISLGSSYGGNRIVELKLVYNMRRKFEFSVDSFQIKLDSLLTFFD
KGYEISCHFYPTVVAESVWGSFHEAKSHLEQRLIMTEKPEEIRGGGLLKY
CKLLIEDYAPHNDLDVVSLERYMCSRFFIDFPDVEKQKHKLLSYLINHFP
DDSKIRVNYLQTLEVVVSNSTVCLMNHERYQTLSLINNIIYDVWNRAQTP
LHIEIFNDPEQWALDHVFYGTSCCLSPNHGMLSCPTSVIHTPSDHSPTEP
TACPAFSE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0004652polynucleotide adenylyltransferase activity
GO:0016740transferase activity
GO:0016779nucleotidyltransferase activity
GO:1990817RNA adenylyltransferase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0048255mRNA stabilization
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR012937TET5
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 56..76
NoneNo IPR availablePANTHERPTHR12974:SF36PRION-LIKE-(Q/N-RICH)-DOMAIN-BEARING PROTEINcoord: 10..349
IPR012937Terminal nucleotidyltransferaseSMARTSM01153DUF1693_2coord: 20..339
e-value: 2.6E-128
score: 442.2
IPR012937Terminal nucleotidyltransferasePFAMPF07984NTP_transf_7coord: 20..338
e-value: 2.7E-114
score: 381.7
IPR012937Terminal nucleotidyltransferasePANTHERPTHR12974PRION-LIKE- Q/N-RICH -DOMAIN-BEARING PROTEIN PROTEIN 44coord: 10..349