Vitellogenin domain-containing protein

Overview
NameVitellogenin domain-containing protein
Smed IDSMED30020296
Length (bp)17504
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Vitellogenin domain-containing protein (SMED30020296) t-SNE clustered cells

Violin plots show distribution of expression levels for Vitellogenin domain-containing protein (SMED30020296) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Vitellogenin domain-containing protein (SMED30020296) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Vitellogenin domain-containing protein (SMED30020296) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020296

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 43

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30020296SMESG000037978.1 PL06019B1E01ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30020296SMESG000037978.1 PL06019B1E01ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
prepharyngeal regionSMED30020296SMESG000037977.1 SmedASXL_004546SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30020296SMESG000037977.1 SmedASXL_019221SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30020296SMESG000037977.1 SmedASXL_007715SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30020296SMESG000037977.1 SmedASXL_000426SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30020296SMESG000037978.1 SMESG000037977.1 SmedASXL_018149SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30020296SMESG000037977.1 SmedASXL_000529SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30020296SMESG000037977.1 SmedASXL_004547SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30020296SMESG000037977.1 SmedASXL_000591SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30020296SMESG000037977.1 SmedASXL_000483SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30020296SMESG000037977.1 SmedASXL_002334SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
gutSMED30020296SMESG000037978.1 SMESG000037977.1 dd_Smed_v4_194_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020296SMESG000037978.1 SMESG000037977.1 dd_Smed_v4_194_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020296SMESG000037978.1 SMESG000037977.1 dd_Smed_v4_194_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020296SMESG000037978.1 SMESG000037977.1 dd_Smed_v4_194_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020296SMESG000037978.1 SMESG000037977.1 dd_Smed_v4_194_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020296SMESG000037978.1 SMESG000037977.1 Contig38414uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020296SMESG000037978.1 SMESG000037977.1 Contig38414newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020296SMESG000037978.1 Contig45267uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020296SMESG000037978.1 Contig45267newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020296SMESG000037978.1 SMESG000037977.1 Contig34774uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020296SMESG000037978.1 SMESG000037977.1 Contig34774newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020296SMESG000037978.1 SMESG000037977.1 Contig3822uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020296SMESG000037978.1 SMESG000037977.1 Contig3822newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020296SMESG000037978.1 SMESG000037977.1 Contig41946uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020296SMESG000037978.1 SMESG000037977.1 Contig41946newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020296SMESG000037978.1 SMESG000037977.1 Contig34775uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020296SMESG000037978.1 SMESG000037977.1 Contig34775newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020296SMESG000072161.1 SMESG000072160.1 Contig4608GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020296SMESG000022917.1 Contig3822uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020296SMESG000022917.1 Contig3822newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020296SMESG000037977.1 Contig4608GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30020296SMESG000037978.1 SMESG000037977.1 Contig38414uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30020296SMESG000037978.1 SMESG000037977.1 Contig38414newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30020296SMESG000037978.1 Contig54872uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30020296SMESG000037978.1 Contig54872newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30020296SMESG000037978.1 SMESG000037977.1 dd_Smed_v6_194_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
phagocytic cellSMED30020296SMESG000037978.1 SMESG000037977.1 dd_Smed_v6_194_0dd_Smed_v6PMID:29674432
Plass et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
reproductive organSMED30020296SMESG000037978.1 Contig54872uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30020296SMESG000037978.1 Contig54872newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
gutSMED30020296SMESG000037978.1 SMESG000037977.1 dd_Smed_v4_194_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
early male germ cellSMED30020296SMESG000037977.1 Contig4608_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Vitellogenin domain-containing protein vs. Ensembl Human
Match: AC099489.1 (novel lipoprotein amino terminal region containing protein)

HSP 1 Score: 263.462 bits (672), Expect = 6.239e-69
Identity = 225/959 (23.46%), Postives = 400/959 (41.71%), Query Frame = 2
Query:  383 SYKFKSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTS-HGKCFITSSEKSPKEETNPNSVNFQYDLQTCDNKMISNSLFGDITRSVIFK-TSQVSCKYLYKDQSNLVSIRCREEYKTATIKTNENQMVVEITTNIYKENQLPSPDRTFTNKNMFETGXXXXXXXXXXXXSPYSA----AKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQDRSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTF--LTNNYGVNFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYLKKEKG-----------------------------------AQENLELINILNEMSGSVNIKLFGNQVSFIELIRGTLSSVKKY--NIIEEIMYWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLVSWPISVNIDNYISPNINAELHTEIVYQTPFTNYGMRMKLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFSVEGNAYVIHRDK-EIIQLQDKLKEIKMCTSEMTVRILGIRVCGEAKVLDPSTRKDALLFGPFAANVFIEKIDTQTEYILLATSKTSAFISQTGKVYSNRHIKFEF-NTPNSKFYNRRFYGEILMDFKQKEFKLELVTP 3118
            S    + L  N + F   S  V  +C    EP W  N+K+A+L  L        P ++ +    G+C  T            + ++   DL  C  +   +SL       V    TS+++C   ++    L    C E      +    + + +   +++   +++P         +  +  +  +    E EE+P  A    A T ++ +C+   +S  +    LF+ LV+ L+ L+  E  EL+   Q S     K  +      DA     T   + +M +LI ++ +   +   WL+SL+F+ + P+   +  L  ++     S   FL + +L H  C      C   P + S+V      L  +C+I + + DD   K+Q+ LK +GN       +  TL+ C +  ++   IR+ A++  + + C  DRS    +  + E D+E+RINAYL +M C       +VR   + E   QVGSF+W+H+  + E++D LK  +RD L +  L +EF     K S   + TF  ++ + G N +  ++FS  SF+PRS ++N T     ++ N LE+  RLE  E++  ++FG + +  +E G                                    Q+          +   +++KL G ++SF+     T S V  +  N+ E  +   + + +  N+ L L  + +V PT+ G P +  L  SAAI+I+++   D           +++ Y+ P+   ++  ++         G+R      +       I   K   L V  ++P+    + S     Y+I RD    ++      E++ CT E      G R+C    V  P   +  LL  P  A V ++K D      LL  + T     Q G  +        F  TP S+   R    ++     Q +F+L+L+ P
Sbjct:  114 SESLSATLGRNPLRFILHSGRVAHLCPHPTEPRWVLNVKRAVLSLLQGHPGAHSPKTFDEVDILGRCPTTYQHHG-------DWLHKTKDLARCSLRRGRSSLHSQALPGVAPGLTSRLTCVQSFR-AGVLREASCTELDSAGPLPAKASAVQMRTLSSLSLLHEMPQDPAGTDPDDRDDEDMTPSSLLYEWEETPSQAMVATAATLVRRLCLAQTTSLEAM--DLFLTLVSQLQGLSGGELMELW---QYSSF---KCRDNGQPLLDALPSCGTEHCVGLMKELIASAAVEADEVEAWLSSLAFLPQ-PTDAMVHMLLPLLQTPRASPGAFLGISALVHNLCASLDGPCGQLPGVGSLVRILGDALGENCTIQEPSDDD---KLQLVLKAVGNAGLAAMALTPTLSACASLRSSTPEIRLGAIQAFRRVPCSADRSVLSRLYQSLEEDAEIRINAYLALMRCPSEEVFAQVRRTQAGELSTQVGSFVWSHILQLLETHDPLKRALRDTLPEDILSQEFHPEMWKHSSYSDVTFRSVSGSLGANLEGTLLFSPASFLPRSATVNLTIHTMGRAFNLLELGLRLENAEEIAHRLFGRKSFWGQEDGREPEPEEPPGPEPGPAPQPASPECPGDRDRRMRYLQQKVTRRRGARQALRCELSVKLLGQELSFVN-CGATGSHVNHWPLNLAELAIKLMKGQEVQMNRRLSLAAQELVFPTVSGLPARLTLNASAAISIRVRGTTDFQQRS----DFSVNGYVKPSALLQISAQMGTAGILGQAGLRWVTSVRSAASLDGGIQVQKGRVLKVHLNTPEEAVELLSFSSQLYLITRDGVRSLRHVPGPSEVQSCTGEEVSYTWGWRLC--TGVTWPVPGQPYLLSLPVFAAVTLQKRDPGLRQYLLEAAYT--LQPQKGSWFPQEATAHVFMGTPGSEVL-RDVGVDMSYSLPQNKFRLKLLHP 1042          

HSP 2 Score: 70.8626 bits (172), Expect = 1.096e-10
Identity = 67/271 (24.72%), Postives = 120/271 (44.28%), Query Frame = 2
Query: 15878 FETYATIS-KRSVMTFDKASFTLSPDSCRVLLSKDLKFKKWEIIMNQQNNK-QMFTINIGSNTFEL--SASNYKVNLNGKPSDLPIQIG---STSLVGLGRMMKLKDDKLGLTITIDPVNEMFTVGISGWYHGKVRGLFGNSDNEQFNDFMLDNGKIVSNEVFMKEISYKSQ---SCKVVSDEEQTVVKPIKGCPFIRRMVCKFLFKCPFSPLAACFNKVNPKKFHKLCVH---STEEVLTKLDPSICKAARQYQAQCQKAGVNIQVPPPC 16651
            +E +A ++  + V+TFD   + LS     +LL++D     + + +++  +      + +   T  L  S   Y++  +  P D    +    +T+   + R+    +D  G++++ D    + ++ +  W HG   GL G +DNE  N+ ML +G +  +   ++E+S   Q    C+     +Q      + CP  +   C   F+ P S L  CF  V+P  F  LCV     T+E    L P+ C  A  Y   C +  V +  PP C
Sbjct: 3011 WEYHALVAGAQHVVTFDGRVWDLSTQCGSILLAQDFAHNTFSLTLSRTGSGLTALFVELNHKTLILYPSLQAYRLYNSSLPGDSCPDLKLHPATTRKDVSRIELASED--GVSVSCDVPTGLCSLTLGLWQHGISAGLLGTNDNEAGNELMLPDGSMARS---LEELSLAWQVGGDCRATEKPQQE-----QACPG-QLPACWAFFEGPHSSLRDCFRVVDPTPFLSLCVQVPCGTQE----LQPA-CNLAAAYIHLCARGFVPLAPPPQC 3265          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Human
Match: AC099489.1 (novel lipoprotein amino terminal region containing protein)

HSP 1 Score: 71.633 bits (174), Expect = 2.106e-11
Identity = 67/271 (24.72%), Postives = 120/271 (44.28%), Query Frame = 2
Query: 15878 FETYATIS-KRSVMTFDKASFTLSPDSCRVLLSKDLKFKKWEIIMNQQNNK-QMFTINIGSNTFEL--SASNYKVNLNGKPSDLPIQI---GSTSLVGLGRMMKLKDDKLGLTITIDPVNEMFTVGISGWYHGKVRGLFGNSDNEQFNDFMLDNGKIVSNEVFMKEISYKSQ---SCKVVSDEEQTVVKPIKGCPFIRRMVCKFLFKCPFSPLAACFNKVNPKKFHKLCVH---STEEVLTKLDPSICKAARQYQAQCQKAGVNIQVPPPC 16651
            +E +A ++  + V+TFD   + LS     +LL++D     + + +++  +      + +   T  L  S   Y++  +  P D    +    +T+   + R+    +D  G++++ D    + ++ +  W HG   GL G +DNE  N+ ML +G +  +   ++E+S   Q    C+     +Q      + CP  +   C   F+ P S L  CF  V+P  F  LCV     T+E    L P+ C  A  Y   C +  V +  PP C
Sbjct:  200 WEYHALVAGAQHVVTFDGRVWDLSTQCGSILLAQDFAHNTFSLTLSRTGSGLTALFVELNHKTLILYPSLQAYRLYNSSLPGDSCPDLKLHPATTRKDVSRIELASED--GVSVSCDVPTGLCSLTLGLWQHGISAGLLGTNDNEAGNELMLPDGSMARS---LEELSLAWQVGGDCRATEKPQQE-----QACPG-QLPACWAFFEGPHSSLRDCFRVVDPTPFLSLCVQVPCGTQE----LQPA-CNLAAAYIHLCARGFVPLAPPPQC 454          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Human
Match: MUC2 (mucin 2, oligomeric mucus/gel-forming [Source:HGNC Symbol;Acc:HGNC:7512])

HSP 1 Score: 54.299 bits (129), Expect = 9.335e-6
Identity = 48/166 (28.92%), Postives = 72/166 (43.37%), Query Frame = 2
Query: 16187 GLTITIDPVNEMFTVGISGWYHGKVRGLFGNSDNEQFNDFMLDNGKIVSNEVFMKEISYKSQSCKVVSDEEQTVVKPIKGCPFIRRMVCKFLFKCPFSPLAACFNKVNPKKFHKLCVHSTEEVLTKLD-PSICKAARQYQAQCQKAGVNI--QVPPPCKK-CDMPN 16672
            G+ +  D    +F + ++  Y G V GL GN D+   NDF   +  +VS+E+       ++ +C  VS    T  +P    P  R    K       S  + C +KV+PK F++ CVH +    T  D    C A   Y  +C K G  +  + P  C   CD  N
Sbjct:  965 GIIVIWDKRTTVF-IKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNSWKEAPTCPDVS----TNPEPCSLNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSCSCDTGGDCECFCSAVASYAQECTKEGACVFWRTPDLCPIFCDYYN 1125          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Fly
Match: Apoltp (gene:FBgn0032136 transcript:FBtr0303874)

HSP 1 Score: 188.348 bits (477), Expect = 1.805e-46
Identity = 163/595 (27.39%), Postives = 281/595 (47.23%), Query Frame = 2
Query:  458 CMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTSH--GKCFITSSEKSPKEETNPNSVNFQY--DLQTCDNKMISNSLF--------GDITRSVIFKTSQVSCKYLYKDQSNLVSIRCREEYKTATIKTNENQMVVEITTNIYKENQLPSPDRTFTNKN--MFETGXXXXXXXXXXXXSPYSAAKTTLKDICVQYKSSESSKIPKLFMEL-VNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGS--LTHLYCKEEPESCQNDPIIASIVSAF------LHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQDRSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTN--NYGVNFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYLKKE 2167
            C   +E  W  NIKK IL +  N  ++   D+    +   G+C +    +   E+T+ + V  +   D+ +C  +  ++S+          D T   I K SQ  C  L  D +    I+C E +         +  +   T+ +  +         F  +N  + E       D   A +  +   K   +++ V+        I + F+++  N L+   S ++K L + LQ+S    E+    ++   ++  F+ + +S  VM D I   +++    + W+T+LSF+   P  ETL+   +I+  A        +LG+  + H +CK   E+C+ +  +  I++        L+NL       ++       ++ I LKGLGN+    +     L   I +D   + IR+  +   + +DC + RS  L    N   +SELRI +YL  M C D  ++  ++ IL  E++NQVGSF+W+HLTN+ +SN  ++   + LL + +L + F +   KFSRN E +   +  N+G   D+NVIF   S++PR  S+N TA +F +S NF E +AR EGLE+L    FGP+G L  +
Sbjct:  168 CPQEQETPWVLNIKKGILSAFQNTMMRFDVDANTTETDVSGQCQV----QYALEDTDSSYVTIRKTKDINSCRQRYATHSVLQTTPYTFRDDKTIWPILK-SQSHCN-LTIDNNVYKEIKCLETHLLVPFSNASSGALTTSTSRLKLDGVESYSAGEFLEQNPELVERRATLVFDHTPAVKPSHDEIKAA-RELLVEMCRVGFPNIQREFIDVFTNFLQTSKSLDYKTLSVLLQRSASTCEQG---RNHLLESLPFIGSTASYKVMRDQIINEKLTKQMAHDWMTALSFITR-PDEETLETFHSILEYAKNRLDAEYTLGATAVVHSFCKHH-EACEENLRVQQIINLLETEFLNLYNLFKGERRTRE-------RMVILLKGLGNIGVVSSAFAEQLQWIIREDEAPVDIRLHGILAFRRVDCARHRSYFLDNYGNYTLNSELRIYSYLQAMRCPDYISVGVIKSILEHEEINQVGSFVWSHLTNLAKSNSPVRIEAQGLLLNDELSERFKMDIRKFSRNYEHSLFFDEYNFGTTTDANVIFGTDSYLPRIASVNFTADLFGQSVNFFEFTARAEGLEELAANAFGPKGPLSGQ 743          

HSP 2 Score: 139.813 bits (351), Expect = 7.216e-32
Identity = 143/634 (22.56%), Postives = 274/634 (43.22%), Query Frame = 2
Query: 15659 ITVKMTSPIPFNDFKSLPDFGYV--RRKIHKIQAAINLIKQTIKNQLANGCRYFELRSWFTLYFPQTPFTSILPEFETYATISKRSV---MTFDKASFTLSPDSCRVLLSKDLKFKKWEIIMN-------QQNNKQMFTINIGSNTFELSASNYKVNLNGKPSD-LPIQIGSTSLVGLGRMMKLKDDKLGLTITIDP-----VNEMFTV---GISGWYHGKVRGLFGNSDNEQFNDFMLDNGKIVSNEVFMKEISYKSQSCKVVS-DEEQTVVKPIKGCPFIRRMVCKFLFKCPFSPLAACFNKVNPKKFHKLCVH--STEEVLTKLDPSI---CKAARQYQAQCQKAGVNIQVPPPCKKCDMPNDKPLSINEFRNVKIKE--KVSDIVFIVDEGTCLNSLYDKLPIL--VTRLDKGMKTKGINSVHYGLVTY--VDDNNNQANFHTVGQKLLGSSQEMITSLKTLKSSNGKFKDFTGAITTAANYPFREHASRHLIIISCTSTK------EYPNVLHNLVDKLTKKAIQVSLLTDFSFKLKDSNKQSIIFGVDSQNTYTALSRNGD---KNFTSRPESDF--LYQLTMKMKGVVFDNKYLSASQELTRIRFVSSFANQISLRATPAKSSRCVC 17428
            I ++   P+ ++ F   P F  +   + + K Q+  +    +I  +L N   + + ++W   Y+ +    ++L +   Y T  +R V   + FD+     S   C  LL+ D   + + +++         Q   +  +        E+      +++NG P   LP+++G    V + R + +      L+IT D       N  F +    +SGWY G+  GL G  +NE ++++ + +G ++SNE  +   S+  + C+     + Q V + +          C   F+     LA C   ++P  F+++C+        + K  P++   C AA  Y   C    V ++VP  C  C + N   +    F  +   E  K SD+VFIV+   C  +L     I+  V+ +++ ++   I +  Y +V +  V   +   +      +     +++      + + NG   D   AI+ AA   FR   S+  I++SC+         +Y ++L  L++    + + + +L D  F  + + K    FG+DS+  Y+     GD   +N T  P+S+      L ++ +G VF  + L   ++    RF + FA +++L ATP +S  C C
Sbjct: 3680 IDLEQKLPMSWHAFNETPRFEEIPEYQVLAKAQSFFSETNSSIVMKLYNMRTHLDPKTWLPPYYSR----ALLIDSRHYMTFDQRYVGLNLNFDELGNGRSTSQCSYLLAHDFFKRNFTLLLEPASKSLAGQGLTRKLSFIANGQLIEIDLETDHISINGNPQPILPLKLGD---VNIHRDLDV------LSITSDTEFSLHCNVQFDLCWFEVSGWYFGRTAGLLGTLNNEPYDEYTMSSG-VISNETQLFTDSWSLKQCRQNKLAQTQEVSQEVSDA-------CTSFFRTGI--LATCSAVLDPTPFYEMCMDLGMKSPPIRKGHPAVKGACAAALAYIEACTALKVPMRVPSQCVFCQLSNGSYVPEGTFMELSGPEIPKSSDVVFIVEAKECNANLKTSKNIMTVVSSIEEQLQAAKITNNRYAVVAFGGVSPYDKARSVIYEHNEFTSKPEQLADYFGHINTGNGSSNDILMAISAAAKLNFRPGVSKTFILLSCSKCAARDMRFDYTSILQYLLE----EGVNLHILADTEFDFERNKKLRHFFGLDSKLVYSKRFPEGDAETRNTTHIPKSNLGICTTLAVETQGSVFSARKLQPERKYPIKRFATIFAKRVALSATPIQSQTCEC 4286          

HSP 3 Score: 64.6994 bits (156), Expect = 4.144e-9
Identity = 56/286 (19.58%), Postives = 122/286 (42.66%), Query Frame = 2
Query: 2207 NEMSGSVNIKLFGNQVSF--IELIRGTLSSVKKYNIIEEIMYWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFD-VAGLVSWPISVNIDNYISPNINAELHTEIVYQTPFTNYGMRMKLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFSVEGNAYVIHRDKEIIQLQDKLKEI-KMCTSEMTVRILGIRVCGEAKVLDPSTRKD----ALLFGPFAANVFIEKIDTQTEYILLATSKTSAFISQTGKVYSNRHIKFEFNTPNSK 3040
            N       +++FGN + +  +E +   ++   K+N  ++       K   + K+   +D +  +P  +G PL     G+++I++++    D +     W    +++    P+++ ++ T +     +   G+++K    +N+E  A +       +S  FD P+    IFSV     V  R++++ Q     +     CT  +  + +G+++C    V D S   +     LL GP   ++ ++K D         ++K   F  +  +   + +    F TP SK
Sbjct:  837 NNPRAQFGLRVFGNDLRYFNVESLVEVMALAAKFNPFQQAKNVLSGKEFTYTKSRVFLDASYTVPLAVGLPLAIHAFGASSIDLRVSGNLDEMDPPTDW--HFDVEGQFKPSVSVDVITTMQTDMFWEQSGIKVKSNLYSNSELVAKLKVRGRNLVSFSFDLPRDKNEIFSVRSELLVQKREEQLPQAGIANRSANSTCTWPVLDQAIGLQMCSHYSVPDLSNATEIYPSLLLAGPLNFSLILKKSDL--------SAKKYVFEYKWDQQEEDNNFSLVFTTPGSK 1112          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Fly
Match: apolpp (gene:FBgn0087002 transcript:FBtr0345297)

HSP 1 Score: 178.333 bits (451), Expect = 1.652e-43
Identity = 229/952 (24.05%), Postives = 422/952 (44.33%), Query Frame = 2
Query:   83 VLLSIITNAARTPQFINPCSMKCSFEEDRIFK--PGQKYVYSYEGESNIKTTK---GSYETTGVKIKSKVTITGLSNCEMKLSLSDVQIFDKTSSDGNQFKESPNSYKFKSALEMNDIFFTKESNEVK-SVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTSHGKCFITSSEKSPKEETNPNSVNFQYDLQTCDNK-MISNSLFGDITRSVIFKTSQVSCKYLYKDQSNLVS-----IRCREEYK-TATIKTNENQMVVEITTNIYKENQLPSPDRTFTNKNMFETGXXXXXXXXXXXXSPYS----AAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCI-TKDTNKLSIRISALEVMKHMDCKQD-RSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTNNYGVNF--DSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYLKKE----------------KGAQENLELINILNEMSG---------------SVNIKLFGNQVSFIEL---IRGTLSSVKKY--NIIEEIMYWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLV--SWPISVNIDNYISPNINAELHTEIVYQTPFTNYGMRM--KLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNI--FSVEGNAYVIHRDKE 2749
            VLL+I  NA       N C++ C   ++ + K  PG  Y YS++    I  +       + T +K+     I    NC   L LS V++   T++  +  K+  NS +         + FT  S  ++  +C D  +  +S NIK+A++ SL   GI+ +   ++    G C    +  S  +  N N +    +L +C ++  I++ L           TS +  +  Y  +S +V+     ++  E YK     K N      +I+  +    +L +P  + T  N   TG        +  E+  S    A KT L D+          +  K F+E +  L++ +S+   EL      + +   K      ++ D  G   T ++ S  V L + S+    ++ + + SL+ ++ V   ETL +  + + + N    L++++G+L   YC +    CQ  P I +I   F   L   C   K  T     +I   LKGLGN K      +  L++C  T  +N+  IR++AL     + C++  +S +L +L N   DSELRI AYL+ + C +     ++ EI++ E VNQVG FI ++L  I++S D  ++  +  L ++ + K F +   ++S N E ++   + GV    D  +I+S+  F+PRS  +N T   F  + N  E S R E +ED+L    GP+G + K+                 G +    +++ ++++S                 V++KLFG++++F+ L   I  +L  +  Y     E+           F+ +   +D  +  PT +G PL+   QG AA  + +    D+  ++  +W  +     ++ P+++   + +I +     + G+R+     S T ++    + ++  E  +V  + P+    +  F+V+   YV  +DK+
Sbjct:   17 VLLTIAVNAE------NACNLGCPKSDNGLLKYIPGNYYDYSFDSILTIGASSDVPNDSDDTSLKVSGSAKIFAKGNCGYTLQLSSVKV---TNTKESVEKKILNSIQ-------KPVQFTLVSGILEPQICSDSSDLDYSLNIKRAVV-SLLQSGIEAE---HEVDVFGMC---PTHTSTSKVGNANIITKARNLNSCSHREQINSGLVSGKVNEKAGITSSLLLQANYIKESRIVNHLIENVQLTETYKFIGNTKRNS-----DISAKVVTILKLKNP--SGTKANSPGTGSTVRSLIFQRPETYTSKNINALKTILSDLVDSTGDYVKKETAKKFVEFIRLLRQSDSETLLELAAFPHPNKVLARK------VYLD--GLFRTSTAESARVILKQLSKFDEKEKLLAILSLNIVKSVDK-ETLNQAASQL-LPNAPKELYIAVGNLVAKYCLKN--YCQG-PEIDAISKKFSDGLK-HC---KPNTKREEERIVYILKGLGNAKSLSGNTVAALSECASTGRSNR--IRVAALHAFSKVKCEETLQSKSLELLKNRNEDSELRIEAYLSAISCPNAEVANQISEIVNSETVNQVGGFISSNLKAIRDSTDVSRDQQKYHLANIRVTKTFPVDYRRYSFNNEVSYKLESLGVGASTDYQIIYSQHGFLPRSSRINVTTEFFGTNYNVFEASVRQENVEDVLEYYLGPKGLVNKDFDEIVKLIEVGNNGVAAGGRARRSIVDDVSKISKKYKMYGVKNVQDLNLDVSLKLFGSELAFLSLGDNIPSSLDDIINYFSTSFEKAKQELSSFEKQFSSHHLFLDTDLAYPTSIGVPLELVAQGFAATKVDLAVSLDINAILEQNWQKAKYRLKFV-PSVDINANVQIGFNAQVLSTGLRVVSSAHSATGSDITVAVISD-GEGFNVDLELPREKLELINFNVDTELYVAEQDKQ 917          

HSP 2 Score: 86.2705 bits (212), Expect = 1.117e-15
Identity = 102/430 (23.72%), Postives = 184/430 (42.79%), Query Frame = 2
Query: 15896 ISKRSVMTFDKASFTLSPDSCRVLLSKDLKFKKWEIIMNQQNNK--QMFTINIGSNTFELSASNYKVNLNGKPSDLPIQIGSTSLVGLGRMMKL---KDDKLGLTITIDPVNEMFTVGISGWYHGKVRGLFGNSDNEQFNDFMLDNGKIVSNEVFMKEISYKSQSCKVVS-DEEQTVVKPIKGCPFIRRMVCKFLFKCPFSPLAACFNKVNPKKFHKLCVHSTEEVLTK-LDPSICKAARQYQAQCQKAGVNIQVPPPCKKCDMPNDKPLSINEFRNVKIKEKVSDIVFIVDEGTCLNSLYDKLPILVTRLDKGMKTKGINSVHYGLVTY----------------VDDNNNQANFHTVGQKLLGSS--QEMITSLKTLKSSNGKFKDFTG--------AITTAANYPFREHASRHLIIISCTSTKEYPN 17086
            +  + + TFD  +F   P +C+ +L++D     + II    N K   +  I+   + FE+ A N  + LNG   + P  +  + L    R   +    +  +G+  T D   ++  + I+G+Y  K RGL GN + E ++DF+L +G +  N   +    Y    C  +  D  Q   K  K     R+ +C  LF    S LA  F  ++ + + K C  +  +V  K  + + C  A  Y +  ++    + +PP C KC  P  +    +EF  VK+     D+VF+VD       L + +   +  + + ++++G + V  G++ +                ++   N A+    G K    +  +++IT  + L   N   +   G        A   A +YPFR  A++ +I +   S  EY N
Sbjct: 2791 VDGKHIFTFDGLNFAY-PGNCKYILAQDSVDNNFTIIGQLTNGKLKSITLIDREGSYFEV-ADNLALKLNGNLVEYPQHL--SGLHAWRRFYTIHLYSEYGVGIVCTSDL--KVCHININGFYTSKTRGLLGNGNAEPYDDFLLIDGTLAENSAALGN-DYGVGKCTAIEFDNNQ--FKSSK-----RQEMCSELFGIE-STLAFNFITLDSRPYRKACDIALAKVAEKEKEATACTFALAYGSAVKQINKWVLLPPRCIKCAGPAGQHDFGDEF-TVKLPNNKVDVVFVVDINVTPGVLSNLIAPAINDIRESLRSRGFSDVQVGVIVFEETKRYPALLTSDGGKINYKGNVADVKLAGIKSFCDNCVEQIITEKRILDIYNSLKEIVKGIAPQADEKAFQLALDYPFRAGAAKSIIGVRSDSL-EYKN 3203          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Fly
Match: apolpp (gene:FBgn0087002 transcript:FBtr0334627)

HSP 1 Score: 178.333 bits (451), Expect = 1.652e-43
Identity = 229/952 (24.05%), Postives = 422/952 (44.33%), Query Frame = 2
Query:   83 VLLSIITNAARTPQFINPCSMKCSFEEDRIFK--PGQKYVYSYEGESNIKTTK---GSYETTGVKIKSKVTITGLSNCEMKLSLSDVQIFDKTSSDGNQFKESPNSYKFKSALEMNDIFFTKESNEVK-SVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTSHGKCFITSSEKSPKEETNPNSVNFQYDLQTCDNK-MISNSLFGDITRSVIFKTSQVSCKYLYKDQSNLVS-----IRCREEYK-TATIKTNENQMVVEITTNIYKENQLPSPDRTFTNKNMFETGXXXXXXXXXXXXSPYS----AAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCI-TKDTNKLSIRISALEVMKHMDCKQD-RSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTNNYGVNF--DSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYLKKE----------------KGAQENLELINILNEMSG---------------SVNIKLFGNQVSFIEL---IRGTLSSVKKY--NIIEEIMYWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLV--SWPISVNIDNYISPNINAELHTEIVYQTPFTNYGMRM--KLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNI--FSVEGNAYVIHRDKE 2749
            VLL+I  NA       N C++ C   ++ + K  PG  Y YS++    I  +       + T +K+     I    NC   L LS V++   T++  +  K+  NS +         + FT  S  ++  +C D  +  +S NIK+A++ SL   GI+ +   ++    G C    +  S  +  N N +    +L +C ++  I++ L           TS +  +  Y  +S +V+     ++  E YK     K N      +I+  +    +L +P  + T  N   TG        +  E+  S    A KT L D+          +  K F+E +  L++ +S+   EL      + +   K      ++ D  G   T ++ S  V L + S+    ++ + + SL+ ++ V   ETL +  + + + N    L++++G+L   YC +    CQ  P I +I   F   L   C   K  T     +I   LKGLGN K      +  L++C  T  +N+  IR++AL     + C++  +S +L +L N   DSELRI AYL+ + C +     ++ EI++ E VNQVG FI ++L  I++S D  ++  +  L ++ + K F +   ++S N E ++   + GV    D  +I+S+  F+PRS  +N T   F  + N  E S R E +ED+L    GP+G + K+                 G +    +++ ++++S                 V++KLFG++++F+ L   I  +L  +  Y     E+           F+ +   +D  +  PT +G PL+   QG AA  + +    D+  ++  +W  +     ++ P+++   + +I +     + G+R+     S T ++    + ++  E  +V  + P+    +  F+V+   YV  +DK+
Sbjct:   17 VLLTIAVNAE------NACNLGCPKSDNGLLKYIPGNYYDYSFDSILTIGASSDVPNDSDDTSLKVSGSAKIFAKGNCGYTLQLSSVKV---TNTKESVEKKILNSIQ-------KPVQFTLVSGILEPQICSDSSDLDYSLNIKRAVV-SLLQSGIEAE---HEVDVFGMC---PTHTSTSKVGNANIITKARNLNSCSHREQINSGLVSGKVNEKAGITSSLLLQANYIKESRIVNHLIENVQLTETYKFIGNTKRNS-----DISAKVVTILKLKNP--SGTKANSPGTGSTVRSLIFQRPETYTSKNINALKTILSDLVDSTGDYVKKETAKKFVEFIRLLRQSDSETLLELAAFPHPNKVLARK------VYLD--GLFRTSTAESARVILKQLSKFDEKEKLLAILSLNIVKSVDK-ETLNQAASQL-LPNAPKELYIAVGNLVAKYCLKN--YCQG-PEIDAISKKFSDGLK-HC---KPNTKREEERIVYILKGLGNAKSLSGNTVAALSECASTGRSNR--IRVAALHAFSKVKCEETLQSKSLELLKNRNEDSELRIEAYLSAISCPNAEVANQISEIVNSETVNQVGGFISSNLKAIRDSTDVSRDQQKYHLANIRVTKTFPVDYRRYSFNNEVSYKLESLGVGASTDYQIIYSQHGFLPRSSRINVTTEFFGTNYNVFEASVRQENVEDVLEYYLGPKGLVNKDFDEIVKLIEVGNNGVAAGGRARRSIVDDVSKISKKYKMYGVKNVQDLNLDVSLKLFGSELAFLSLGDNIPSSLDDIINYFSTSFEKAKQELSSFEKQFSSHHLFLDTDLAYPTSIGVPLELVAQGFAATKVDLAVSLDINAILEQNWQKAKYRLKFV-PSVDINANVQIGFNAQVLSTGLRVVSSAHSATGSDITVAVISD-GEGFNVDLELPREKLELINFNVDTELYVAEQDKQ 917          

HSP 2 Score: 86.2705 bits (212), Expect = 1.117e-15
Identity = 102/430 (23.72%), Postives = 184/430 (42.79%), Query Frame = 2
Query: 15896 ISKRSVMTFDKASFTLSPDSCRVLLSKDLKFKKWEIIMNQQNNK--QMFTINIGSNTFELSASNYKVNLNGKPSDLPIQIGSTSLVGLGRMMKL---KDDKLGLTITIDPVNEMFTVGISGWYHGKVRGLFGNSDNEQFNDFMLDNGKIVSNEVFMKEISYKSQSCKVVS-DEEQTVVKPIKGCPFIRRMVCKFLFKCPFSPLAACFNKVNPKKFHKLCVHSTEEVLTK-LDPSICKAARQYQAQCQKAGVNIQVPPPCKKCDMPNDKPLSINEFRNVKIKEKVSDIVFIVDEGTCLNSLYDKLPILVTRLDKGMKTKGINSVHYGLVTY----------------VDDNNNQANFHTVGQKLLGSS--QEMITSLKTLKSSNGKFKDFTG--------AITTAANYPFREHASRHLIIISCTSTKEYPN 17086
            +  + + TFD  +F   P +C+ +L++D     + II    N K   +  I+   + FE+ A N  + LNG   + P  +  + L    R   +    +  +G+  T D   ++  + I+G+Y  K RGL GN + E ++DF+L +G +  N   +    Y    C  +  D  Q   K  K     R+ +C  LF    S LA  F  ++ + + K C  +  +V  K  + + C  A  Y +  ++    + +PP C KC  P  +    +EF  VK+     D+VF+VD       L + +   +  + + ++++G + V  G++ +                ++   N A+    G K    +  +++IT  + L   N   +   G        A   A +YPFR  A++ +I +   S  EY N
Sbjct: 2791 VDGKHIFTFDGLNFAY-PGNCKYILAQDSVDNNFTIIGQLTNGKLKSITLIDREGSYFEV-ADNLALKLNGNLVEYPQHL--SGLHAWRRFYTIHLYSEYGVGIVCTSDL--KVCHININGFYTSKTRGLLGNGNAEPYDDFLLIDGTLAENSAALGN-DYGVGKCTAIEFDNNQ--FKSSK-----RQEMCSELFGIE-STLAFNFITLDSRPYRKACDIALAKVAEKEKEATACTFALAYGSAVKQINKWVLLPPRCIKCAGPAGQHDFGDEF-TVKLPNNKVDVVFVVDINVTPGVLSNLIAPAINDIRESLRSRGFSDVQVGVIVFEETKRYPALLTSDGGKINYKGNVADVKLAGIKSFCDNCVEQIITEKRILDIYNSLKEIVKGIAPQADEKAFQLALDYPFRAGAAKSIIGVRSDSL-EYKN 3203          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Fly
Match: apolpp (gene:FBgn0087002 transcript:FBtr0345296)

HSP 1 Score: 178.333 bits (451), Expect = 1.652e-43
Identity = 229/952 (24.05%), Postives = 422/952 (44.33%), Query Frame = 2
Query:   83 VLLSIITNAARTPQFINPCSMKCSFEEDRIFK--PGQKYVYSYEGESNIKTTK---GSYETTGVKIKSKVTITGLSNCEMKLSLSDVQIFDKTSSDGNQFKESPNSYKFKSALEMNDIFFTKESNEVK-SVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTSHGKCFITSSEKSPKEETNPNSVNFQYDLQTCDNK-MISNSLFGDITRSVIFKTSQVSCKYLYKDQSNLVS-----IRCREEYK-TATIKTNENQMVVEITTNIYKENQLPSPDRTFTNKNMFETGXXXXXXXXXXXXSPYS----AAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCI-TKDTNKLSIRISALEVMKHMDCKQD-RSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTNNYGVNF--DSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYLKKE----------------KGAQENLELINILNEMSG---------------SVNIKLFGNQVSFIEL---IRGTLSSVKKY--NIIEEIMYWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLV--SWPISVNIDNYISPNINAELHTEIVYQTPFTNYGMRM--KLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNI--FSVEGNAYVIHRDKE 2749
            VLL+I  NA       N C++ C   ++ + K  PG  Y YS++    I  +       + T +K+     I    NC   L LS V++   T++  +  K+  NS +         + FT  S  ++  +C D  +  +S NIK+A++ SL   GI+ +   ++    G C    +  S  +  N N +    +L +C ++  I++ L           TS +  +  Y  +S +V+     ++  E YK     K N      +I+  +    +L +P  + T  N   TG        +  E+  S    A KT L D+          +  K F+E +  L++ +S+   EL      + +   K      ++ D  G   T ++ S  V L + S+    ++ + + SL+ ++ V   ETL +  + + + N    L++++G+L   YC +    CQ  P I +I   F   L   C   K  T     +I   LKGLGN K      +  L++C  T  +N+  IR++AL     + C++  +S +L +L N   DSELRI AYL+ + C +     ++ EI++ E VNQVG FI ++L  I++S D  ++  +  L ++ + K F +   ++S N E ++   + GV    D  +I+S+  F+PRS  +N T   F  + N  E S R E +ED+L    GP+G + K+                 G +    +++ ++++S                 V++KLFG++++F+ L   I  +L  +  Y     E+           F+ +   +D  +  PT +G PL+   QG AA  + +    D+  ++  +W  +     ++ P+++   + +I +     + G+R+     S T ++    + ++  E  +V  + P+    +  F+V+   YV  +DK+
Sbjct:   17 VLLTIAVNAE------NACNLGCPKSDNGLLKYIPGNYYDYSFDSILTIGASSDVPNDSDDTSLKVSGSAKIFAKGNCGYTLQLSSVKV---TNTKESVEKKILNSIQ-------KPVQFTLVSGILEPQICSDSSDLDYSLNIKRAVV-SLLQSGIEAE---HEVDVFGMC---PTHTSTSKVGNANIITKARNLNSCSHREQINSGLVSGKVNEKAGITSSLLLQANYIKESRIVNHLIENVQLTETYKFIGNTKRNS-----DISAKVVTILKLKNP--SGTKANSPGTGSTVRSLIFQRPETYTSKNINALKTILSDLVDSTGDYVKKETAKKFVEFIRLLRQSDSETLLELAAFPHPNKVLARK------VYLD--GLFRTSTAESARVILKQLSKFDEKEKLLAILSLNIVKSVDK-ETLNQAASQL-LPNAPKELYIAVGNLVAKYCLKN--YCQG-PEIDAISKKFSDGLK-HC---KPNTKREEERIVYILKGLGNAKSLSGNTVAALSECASTGRSNR--IRVAALHAFSKVKCEETLQSKSLELLKNRNEDSELRIEAYLSAISCPNAEVANQISEIVNSETVNQVGGFISSNLKAIRDSTDVSRDQQKYHLANIRVTKTFPVDYRRYSFNNEVSYKLESLGVGASTDYQIIYSQHGFLPRSSRINVTTEFFGTNYNVFEASVRQENVEDVLEYYLGPKGLVNKDFDEIVKLIEVGNNGVAAGGRARRSIVDDVSKISKKYKMYGVKNVQDLNLDVSLKLFGSELAFLSLGDNIPSSLDDIINYFSTSFEKAKQELSSFEKQFSSHHLFLDTDLAYPTSIGVPLELVAQGFAATKVDLAVSLDINAILEQNWQKAKYRLKFV-PSVDINANVQIGFNAQVLSTGLRVVSSAHSATGSDITVAVISD-GEGFNVDLELPREKLELINFNVDTELYVAEQDKQ 917          

HSP 2 Score: 86.2705 bits (212), Expect = 1.117e-15
Identity = 102/430 (23.72%), Postives = 184/430 (42.79%), Query Frame = 2
Query: 15896 ISKRSVMTFDKASFTLSPDSCRVLLSKDLKFKKWEIIMNQQNNK--QMFTINIGSNTFELSASNYKVNLNGKPSDLPIQIGSTSLVGLGRMMKL---KDDKLGLTITIDPVNEMFTVGISGWYHGKVRGLFGNSDNEQFNDFMLDNGKIVSNEVFMKEISYKSQSCKVVS-DEEQTVVKPIKGCPFIRRMVCKFLFKCPFSPLAACFNKVNPKKFHKLCVHSTEEVLTK-LDPSICKAARQYQAQCQKAGVNIQVPPPCKKCDMPNDKPLSINEFRNVKIKEKVSDIVFIVDEGTCLNSLYDKLPILVTRLDKGMKTKGINSVHYGLVTY----------------VDDNNNQANFHTVGQKLLGSS--QEMITSLKTLKSSNGKFKDFTG--------AITTAANYPFREHASRHLIIISCTSTKEYPN 17086
            +  + + TFD  +F   P +C+ +L++D     + II    N K   +  I+   + FE+ A N  + LNG   + P  +  + L    R   +    +  +G+  T D   ++  + I+G+Y  K RGL GN + E ++DF+L +G +  N   +    Y    C  +  D  Q   K  K     R+ +C  LF    S LA  F  ++ + + K C  +  +V  K  + + C  A  Y +  ++    + +PP C KC  P  +    +EF  VK+     D+VF+VD       L + +   +  + + ++++G + V  G++ +                ++   N A+    G K    +  +++IT  + L   N   +   G        A   A +YPFR  A++ +I +   S  EY N
Sbjct: 2791 VDGKHIFTFDGLNFAY-PGNCKYILAQDSVDNNFTIIGQLTNGKLKSITLIDREGSYFEV-ADNLALKLNGNLVEYPQHL--SGLHAWRRFYTIHLYSEYGVGIVCTSDL--KVCHININGFYTSKTRGLLGNGNAEPYDDFLLIDGTLAENSAALGN-DYGVGKCTAIEFDNNQ--FKSSK-----RQEMCSELFGIE-STLAFNFITLDSRPYRKACDIALAKVAEKEKEATACTFALAYGSAVKQINKWVLLPPRCIKCAGPAGQHDFGDEF-TVKLPNNKVDVVFVVDINVTPGVLSNLIAPAINDIRESLRSRGFSDVQVGVIVFEETKRYPALLTSDGGKINYKGNVADVKLAGIKSFCDNCVEQIITEKRILDIYNSLKEIVKGIAPQADEKAFQLALDYPFRAGAAKSIIGVRSDSL-EYKN 3203          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Fly
Match: apolpp (gene:FBgn0087002 transcript:FBtr0089188)

HSP 1 Score: 178.333 bits (451), Expect = 1.652e-43
Identity = 229/952 (24.05%), Postives = 422/952 (44.33%), Query Frame = 2
Query:   83 VLLSIITNAARTPQFINPCSMKCSFEEDRIFK--PGQKYVYSYEGESNIKTTK---GSYETTGVKIKSKVTITGLSNCEMKLSLSDVQIFDKTSSDGNQFKESPNSYKFKSALEMNDIFFTKESNEVK-SVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTSHGKCFITSSEKSPKEETNPNSVNFQYDLQTCDNK-MISNSLFGDITRSVIFKTSQVSCKYLYKDQSNLVS-----IRCREEYK-TATIKTNENQMVVEITTNIYKENQLPSPDRTFTNKNMFETGXXXXXXXXXXXXSPYS----AAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCI-TKDTNKLSIRISALEVMKHMDCKQD-RSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTNNYGVNF--DSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYLKKE----------------KGAQENLELINILNEMSG---------------SVNIKLFGNQVSFIEL---IRGTLSSVKKY--NIIEEIMYWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLV--SWPISVNIDNYISPNINAELHTEIVYQTPFTNYGMRM--KLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNI--FSVEGNAYVIHRDKE 2749
            VLL+I  NA       N C++ C   ++ + K  PG  Y YS++    I  +       + T +K+     I    NC   L LS V++   T++  +  K+  NS +         + FT  S  ++  +C D  +  +S NIK+A++ SL   GI+ +   ++    G C    +  S  +  N N +    +L +C ++  I++ L           TS +  +  Y  +S +V+     ++  E YK     K N      +I+  +    +L +P  + T  N   TG        +  E+  S    A KT L D+          +  K F+E +  L++ +S+   EL      + +   K      ++ D  G   T ++ S  V L + S+    ++ + + SL+ ++ V   ETL +  + + + N    L++++G+L   YC +    CQ  P I +I   F   L   C   K  T     +I   LKGLGN K      +  L++C  T  +N+  IR++AL     + C++  +S +L +L N   DSELRI AYL+ + C +     ++ EI++ E VNQVG FI ++L  I++S D  ++  +  L ++ + K F +   ++S N E ++   + GV    D  +I+S+  F+PRS  +N T   F  + N  E S R E +ED+L    GP+G + K+                 G +    +++ ++++S                 V++KLFG++++F+ L   I  +L  +  Y     E+           F+ +   +D  +  PT +G PL+   QG AA  + +    D+  ++  +W  +     ++ P+++   + +I +     + G+R+     S T ++    + ++  E  +V  + P+    +  F+V+   YV  +DK+
Sbjct:   17 VLLTIAVNAE------NACNLGCPKSDNGLLKYIPGNYYDYSFDSILTIGASSDVPNDSDDTSLKVSGSAKIFAKGNCGYTLQLSSVKV---TNTKESVEKKILNSIQ-------KPVQFTLVSGILEPQICSDSSDLDYSLNIKRAVV-SLLQSGIEAE---HEVDVFGMC---PTHTSTSKVGNANIITKARNLNSCSHREQINSGLVSGKVNEKAGITSSLLLQANYIKESRIVNHLIENVQLTETYKFIGNTKRNS-----DISAKVVTILKLKNP--SGTKANSPGTGSTVRSLIFQRPETYTSKNINALKTILSDLVDSTGDYVKKETAKKFVEFIRLLRQSDSETLLELAAFPHPNKVLARK------VYLD--GLFRTSTAESARVILKQLSKFDEKEKLLAILSLNIVKSVDK-ETLNQAASQL-LPNAPKELYIAVGNLVAKYCLKN--YCQG-PEIDAISKKFSDGLK-HC---KPNTKREEERIVYILKGLGNAKSLSGNTVAALSECASTGRSNR--IRVAALHAFSKVKCEETLQSKSLELLKNRNEDSELRIEAYLSAISCPNAEVANQISEIVNSETVNQVGGFISSNLKAIRDSTDVSRDQQKYHLANIRVTKTFPVDYRRYSFNNEVSYKLESLGVGASTDYQIIYSQHGFLPRSSRINVTTEFFGTNYNVFEASVRQENVEDVLEYYLGPKGLVNKDFDEIVKLIEVGNNGVAAGGRARRSIVDDVSKISKKYKMYGVKNVQDLNLDVSLKLFGSELAFLSLGDNIPSSLDDIINYFSTSFEKAKQELSSFEKQFSSHHLFLDTDLAYPTSIGVPLELVAQGFAATKVDLAVSLDINAILEQNWQKAKYRLKFV-PSVDINANVQIGFNAQVLSTGLRVVSSAHSATGSDITVAVISD-GEGFNVDLELPREKLELINFNVDTELYVAEQDKQ 917          

HSP 2 Score: 86.2705 bits (212), Expect = 1.117e-15
Identity = 102/430 (23.72%), Postives = 184/430 (42.79%), Query Frame = 2
Query: 15896 ISKRSVMTFDKASFTLSPDSCRVLLSKDLKFKKWEIIMNQQNNK--QMFTINIGSNTFELSASNYKVNLNGKPSDLPIQIGSTSLVGLGRMMKL---KDDKLGLTITIDPVNEMFTVGISGWYHGKVRGLFGNSDNEQFNDFMLDNGKIVSNEVFMKEISYKSQSCKVVS-DEEQTVVKPIKGCPFIRRMVCKFLFKCPFSPLAACFNKVNPKKFHKLCVHSTEEVLTK-LDPSICKAARQYQAQCQKAGVNIQVPPPCKKCDMPNDKPLSINEFRNVKIKEKVSDIVFIVDEGTCLNSLYDKLPILVTRLDKGMKTKGINSVHYGLVTY----------------VDDNNNQANFHTVGQKLLGSS--QEMITSLKTLKSSNGKFKDFTG--------AITTAANYPFREHASRHLIIISCTSTKEYPN 17086
            +  + + TFD  +F   P +C+ +L++D     + II    N K   +  I+   + FE+ A N  + LNG   + P  +  + L    R   +    +  +G+  T D   ++  + I+G+Y  K RGL GN + E ++DF+L +G +  N   +    Y    C  +  D  Q   K  K     R+ +C  LF    S LA  F  ++ + + K C  +  +V  K  + + C  A  Y +  ++    + +PP C KC  P  +    +EF  VK+     D+VF+VD       L + +   +  + + ++++G + V  G++ +                ++   N A+    G K    +  +++IT  + L   N   +   G        A   A +YPFR  A++ +I +   S  EY N
Sbjct: 2791 VDGKHIFTFDGLNFAY-PGNCKYILAQDSVDNNFTIIGQLTNGKLKSITLIDREGSYFEV-ADNLALKLNGNLVEYPQHL--SGLHAWRRFYTIHLYSEYGVGIVCTSDL--KVCHININGFYTSKTRGLLGNGNAEPYDDFLLIDGTLAENSAALGN-DYGVGKCTAIEFDNNQ--FKSSK-----RQEMCSELFGIE-STLAFNFITLDSRPYRKACDIALAKVAEKEKEATACTFALAYGSAVKQINKWVLLPPRCIKCAGPAGQHDFGDEF-TVKLPNNKVDVVFVVDINVTPGVLSNLIAPAINDIRESLRSRGFSDVQVGVIVFEETKRYPALLTSDGGKINYKGNVADVKLAGIKSFCDNCVEQIITEKRILDIYNSLKEIVKGIAPQADEKAFQLALDYPFRAGAAKSIIGVRSDSL-EYKN 3203          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Zebrafish
Match: si:dkeyp-106c3.3 (si:dkeyp-106c3.3 [Source:ZFIN;Acc:ZDB-GENE-070705-528])

HSP 1 Score: 131.724 bits (330), Expect = 1.498e-31
Identity = 90/404 (22.28%), Postives = 185/404 (45.79%), Query Frame = 2
Query: 1613 LSIRISALEVMKHMDCKQDRSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTNNYGVNFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIF-----------GPEGYL----KKEKGAQENLELINILNEMSGS--------------VNIKLFGNQVSFIELIRGTLSSVKKY---------NIIEEIMYWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLVSWPISVNIDNYISPNINAELHTEIVYQTPFTNYGMRMKLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFS 2710
            L ++++A+   + + C QDR     +    + + E+RI AY  +M C +      V+  LS EK +QVGSF+W+HL NI+++ D LK+ + + L D  + ++F+    K+S +++ T  T     N +  ++FS +SF+P     N T  I  ++ N LE+S R+E LE LL  +F           GP        KKE+ +  +       + M                 +N+K+FGN ++F+     T   +  Y          ++ +++   + + +  ++   ++ + +V+P+L G P++  +  SA  ++++K    ++   +W    ++  YI P+    +             G+    +  T+T     ++ +  + L +  ++P+   +I +
Sbjct:    7 LELQLAAIRAFRRIPCHQDRKVLAQVFQRQQENVEVRIAAYQQLMHCPNQEIFTLVKTTLSNEKSSQVGSFVWSHLFNIQKTEDPLKKYLMESLPDDIISRDFEAEPWKYSSHMDYTVDTGVAAANVEGALVFSPQSFLPSYAMANLTVFILGRAFNLLEISLRMENLEPLLKTVFEQQPLASADHSGPSAQADSVKKKERNSNSDGCQSATFSSMRTKFTEQRKKDRTLHCWINVKMFGNDMTFM-----TCDDLHSYQRKLSLSTAGVVVKLL---KGQEIKLSQKPVVLAEELVLPSLSGLPMRLSINMSALFSLRLKG---ISNYKNWS-HFSLAGYIKPSALVGISVRAGVDGAIGRVGLEWVTQLKTSTSLDGAVYLHHGQNLKLVLNTPEDVMDILT 398          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Zebrafish
Match: apoba (apolipoprotein Ba [Source:ZFIN;Acc:ZDB-GENE-070702-4])

HSP 1 Score: 97.4413 bits (241), Expect = 6.752e-19
Identity = 191/858 (22.26%), Postives = 352/858 (41.03%), Query Frame = 2
Query:  173 FKPGQKYVYSYEGESNIKTTKGSYETTGVKIKSKVTITGLSNCEMKLS-----LSDVQIFDKTSSDGNQFKESPNSYKFKSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTSHGKCFITSSEKSPKEETNPNS-------VNFQYDLQTCDN---KMIS----------NSLFGDITRSVIFKTSQVSCKYLYKDQS-NLVSIRCREEYKTATIKTNENQMVV--EITTNIYKENQLPSPDRTFTNKNMFETGXXXXXXXXXXXXSPYSAAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFM-QEVPSIETLKELETIISVAN--PSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQD-RSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTNNYGV------NFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGY-----------------------------------LKKE------KGAQENL-ELINILNEMS----GSVNIKLFGNQVSFIELIRGTLSSVKKY-NIIEEIMYWSQDKSLDFNKNL------------QLVDKTVVIPTLLGFPLKFKLQGSAAINIK 2455
            FK  +KYVY Y  ES    T  +    G KI  +V I     C   L      LS+V + D        ++++  +  F++A+E N + F  +     S+  + +EP    NIK+ I+ +L    ++ + +    T HG C         K E   NS       V+   DL  C +     +S          N LF  + RS        +C Y + ++  ++   +C E++      ++E Q  +  E+  ++  ++ +   +R F   +  E  +   E E +           T+K++     S +S +   LF +LV+ ++ L ++       E+ K      +    +++F        T    S ++ +++T   +  + +  + +LS + Q  P     + L  ++S+A   PS P+  +L +      K+ P+           V+ F+  + GDCS  +D+T  ++T   I + G   ++ +P+   + LN C+ +    L ++ +A++  + M+   D RS+ +    N E  ++ RI AYL +M   ++     V   L  E+  QV SF+ +H+ NI ES +      +D +    ++ +     + F++      L+ NY        + +SNVIF   +++PR V L TT   F+     LE+    EGLE ++  +FG  G+                                   +K++      K  +E + E  N L ++     G   ++LFG ++ +++     L  V +Y N+  E     +  SL+F   L              +DK   +PT  GFPLK  L G  A   K
Sbjct:   39 FKNLRKYVYQYTAESKNGVTGTANLKNGPKISCQVEIEVPQTCSFVLRTTECVLSEVSVIDAQGQP--VYRQAAGAEAFQAAMEKNTLNFVVDQVTSVSIYPEEDEPENILNIKRGIISALLVPVLEEEHNERMSTIHGIC---------KTEVTVNSRKDIDIDVSVVRDLSDCSHFSPHSLSTSPLSLMPGLNGLFSKLIRST------QTCNYQFDNRRKHMTEAQCTEKHLFIPF-SHEGQYGISSEVKQSLTLQDSVKINNRYFNKDDTLEKKLFIEEVEDKHPVQSKDDVLATMKELITLSSSGKSQQRASLFHKLVSEVRGLKNETLSGAADEMMKF----SEWLTWQTLFQ-----CGTDECTSAIMQILRTFDEADREVDAIVYALSLLPQSSP-----QRLRDMLSMAQSKPSKPIMYALANT----VKQLPQDQATSTPEVKEVAKFMEFMLGDCSGDEDST--FLTLRVIGVMG-KYMEGFPSLKSSVLN-CMKQAYAPLPVQKAAIQAFRLMEMDSDVRSALIQQYQNVEAPAQKRIAAYLMLMRNPEVAE--NVLRTLKSEQNEQVKSFVSSHIANILESENPNLSIAKDYILKA-VQGDVSFPPMDFTK------LSRNYKTEVPLVGSVESNVIFDSANYMPREVMLATTLDNFNP--EILEIGLEGEGLEPVIEVLFGENGFFPDTISKAMYWVNDKIPHPVKRVLEKWISPLNGERMKRQVPQDIMKSMEEYISEFKNRLEQVEDAPKGLAYLRLFGTELGYLK--TSDLKHVTQYINLCAETF---KSTSLNFMGKLISSLENEFFVHYMFLDKAFTLPTSAGFPLKLTLSGVLAPGAK 840          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Zebrafish
Match: apobb.1 (apolipoprotein Bb, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9732])

HSP 1 Score: 94.3597 bits (233), Expect = 5.278e-18
Identity = 210/995 (21.11%), Postives = 395/995 (39.70%), Query Frame = 2
Query:  173 FKPGQKYVYSYEGESNIKTTKGSYETTGVKIKSKVTITGLSNCEMKLSLSDVQIFDKTSSDGNQ---FKESPNSYKFKSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTSHGKCFITSSEKSPKEETNPNSVNFQYDLQTCDN-----------KMISNSLFGDITRSVIFKTSQVSCKYLY-KDQSNLVSIRCREE-------YKTATIKTNEN-QMVVEITTNIYKENQLPSPDRTFT-NKNMFETGXXXXXXXXXXXXSPYSAAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLG-SLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLN----KCITKDTNKLSIRISALEVMKHMDC-KQDRSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESN----DQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTNNYGV-NFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGY---------------------------------LKKEKGAQENLELINILNEMSGSVN-----IKLFGNQVSFIEL-IRGTLSSVKKYNIIEEIMYWSQ--DKSL------DFNKNLQ------------LVDKTVVIPTLLGFPLKFKLQGSAAINIK--IKSKFDVAGLVSWP---------ISVNIDNYISPNINAELHTEIVYQTPFTNYGMRMKLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFSVEGNAYVIHRD--KEIIQLQDKLKEIKMCTSEMTVRILGIRVCG 2836
            FK  QKY Y+YE ES +    G+    G K + KV I     C   +  ++ ++ D    D      F  S  +  FK+A+  N + FT E +    +  + +EP    N K+ ++ +LA   ++   +    T +G C    S  + ++      V    DL  CD             +I+   +     + + ++SQ +C Y +  DQ ++ S  C E+       YK     +N   Q +  +  ++Y         R F  N+   +T       +         A  + L+D+    +++       L  +L++ +++++++           S   PE     + + Y A     T    S ++ +++T   S  + +  + ++  +   PS + ++E+  +    + S P++ +L  ++  LY  E+  +    P I ++    L  + GDC+  ++        + +SL+ +GN+          L     +CI +      ++ +A++V +      + R   + ++ +     + R+ AYL VM       L ++   L   K  Q  SF+ +HL NI  S      +L+  I + L   ++    D +K  FSRN         Y + + + NVIF  +  +P  V L  T + F    +  E+    +GLE  +  + G +G+                                 +K +K  Q      +I+ E++ +VN     +K+  N  + I L + G      K N +E++ Y +    KSL      DF +NL              +D    +PT  G PL+  L G+ A  +K  +K   D++ +   P         +   +  Y+   +  E+HT I +++     G+++K+ + TN +FK TI T            PKT+  + SV  + Y +     K I  L + +K  K CT      I G + CG
Sbjct:   23 FKSFQKYEYTYETES-LNALNGA--INGPKARCKVEIEVPRICSYIVHTTECELSDVIDVDAEGKPIFMSSAGAEAFKAAMAKNPLKFTVEGDNDIKLFPENDEPANILNFKRGLISALAAPVLEEDRNRRMPTVYGMCRTDYSVNARQDIAT--DVVLNRDLSNCDKFSPVKDHTSPLALITGMQY---PLAQLIRSSQ-TCNYKFDNDQKHMTSASCSEKHMLLPFSYKGEHGVSNVGKQALTLVGVSVYN-------GRIFDHNEANMKTLHLDDSIDSVHPIQDKDAILSILRDLNDLSETTNGENRAHLAHKLISTIRKMSAESL---------SAALPEALEISRPLVYQALFQCGTPECTSAILRVLRTFDRSSVEIDAAVYAMGMVPN-PSRDLVEEMLEMAKFKS-SKPIYYALSNAVKRLYEVEKSVT----PEIKAVADYTLEQI-GDCTGNQE-------HVYLSLRVIGNMAAAVGAASPALKSAVIQCINQPAASPEVQQAAIQVFRLTSVPDEGREVLMKVIFDKAAPIQKRVAAYLIVMKDPQPTELAQLVAALPNNKNCQAMSFVNSHLRNILSSTTSETGELRVKILNALQGNEISTSTDPTK--FSRN---------YKIGSLEGNVIFESEELLPNEVILEMTLNAFGYDVDMFEIGLNGKGLEPTVDALIGIDGFFRDTMQKTINYAADKVPRGNDIMQSMFPTLWNNIKMQKAPQ------SIVKEITNNVNKLIQKLKVQDNPEAMIYLRLLGAEMGYLKTNDVEDMAYSAALLTKSLLNMFPTDFLRNLYSSVNNNLFLHYVFMDNEFYLPTGTGIPLRVALSGTFAPGVKGGLKLARDMSEVAFMPSAGVEFVTEVGALLPEYVESGL--EMHTNIYHES-----GLKVKV-AVTNKQFKLTIPT------------PKTSTKLISVSNSLYSVTGTEIKRIPPLAEHVKARK-CTP----FIPGFQYCG 936          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Zebrafish
Match: apobb.1 (apolipoprotein Bb, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9732])

HSP 1 Score: 79.337 bits (194), Expect = 1.816e-13
Identity = 190/925 (20.54%), Postives = 366/925 (39.57%), Query Frame = 2
Query:  374 SPNSYKFKSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTSHGKCFITSSEKSPKEETNPNSVNFQYDLQTCDN-----------KMISNSLFGDITRSVIFKTSQVSCKYLY-KDQSNLVSIRCREE-------YKTATIKTNEN-QMVVEITTNIYKENQLPSPDRTFT-NKNMFETGXXXXXXXXXXXXSPYSAAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLG-SLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLN----KCITKDTNKLSIRISALEVMKHMDC-KQDRSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESN----DQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTNNYGV-NFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGY---------------------------------LKKEKGAQENLELINILNEMSGSVN-----IKLFGNQVSFIEL-IRGTLSSVKKYNIIEEIMYWSQ--DKSL------DFNKNLQ------------LVDKTVVIPTLLGFPLKFKLQGSAAINIK--IKSKFDVAGLVSWP---------ISVNIDNYISPNINAELHTEIVYQTPFTNYGMRMKLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFSVEGNAYVIHRD--KEIIQLQDKLKEIKMCTSEMTVRILGIRVCG 2836
            S  +  FK+A+  N + FT E +    +  + +EP    N K+ ++ +LA   ++   +    T +G C    S  + ++      V    DL  CD             +I+   +     + + ++SQ +C Y +  DQ ++ S  C E+       YK     +N   Q +  +  ++Y         R F  N+   +T       +         A  + L+D+    +++       L  +L++ +++++++           S   PE     + + Y A     T    S ++ +++T   S  + +  + ++  +   PS + ++E+  +    + S P++ +L  ++  LY  E+  +    P I ++    L  + GDC+  ++        + +SL+ +GN+          L     +CI +      ++ +A++V +      + R   + ++ +     + R+ AYL VM       L ++   L   K  Q  SF+ +HL NI  S      +L+  I + L   ++    D +K  FSRN         Y + + + NVIF  +  +P  V L  T + F    +  E+    +GLE  +  + G +G+                                 +K +K  Q      +I+ E++ +VN     +K+  N  + I L + G      K N +E++ Y +    KSL      DF +NL              +D    +PT  G PL+  L G+ A  +K  +K   D++ +   P         +   +  Y+   +  E+HT I +++     G+++K+ + TN +FK TI T            PKT+  + SV  + Y +     K I  L + +K  K CT      I G + CG
Sbjct:    3 SAGAEAFKAAMAKNPLKFTVEGDNDIKLFPENDEPANILNFKRGLISALAAPVLEEDRNRRMPTVYGMCRTDYSVNARQDIAT--DVVLNRDLSNCDKFSPVKDHTSPLALITGMQY---PLAQLIRSSQ-TCNYKFDNDQKHMTSASCSEKHMLLPFSYKGEHGVSNVGKQALTLVGVSVYN-------GRIFDHNEANMKTLHLDDSIDSVHPIQDKDAILSILRDLNDLSETTNGENRAHLAHKLISTIRKMSAESL---------SAALPEALEISRPLVYQALFQCGTPECTSAILRVLRTFDRSSVEIDAAVYAMGMVPN-PSRDLVEEMLEMAKFKS-SKPIYYALSNAVKRLYEVEKSVT----PEIKAVADYTLEQI-GDCTGNQE-------HVYLSLRVIGNMAAAVGAASPALKSAVIQCINQPAASPEVQQAAIQVFRLTSVPDEGREVLMKVIFDKAAPIQKRVAAYLIVMKDPQPTELAQLVAALPNNKNCQAMSFVNSHLRNILSSTTSETGELRVKILNALQGNEISTSTDPTK--FSRN---------YKIGSLEGNVIFESEELLPNEVILEMTLNAFGYDVDMFEIGLNGKGLEPTVDALIGIDGFFRDTMQKTINYAADKVPRGNDIMQSMFPTLWNNIKMQKAPQ------SIVKEITNNVNKLIQKLKVQDNPEAMIYLRLLGAEMGYLKTNDVEDMAYSAALLTKSLLNMFPTDFLRNLYSSVNNNLFLHYVFMDNEFYLPTGTGIPLRVALSGTFAPGVKGGLKLARDMSEVAFMPSAGVEFVTEVGALLPEYVESGL--EMHTNIYHES-----GLKVKV-AVTNKQFKLTIPT------------PKTSTKLISVSNSLYSVTGTEIKRIPPLAEHVKARK-CTP----FIPGFQYCG 849          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Zebrafish
Match: vtg3 (vitellogenin 3, phosvitinless [Source:ZFIN;Acc:ZDB-GENE-991019-2])

HSP 1 Score: 70.0922 bits (170), Expect = 8.830e-11
Identity = 108/504 (21.43%), Postives = 212/504 (42.06%), Query Frame = 2
Query: 1355 LFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTN---KLSIRI--SALEVMKHMDCKQDRSS---ALSILLNNENDSELRINAYLTVMGCSDINTLFKV-REILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLK---KEFDISKLKFSRNIEKTFLTNNYGVNFDSNV-IFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYLKKEKGAQENLELINILNEMSG--------SVNIKLFGNQVSFIELIRGTLSSV---------KKYNIIEEIMYWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDV--------AGLVSWPISVNIDNYISPNINAELHTEIVYQTPFTNYGMRMKLKSGTNTEFKATIFTNKNEE-LSVKFDSPKTTQNIFSVEGNAYVIHRDKE 2749
            + L+ GSL H YC         DP   ++V   L N+    S+ K++ D+ V    ++LK LGN  +   +   TL K +   +N   KLS R+  +A++  + +  +   S     L++ +     +E+R+ A + ++       L  V  E+L +E   QV SF ++ L    +S     +++  +  ++ +K   ++      ++S+N+   +  +++     ++V +   +S +P  + L        +   FLE   R +GL+D LF    PE  L K+ G  +   ++ IL+            +   ++FG +   +++ R ++ S+         K+  + E I    +  S  + K   + +   + PT LG P++     S    + +K+K ++          L+S  IS+  D +I    +  L   I   T     G  +K K      +   +  N  E+   +     K+   +FSV  N Y + R+ E
Sbjct:  435 VVLAYGSLVHRYC------VYTDPCPITVVQPLL-NMAAS-SLSKNSEDEMV----LALKSLGNAAHL--SSFKTLLKFLPGYSNGAEKLSTRVQGAAVQAFRLLASRASHSVQDIVLNLFVQKHLPAEIRMLACIVLLETKPSTALISVVSEVLLEEADLQVASFSYSLLKGFAKSRTPDNQHL-SIACNIAMKILTRKLGHLSYRYSKNLHFDWFHDDFLFGTSADVYMLQNESPIPTKLMLKGKFHFIGRILQFLEFGIRADGLKD-LFAGKIPE--LTKDLGISDLASILKILSNWQSLPKDKPLLTAYARVFGQEAFLMDVSRDSVQSIIKSFSPSAGKESKVWERIQDVQKGTSWHWTKPHLVYEARFIQPTCLGLPVEISKYYSVVNAVTMKAKAEINPPPKEHLGELLSSDISMQTDGFIGVTKDHFLFHGI--NTDLFQCGTELKSKVSMGLPWAFDLKINPKEQTYEMNLTPSKSVTELFSVSSNVYAVLRNIE 918          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Xenopus
Match: fosb (FBJ murine osteosarcoma viral oncogene homolog B [Source:Xenbase;Acc:XB-GENE-6258697])

HSP 1 Score: 149.828 bits (377), Expect = 1.536e-34
Identity = 78/215 (36.28%), Postives = 123/215 (57.21%), Query Frame = 2
Query: 1499 DDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQDRSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTNNYGVNFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFG 2143
            D+ + K+Q+ LK +GN      ++I  L  C    +N  SIR++A+E  + + C  +R+    +  +   + E+RI +Y T M C     L  VR++L  EK  QVGSF+W+HL+ + ES+D LK++I D L D  L K+F+    K+S   + T L+ + G N ++++IF+  SF+PRS   N T     ++ N LE   RLE  EDLL ++FG
Sbjct:   17 DEQIHKMQLILKAIGNAGLAAESLIPVLTSCAFLRSNPDSIRLAAVEAFRRIPCSANRTILAELYQSVHKNEEIRIASYYTAMKCPTQEFLHIVRQMLKHEKSMQVGSFVWSHLSQLLESDDPLKQDIADSLPDDILSKDFEGEFWKYSSYSDATVLSESAGANVEASMIFTPSSFIPRSAMANLTIHAMGRAMNILEFGIRLENAEDLLKRMFG 231          

HSP 2 Score: 95.9005 bits (237), Expect = 3.036e-18
Identity = 77/262 (29.39%), Postives = 127/262 (48.47%), Query Frame = 2
Query: 15878 FETYAT-ISKRSVMTFDKASFTLSPDSCRVLLSKDLKFKKWEIIMNQQNNKQMFTINIGSNTFELSA-SNYKVNLNGKPSDLPIQIGSTSLVGLGRMMKLKDDKLGLTITIDPVNEMFTVGISGWYHGKVRGLFGNSDNEQFNDFML-DNGKIVSNEVFMKEISYKSQSCKVVSDEEQTVVKPIKGCPFI-RRMVCKFLFKCPFSPLAACFNKVNPKKFHKLCVHSTEEVLTKLDPSICKAARQYQAQCQKAGVNIQVPPPC 16651
            FE +A  I  + V+TFD     ++   C +LL+KD  + K+ +I+NQ     M ++++  N   +      K+  N +  DLP+      +      +++ + + G+T+  D  +++ +  + GWYHG   GLFG +DNE  NDF+L D+    S + F    S K Q    V  +  +  K IK CP    + +CK LF+   S L  CF  + P+ F+  CV    +   ++ P IC  A  Y   C +  V I++P  C
Sbjct: 3179 FEYHAVLIGNKHVVTFDGILLNVA-SKCSLLLAKDFMYNKFTLILNQ-GGGTMRSLHVDMNHVSVDIYPGLKIEENCQRLDLPVYKNGIFIKKDANHIEVANQE-GITVQCDIYHDICSFTLEGWYHGISAGLFGTNDNESGNDFLLPDHSHTNSTQDF----SLKWQ----VDTQCSSGRKKIKACPTSPHQKLCKALFQGSNSVLRNCFRVIYPQPFYNACVEDICDS-NEIKP-ICNLAAAYVHLCNRNFVPIEIPLQC 3427          

HSP 3 Score: 77.7962 bits (190), Expect = 7.142e-13
Identity = 78/342 (22.81%), Postives = 149/342 (43.57%), Query Frame = 2
Query: 2129 FKIFGPEGYLKKEKGAQENLE--LINILNEMSGSVNIKLFGNQVSFIELIRGTLSSVKKYNI--IEEIMYWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLVSWPISVNIDNYISPNINAELHTEIVYQTPFTNYGMRMKLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFSVEGNAYVIHRDK-EIIQLQDKLKEIKMCTSEMTVRILGIRVCGEAKVLDPSTRKDALLF-----GPFAANVFIEKIDTQTEYILLATSKTSAFISQTGKVYSNRH-IKFEFNTPNSKFYNRRFYG-EILMDFKQKEFKLELVTP 3118
            FK   P G   K    Q+     + +I NE+   +++K+FGN+++F++   G   ++K+Y++   E  +   + + + ++K + L  + +  PTL GFP++  L  + + ++KI+   D+    ++     I+ YI P+   +L +++         G+R        +     I   K +EL +  ++P  +  I       Y +  D  + I      KE K C +E   ++ G + C     LD S  +D  L      GP   ++ + K D      LL  S     I Q      N   + F   TP S+   RR  G ++  + + ++F++ L+ P
Sbjct:  289 FKHSCPSGKYNKINEIQQKFTKGMKSITNELKCGLSMKIFGNELNFLD-CEGVKQTIKQYSLSMAELAVRLLKGQEVQYSKRMGLATEEITFPTLSGFPVQLSLNATLSTSVKIRGNMDIKQQANF----YINGYIKPSALIQLSSQMGIVGTVGKMGLRWVTGLKAMSSVDGGIQMKKGQELKIFLNTPDESMEILDFSSTLYQVTPDGLKTISNPIYQKERKACMNEEVSKLFGWQPC-----LDVSYPEDESLLPFPLSGPVKVSLVLRKQDKGLRQYLLEASYNQ--IPQKDDWIPNEATLHFFMGTPKSEI--RRDVGIDLHYNIQHRKFRITLLHP 616          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Xenopus
Match: fosb (FBJ murine osteosarcoma viral oncogene homolog B [Source:Xenbase;Acc:XB-GENE-6258697])

HSP 1 Score: 149.443 bits (376), Expect = 1.751e-34
Identity = 78/215 (36.28%), Postives = 123/215 (57.21%), Query Frame = 2
Query: 1499 DDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQDRSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTNNYGVNFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFG 2143
            D+ + K+Q+ LK +GN      ++I  L  C    +N  SIR++A+E  + + C  +R+    +  +   + E+RI +Y T M C     L  VR++L  EK  QVGSF+W+HL+ + ES+D LK++I D L D  L K+F+    K+S   + T L+ + G N ++++IF+  SF+PRS   N T     ++ N LE   RLE  EDLL ++FG
Sbjct:   17 DEQIHKMQLILKAIGNAGLAAESLIPVLTSCAFLRSNPDSIRLAAVEAFRRIPCSANRTILAELYQSVHKNEEIRIASYYTAMKCPTQEFLHIVRQMLKHEKSMQVGSFVWSHLSQLLESDDPLKQDIADSLPDDILSKDFEGEFWKYSSYSDATVLSESAGANVEASMIFTPSSFIPRSAMANLTIHAMGRAMNILEFGIRLENAEDLLKRMFG 231          

HSP 2 Score: 95.9005 bits (237), Expect = 2.858e-18
Identity = 77/262 (29.39%), Postives = 127/262 (48.47%), Query Frame = 2
Query: 15878 FETYAT-ISKRSVMTFDKASFTLSPDSCRVLLSKDLKFKKWEIIMNQQNNKQMFTINIGSNTFELSA-SNYKVNLNGKPSDLPIQIGSTSLVGLGRMMKLKDDKLGLTITIDPVNEMFTVGISGWYHGKVRGLFGNSDNEQFNDFML-DNGKIVSNEVFMKEISYKSQSCKVVSDEEQTVVKPIKGCPFI-RRMVCKFLFKCPFSPLAACFNKVNPKKFHKLCVHSTEEVLTKLDPSICKAARQYQAQCQKAGVNIQVPPPC 16651
            FE +A  I  + V+TFD     ++   C +LL+KD  + K+ +I+NQ     M ++++  N   +      K+  N +  DLP+      +      +++ + + G+T+  D  +++ +  + GWYHG   GLFG +DNE  NDF+L D+    S + F    S K Q    V  +  +  K IK CP    + +CK LF+   S L  CF  + P+ F+  CV    +   ++ P IC  A  Y   C +  V I++P  C
Sbjct: 3134 FEYHAVLIGNKHVVTFDGILLNVA-SKCSLLLAKDFMYNKFTLILNQ-GGGTMRSLHVDMNHVSVDIYPGLKIEENCQRLDLPVYKNGIFIKKDANHIEVANQE-GITVQCDIYHDICSFTLEGWYHGISAGLFGTNDNESGNDFLLPDHSHTNSTQDF----SLKWQ----VDTQCSSGRKKIKACPTSPHQKLCKALFQGSNSVLRNCFRVIYPQPFYNACVEDICDS-NEIKP-ICNLAAAYVHLCNRNFVPIEIPLQC 3382          

HSP 3 Score: 77.7962 bits (190), Expect = 7.952e-13
Identity = 78/342 (22.81%), Postives = 149/342 (43.57%), Query Frame = 2
Query: 2129 FKIFGPEGYLKKEKGAQENLE--LINILNEMSGSVNIKLFGNQVSFIELIRGTLSSVKKYNI--IEEIMYWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLVSWPISVNIDNYISPNINAELHTEIVYQTPFTNYGMRMKLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFSVEGNAYVIHRDK-EIIQLQDKLKEIKMCTSEMTVRILGIRVCGEAKVLDPSTRKDALLF-----GPFAANVFIEKIDTQTEYILLATSKTSAFISQTGKVYSNRH-IKFEFNTPNSKFYNRRFYG-EILMDFKQKEFKLELVTP 3118
            FK   P G   K    Q+     + +I NE+   +++K+FGN+++F++   G   ++K+Y++   E  +   + + + ++K + L  + +  PTL GFP++  L  + + ++KI+   D+    ++     I+ YI P+   +L +++         G+R        +     I   K +EL +  ++P  +  I       Y +  D  + I      KE K C +E   ++ G + C     LD S  +D  L      GP   ++ + K D      LL  S     I Q      N   + F   TP S+   RR  G ++  + + ++F++ L+ P
Sbjct:  289 FKHSCPSGKYNKINEIQQKFTKGMKSITNELKCGLSMKIFGNELNFLD-CEGVKQTIKQYSLSMAELAVRLLKGQEVQYSKRMGLATEEITFPTLSGFPVQLSLNATLSTSVKIRGNMDIKQQANF----YINGYIKPSALIQLSSQMGIVGTVGKMGLRWVTGLKAMSSVDGGIQMKKGQELKIFLNTPDESMEILDFSSTLYQVTPDGLKTISNPIYQKERKACMNEEVSKLFGWQPC-----LDVSYPEDESLLPFPLSGPVKVSLVLRKQDKGLRQYLLEASYNQ--IPQKDDWIPNEATLHFFMGTPKSEI--RRDVGIDLHYNIQHRKFRITLLHP 616          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Xenopus
Match: ddx6 (DEAD-box helicase 6 [Source:Xenbase;Acc:XB-GENE-922227])

HSP 1 Score: 103.605 bits (257), Expect = 1.324e-20
Identity = 189/925 (20.43%), Postives = 371/925 (40.11%), Query Frame = 2
Query:  173 FKPGQKYVYSYEGESNIKTTKGSYETTGVKIKSKVTITGLSNCEMKLSLSDV---QIFDKTSSDGNQFKESPNSYKFKSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTSHGKCFITSSEKSPKEETN-PNSVNFQYDLQTCD------NKMISNSLFGDITR--SVIFKTSQVSCKY-LYKDQSNLVSIRCREEYKTATIKTNENQMV-VEITTNIYKENQLPSPDRTFTNKNMFETGXXXXXXXXXXXXSPYSAAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQK--SDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCK--EEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQDRSSALSILLNNENDSEL-RINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVD-LKKEFDISKL----KFSRNIEKTFLTNNYGVNFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGY-----------------------LKKEKGAQENLELINI---LNEM------SGSVNIKLFGNQVSFIEL---------IRGTLSSVKKYNIIEEIM-YWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLVSWPISVNIDNYISPNINAELHTEIVYQTP-FTNYGMRMKLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFSVEGNAYVIHRDK 2746
            FK  +KYVY+YE  +    +  +   +G K   KV +    +C   L +      +++  +S      K+S NS  F +A+   ++  T +  +   +  D +EP+   N+K+ IL +L     +T+   Y  T +GKC  TS  K    + N P  V  + +L+TCD      + +   ++   + R  S +  +SQV C+Y L   + ++    C E +        +   +  ++T  +  E+   +  R F        G      +  ++     AA   L+++     S ++ +    F +LV  L+ LN+     L   L +  S I  +  T+             T      ++ ++++  IS    +     L  +   P  + ++EL  +    +     +    +L+H   K  EE ++  ++  +  +    L  +  +C+  +D T  + T   I + G       P  + ++L KC     +   I+ +A++  + M    D    L  +  + N  E  R+ AYL +M     + L KV ++L ++   QV +F+ +H+ NI      LK  +++ L     L  + D +KL     FSR++    L +  G +  +N+IF  + ++P+   L  T ++F KS +  E+    +G E  L  +FG  G+                       L K  G      L N+   + E+         + +++ G ++ +++L         +  TL + ++  +  +IM   S+    D   +   +D    +PT  G  L+    G  A   +   KF          ++  +  + P +  E  T++  Q P F+ + + M       + F+   F+ K  +L     +PKT   +FS+     ++   K
Sbjct:   58 FKHLRKYVYNYEAATTSGVSGTADSQSGTKFNCKVELEVPQSCNFILRVKQCTLREVYGVSSEGKALLKKSKNSEDFSNAMTKYEVKVTVQDGKNVVLYPDKDEPLNVLNMKRGILSALLVD--ETQETDYMDTVYGKC--TSEIKVTGRKGNTPTDVTVKRNLKTCDRFTPIRDYVNPLAIIKGMNRPLSTLISSSQV-CQYSLDPKRRHITEASCAETHLFLPFSYRDQYGINGKVTQTLKLEDVAKTNSRDFDPDTSLARGFALEATKTVSKNE--DAALENLQELQKLSTSEQNQQRASRFYKLVTALRGLNNDSLGPLVPRLMQLSSPIALQALTQ-----------CGTPECFGGILQVLRSGDISPVISDTVTFGLGLLPS-PCTKRVRELLNMAQYQSSRASFY----ALSHAVSKFYEEQQTVTDE--LRDVADFMLSLIGNECTGNEDKT--FQTLKAIGIMGSAMEATNPE-IKSSLLKCARGQASSPDIQKAAIQAFRRMTMTDDVRGVLVQVFQDSNAPEQKRLAAYLMLMKNPSQSDLRKVVKVLLRDDNKQVKNFVSSHIRNI-----LLKTKLQEALKSSQPLNVDTDFTKLSQNYHFSRDVTIPGLYDAAGADMVANIIFDSEGYMPKEAMLEATLNVFGKSVDMFEIGVEGKGFEPTLDSLFGNGGFFPDCTLKALYWADGKLPDKVTEILFKWYGVPRQTILYNVEKLIKEVRSNYAPEAKLYLEILGKELGYLQLNDFRTLGSMLLRTLHTTQE--LPAQIMKAISKGAETDLFLHYIFMDNEFDLPTGSGLQLQVSFSGVIAPGTRAGMKFGGR-------NIRAELSMKPAVAVEFVTQMGIQIPEFSRHAVLMNTNLYHESGFEGR-FSMKEGQLKFSIPAPKTPTKLFSIRNQLNLVFASK 939          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Xenopus
Match: ddx6 (DEAD-box helicase 6 [Source:Xenbase;Acc:XB-GENE-922227])

HSP 1 Score: 102.449 bits (254), Expect = 2.618e-20
Identity = 189/925 (20.43%), Postives = 371/925 (40.11%), Query Frame = 2
Query:  173 FKPGQKYVYSYEGESNIKTTKGSYETTGVKIKSKVTITGLSNCEMKLSLSDV---QIFDKTSSDGNQFKESPNSYKFKSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTSHGKCFITSSEKSPKEETN-PNSVNFQYDLQTCD------NKMISNSLFGDITR--SVIFKTSQVSCKY-LYKDQSNLVSIRCREEYKTATIKTNENQMV-VEITTNIYKENQLPSPDRTFTNKNMFETGXXXXXXXXXXXXSPYSAAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQK--SDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCK--EEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQDRSSALSILLNNENDSEL-RINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVD-LKKEFDISKL----KFSRNIEKTFLTNNYGVNFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGY-----------------------LKKEKGAQENLELINI---LNEM------SGSVNIKLFGNQVSFIEL---------IRGTLSSVKKYNIIEEIM-YWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLVSWPISVNIDNYISPNINAELHTEIVYQTP-FTNYGMRMKLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFSVEGNAYVIHRDK 2746
            FK  +KYVY+YE  +    +  +   +G K   KV +    +C   L +      +++  +S      K+S NS  F +A+   ++  T +  +   +  D +EP+   N+K+ IL +L     +T+   Y  T +GKC  TS  K    + N P  V  + +L+TCD      + +   ++   + R  S +  +SQV C+Y L   + ++    C E +        +   +  ++T  +  E+   +  R F        G      +  ++     AA   L+++     S ++ +    F +LV  L+ LN+     L   L +  S I  +  T+             T      ++ ++++  IS    +     L  +   P  + ++EL  +    +     +    +L+H   K  EE ++  ++  +  +    L  +  +C+  +D T  + T   I + G       P  + ++L KC     +   I+ +A++  + M    D    L  +  + N  E  R+ AYL +M     + L KV ++L ++   QV +F+ +H+ NI      LK  +++ L     L  + D +KL     FSR++    L +  G +  +N+IF  + ++P+   L  T ++F KS +  E+    +G E  L  +FG  G+                       L K  G      L N+   + E+         + +++ G ++ +++L         +  TL + ++  +  +IM   S+    D   +   +D    +PT  G  L+    G  A   +   KF          ++  +  + P +  E  T++  Q P F+ + + M       + F+   F+ K  +L     +PKT   +FS+     ++   K
Sbjct:   58 FKHLRKYVYNYEAATTSGVSGTADSQSGTKFNCKVELEVPQSCNFILRVKQCTLREVYGVSSEGKALLKKSKNSEDFSNAMTKYEVKVTVQDGKNVVLYPDKDEPLNVLNMKRGILSALLVD--ETQETDYMDTVYGKC--TSEIKVTGRKGNTPTDVTVKRNLKTCDRFTPIRDYVNPLAIIKGMNRPLSTLISSSQV-CQYSLDPKRRHITEASCAETHLFLPFSYRDQYGINGKVTQTLKLEDVAKTNSRDFDPDTSLARGFALEATKTVSKNE--DAALENLQELQKLSTSEQNQQRASRFYKLVTALRGLNNDSLGPLVPRLMQLSSPIALQALTQ-----------CGTPECFGGILQVLRSGDISPVISDTVTFGLGLLPS-PCTKRVRELLNMAQYQSSRASFY----ALSHAVSKFYEEQQTVTDE--LRDVADFMLSLIGNECTGNEDKT--FQTLKAIGIMGSAMEATNPE-IKSSLLKCARGQASSPDIQKAAIQAFRRMTMTDDVRGVLVQVFQDSNAPEQKRLAAYLMLMKNPSQSDLRKVVKVLLRDDNKQVKNFVSSHIRNI-----LLKTKLQEALKSSQPLNVDTDFTKLSQNYHFSRDVTIPGLYDAAGADMVANIIFDSEGYMPKEAMLEATLNVFGKSVDMFEIGVEGKGFEPTLDSLFGNGGFFPDCTLKALYWADGKLPDKVTEILFKWYGVPRQTILYNVEKLIKEVRSNYAPEAKLYLEILGKELGYLQLNDFRTLGSMLLRTLHTTQE--LPAQIMKAISKGAETDLFLHYIFMDNEFDLPTGSGLQLQVSFSGVIAPGTRAGMKFGGR-------NIRAELSMKPAVAVEFVTQMGIQIPEFSRHAVLMNTNLYHESGFEGR-FSMKEGQLKFSIPAPKTPTKLFSIRNQLNLVFASK 939          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Xenopus
Match: ddx6 (DEAD-box helicase 6 [Source:Xenbase;Acc:XB-GENE-922227])

HSP 1 Score: 101.293 bits (251), Expect = 2.945e-20
Identity = 146/688 (21.22%), Postives = 288/688 (41.86%), Query Frame = 2
Query:  173 FKPGQKYVYSYEGESNIKTTKGSYETTGVKIKSKVTITGLSNCEMKLSLSDV---QIFDKTSSDGNQFKESPNSYKFKSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTSHGKCFITSSEKSPKEETN-PNSVNFQYDLQTCD------NKMISNSLFGDITR--SVIFKTSQVSCKY-LYKDQSNLVSIRCREEYKTATIKTNENQMV-VEITTNIYKENQLPSPDRTFTNKNMFETGXXXXXXXXXXXXSPYSAAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQK--SDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNG-DCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQDRSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDV-----DLKKEFDISKL----KFSRNIEKTFLTNNYGVNFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYL 2158
            FK  +KYVY+YE  +    +  +   +G K   KV +    +C   L +      +++  +S      K+S NS  F +A+   ++  T +  +   +  D +EP+   N+K+ IL +L     +T+   Y  T +GKC  TS  K    + N P  V  + +L+TCD      + +   ++   + R  S +  +SQV C+Y L   + ++    C E +        +   +  ++T  +  E+   +  R F        G      +  ++     AA   L+++     S ++ +    F +LV  L+ LN+     L   L +  S I  +  T+             T      ++ ++++  IS    +     L  +   P  + ++EL  +    +     +    +L+H   ++       D      V+ F+ +L G +C+  +D T  + T   I + G       P  + ++L KC     +   I+ +A++  + M    D    + +  ++    + R+ AYL +M     + L KV ++L ++   QV +F+ +H+ NI + +    E ++  L +       L  + D +KL     FSR++    L +  G +  +N+IF  + ++P+   L  T ++F KS +  E+    +G E  L  +FG  G+ 
Sbjct:   38 FKHLRKYVYNYEAATTSGVSGTADSQSGTKFNCKVELEVPQSCNFILRVKQCTLREVYGVSSEGKALLKKSKNSEDFSNAMTKYEVKVTVQDGKNVVLYPDKDEPLNVLNMKRGILSALLVD--ETQETDYMDTVYGKC--TSEIKVTGRKGNTPTDVTVKRNLKTCDRFTPIRDYVNPLAIIKGMNRPLSTLISSSQV-CQYSLDPKRRHITEASCAETHLFLPFSYRDQYGINGKVTQTLKLEDVAKTNSRDFDPDTSLARGFALEATKTVSKNE--DAALENLQELQKLSTSEQNQQRASRFYKLVTALRGLNNDSLGPLVPRLMQLSSPIALQALTQ-----------CGTPECFGGILQVLRSGDISPVISDTVTFGLGLLPS-PCTKRVRELLNMAQYQSSRASFY----ALSHAVKQQTVTDELRD------VADFMLSLIGNECTGNEDKT--FQTLKAIGIMGSAMEATNPE-IKSSLLKCARGQASSPDIQKAAIQAFRRMTMTDDVRVLVQVFQDSNAPEQKRLAAYLMLMKNPSQSDLRKVVKVLLRDDNKQVKNFVSSHIRNILQMDAPEAEGLKTKLQEALKSSQPLNVDTDFTKLSQNYHFSRDVTIPGLYDAAGADMVANIIFDSEGYMPKEAMLEATLNVFGKSVDMFEIGVEGKGFEPTLDSLFGNGGFF 693          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Mouse
Match: Apob (apolipoprotein B [Source:MGI Symbol;Acc:MGI:88052])

HSP 1 Score: 99.3673 bits (246), Expect = 1.979e-19
Identity = 160/719 (22.25%), Postives = 307/719 (42.70%), Query Frame = 2
Query:  137 CSMKCSFEEDRIFKPGQKYVYSYEGESN--IKTTKGSYETTGVKIKSKVTITGLSNCEMKL---SLSDVQIFDKTSSDGNQF-KESPNSYKFKSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSL--ANQGIQTKPDSYKKTSHGKCFITSSEKSPKEETNPNSVNFQYDLQTCDN-KMISNS-----LFGDITR--SVIFKTSQVSCKYLYKDQSNLVS-IRCREEYKTATIK-TNENQMVVEITTNIYKENQLPSPDRTFTNKNMFETGXXXXXXXXXXXXSPYSAAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELY---------LELQKSDIC--PEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLN----KCITKDTNKLSIRISALEVMKHMDCKQD-RSSALSILLNNENDSELRINAYLTVM---GCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFD--ISKLKFSRN--IEKTF---LTNNYGVNFDSNVIFSEKSFVPRSVSLNTTASIFS-KSTNFLEMSARLEGLEDLLFKIFGPEGYL 2158
             S  C  +  R FK  +KYVY+YE ES+  ++ T  S   T +  K ++ +  +    M+    +L +V  F+    +G    K++ NS +F +A+   ++       +   +  D +EP +  NIK+ I+ +L    +  + + + +  T +G C    +  S ++ T P  ++ + +LQ CD  + IS S     L   +    S +  +SQ +C+Y    +   VS   C E++        N+  ++  +T  +  E+  P  +  F ++     G+     +  +      A   TL+++     S ++++   LF +LV  L+ L  +    L          + LQ    C  P+  T I         ++ T  +  ++VD++              T L  +   PS + L+E+            L+    +L+H             P++  I    L  ++ +C+  +D T        + L+ +GN+      V+  L      C+      L I+ +AL+ ++ M+ + + R+      +N     E R+ AYL +M     SDIN   K+ ++L  E+  QV +F+ +H+ NI  S +   ++++ L+ +     +F   +   KFSRN  I K+    + +   V  + N+IF   S++PR   L TT ++F   S +  E+    +G E  L  +FG +G+ 
Sbjct:   35 LSFSCPKDATR-FKHLRKYVYNYEAESSSGVQGTADSRSATKINCKVELEVPQICGFIMRTNQCTLKEVYGFN---PEGKALMKKTKNSEEFAAAMSRYELKLAIPEGKQIVLYPDKDEPKYILNIKRGIISALLVPPETEEDQQELFLDTVYGNCSTQVTVNS-RKGTVPTEMSTERNLQQCDGFQPISTSVSPLALIKGLVHPLSTLISSSQ-TCQYTLDPKRKHVSEAVCDEQHLFLPFSYKNKYGIMTRVTQKLSLEDT-PKINSRFFSEGTNRMGLAFESTKSTSSPKQADAVLKTLQELKKLSISEQNAQRANLFNKLVTELRGLTGEAITSLLPQLIEVSSPITLQALVQCGQPQCYTHILQ-------WLKTEKAHPLLVDIV--------------TYLMALIPNPSTQRLQEIFNTAKEQQSRATLY----ALSHAVNSYFDVDHSRSPVLQDIAGYLLKQIDNECTGNEDHT-------FLILRVIGNMGRTMEQVMPALKSSVLSCVRSTKPSLLIQKAALQALRKMELEDEVRTILFDTFVNGVAPVEKRLAAYLLLMKNPSSSDIN---KIAQLLQWEQSEQVKNFVASHIANILNSEELYVQDLKVLIKNALENSQFPTIMDFRKFSRNYQISKSASLPMFDPVSVKIEGNLIFDPSSYLPRESLLKTTLTVFGLASLDLFEIGLEGKGFEPTLEALFGKQGFF 711          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Mouse
Match: Apob (apolipoprotein B [Source:MGI Symbol;Acc:MGI:88052])

HSP 1 Score: 98.2117 bits (243), Expect = 3.992e-19
Identity = 160/709 (22.57%), Postives = 302/709 (42.60%), Query Frame = 2
Query:  173 FKPGQKYVYSYEGESN--IKTTKGSYETTGVKIKSKVTITGLSNCEMKL---SLSDVQIFDKTSSDGNQF-KESPNSYKFKSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSL--ANQGIQTKPDSYKKTSHGKCFITSSEKSPKEETNPNSVNFQYDLQTCDN-KMISNS-----LFGDITR--SVIFKTSQVSCKYLYKDQSNLVS-IRCREEYKTATIK-TNENQMVVEITTNIYKENQLPSPDRTFTNKNMFETGXXXXXXXXXXXXSPYSAAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELY---------LELQKSDIC--PEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLN----KCITKDTNKLSIRISALEVMKHMDCKQD-RSSALSILLNNENDSELRINAYLTVM---GCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESND----QLKENIRDLLDDVDLKKEFDISKLKFSRN--IEKTF---LTNNYGVNFDSNVIFSEKSFVPRSVSLNTTASIFS-KSTNFLEMSARLEGLEDLLFKIFGPEGYL 2158
            FK  +KYVY+YE ES+  ++ T  S   T +  K ++ +  +    M+    +L +V  F+    +G    K++ NS +F +A+   ++       +   +  D +EP +  NIK+ I+ +L    +  + + + +  T +G C    +  S ++ T P  ++ + +LQ CD  + IS S     L   +    S +  +SQ +C+Y    +   VS   C E++        N+  ++  +T  +  E+  P  +  F ++     G+     +  +      A   TL+++     S ++++   LF +LV  L+ L  +    L          + LQ    C  P+  T I         ++ T  +  ++VD++              T L  +   PS + L+E+            L+    +L+H             P++  I    L  ++ +C+  +D T        + L+ +GN+      V+  L      C+      L I+ +AL+ ++ M+ + + R+      +N     E R+ AYL +M     SDIN   K+ ++L  E+  QV +F+ +H+ NI  S +     LK  I++ L++       D    KFSRN  I K+    + +   V  + N+IF   S++PR   L TT ++F   S +  E+    +G E  L  +FG +G+ 
Sbjct:   33 FKHLRKYVYNYEAESSSGVQGTADSRSATKINCKVELEVPQICGFIMRTNQCTLKEVYGFN---PEGKALMKKTKNSEEFAAAMSRYELKLAIPEGKQIVLYPDKDEPKYILNIKRGIISALLVPPETEEDQQELFLDTVYGNCSTQVTVNS-RKGTVPTEMSTERNLQQCDGFQPISTSVSPLALIKGLVHPLSTLISSSQ-TCQYTLDPKRKHVSEAVCDEQHLFLPFSYKNKYGIMTRVTQKLSLEDT-PKINSRFFSEGTNRMGLAFESTKSTSSPKQADAVLKTLQELKKLSISEQNAQRANLFNKLVTELRGLTGEAITSLLPQLIEVSSPITLQALVQCGQPQCYTHILQ-------WLKTEKAHPLLVDIV--------------TYLMALIPNPSTQRLQEIFNTAKEQQSRATLY----ALSHAVNSYFDVDHSRSPVLQDIAGYLLKQIDNECTGNEDHT-------FLILRVIGNMGRTMEQVMPALKSSVLSCVRSTKPSLLIQKAALQALRKMELEDEVRTILFDTFVNGVAPVEKRLAAYLLLMKNPSSSDIN---KIAQLLQWEQSEQVKNFVASHIANILNSEELYVQDLKVLIKNALENSQFPTIMDFR--KFSRNYQISKSASLPMFDPVSVKIEGNLIFDPSSYLPRESLLKTTLTVFGLASLDLFEIGLEGKGFEPTLEALFGKQGFF 698          
BLAST of Vitellogenin domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9U943|APLP_LOCMI (Apolipophorins OS=Locusta migratoria OX=7004 PE=1 SV=2)

HSP 1 Score: 216.468 bits (550), Expect = 5.951e-54
Identity = 262/1117 (23.46%), Postives = 487/1117 (43.60%), Query Frame = 2
Query:   74 FLLVLLSIITNAARTPQFINPCSMKCSFEEDRI-FKPGQKYVYSYEGES--NIKTTKGSYETTGVKIKSKVTITGLSNCEMKLSLSDVQIFDKTSSDGNQFKESPNSYKFKSALEMNDIFFT-KESNEVKSVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTSHGKCFITSSEKSPKEETNPNSVNFQYDLQTCDNKMISNSLFGDITRSVIFKTSQVSCKYLYKDQ----SNLVSIRCREEY--KTATIKTNENQMVVEITTNIYKENQLPSPDR---TFTNKNMFET--GXXXXXXXXXXXXSPYSAAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQD-RSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTN--NYGVNFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYLKKE-----------------------------------KGAQENLE------LINILNEMSGSVNIKL--FGNQVSFIELIRGTLSSVKKYNIIEEIMYWSQDKSL--------DFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLVSWPISVNIDNYISPNINAELHTEIVYQTPFTNYGMRMKLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFSVEGNAYVIHRDKEIIQLQDKL---------KEIKMCTSEMTVRILGIRVCGEAKVLDPSTRKDALLF---GPFAANVFIEKIDTQTEYILLATSKTSAFISQTGKVYSNRHIKFEFNTPNSKFYNRRFYGEILMDFKQKEFK---LELVTPWTDALVAARLKLTDGETK 3172
            + L++L+I +        +  C+ +C+ +     ++ GQ Y YS+EG +  ++  T+G  E   +K+K+   ++   +C   L L  V +    S +    K+          LE + +    K S+  K +C +  +   S NIK+AIL  L  Q   TK  +  +        T+   S + +    S     +       +I  +L    T       +      L+ +Q      +VS   RE Y  +  + + N  + +VE    +  +N  P+P     T     +FE    +        A  +   AA+++ KD  V   ++E       F  LV+ L++ ++ +  ++Y +++       K +  +++  DA    +T  ++ V+  L+KT  I+    N W  SL+F+Q   S++++  + +++   N  T  FL +GS    YC+E   +C+N      +++ F  +L+G  S    A ++       +LK LGN+++    +   + +     +    +R++ALEV++   C+++ + +AL IL +   DSELRI AYL V+ C   N +  +  +L  E + QVGSF+ +HL N++ S D  K   ++ L  +  KK F     K+S+N E ++  +  N G + +SNVIFS+ S++PRSVSLN TA +F  S N  E++AR E L+ ++    GP+GY++ E                                   K A +N+       L+    + S  V++ L  FG+++++     G         +++EI + + D+ L        DF  +   +D  +  PT LGFPLK  + GS A  +K+  + DV  ++  P +        P+   EL  +++        G+++     ++T     +    +  + +K   P   Q+I  V+ +     +++   +    L         K+ + C  +++  + G+  CG   V   S  + A  +   GP   +V IE  D  +EY   A  K      ++  V         F+TP S   +R+    +L++ K+K  +     L + W + +VA  L + D   K
Sbjct:    8 WFLLILAISSGGLSAA--VGGCNHQCTPQSSVFQYQKGQTYTYSFEGTTLTSLPGTQG--EPVRLKLKATADLSVADDCNKVLRLRGVTVSGPDSKNYANLKD----------LEAHPVLANFKGSSINKQLCSEDGDNQSSLNIKRAILSLL--QTPNTKSSTASEVDVFGICPTNVRHSQRGDVTVISKTRNLNRYASRENLIQETLSTRFTGQSDLHATPFLDADLHVEQQIKGGLIVSATSRESYLFRPFSNQGNGAKTIVETKLTLTSQNAQPAPPLASFTVPKSIVFEAPHALASVPGGSSAITAALHAAESSTKD-GVTVDAAEK------FRTLVSVLRQSSTTDILKVYNDVKAGAGFSNKHSA-RNLLLDALFRTSTGDAVEVIARLLKTKEIT---ANHWYLSLAFIQHA-SLKSVVSISSLLDQKNLPTEAFLGIGSFIGRYCREH--NCENVAEFDEVLNKFSKHLSG--STTSKAGENRAIA---ALKALGNIRHLNNALGEKVKQLALDKSLPPRVRVAALEVIQSDPCRKNIKQAALQILRDQVEDSELRIKAYLAVVECPCDNVVKTISNLLENEPIIQVGSFVVSHLKNLQASTDPSKAEAKEKLGQLKPKKIFSSDIRKYSQNYELSYAIDAINAGASVESNVIFSQSSYLPRSVSLNLTADVFGHSYNVFEIAARTENLDHIIESFLGPKGYIETEDDDKFVDEVEEKTKSLYNRITERFEKTFRQKRSVSKDAVDNIRQQAYKSLLPSQRDRSLDVDLSLKTFGSELAWFNY-DGKHEQKSSERVVDEI-FDAIDEGLKKSKKFNYDFEPHFTFLDSELSYPTNLGFPLKLAIDGSIAARLKLNGEVDVRSILRQPENAAFRLEFVPSAAVELTGKLLVDAYVVEGGLKLDYNVHSSTGINVAVHNLNDLGIDIKVGLPVKKQDIIDVKTDVLTTVKERGHPETSTPLHFNLKGNDYKQYRGCFDQLS-PVSGLTFCGNVSVPWVSPTQAAAFYPLNGPSHLSVSIEADDV-SEYHFRAEIKKDESAFKSAAVL--------FDTPGSS-ADRKVL--LLVEKKEKPHQGITAHLKSGWKE-IVAEGLLIDDNNEK 1073          

HSP 2 Score: 121.324 bits (303), Expect = 3.148e-25
Identity = 137/565 (24.25%), Postives = 242/565 (42.83%), Query Frame = 2
Query: 15818 LRSWFTLYFPQTPFTSILPEFETYATI-SKRSVMTFDKASFTLSPDSCRVLLSKDLKFKKWEIIMNQQNNK-QMFTINIGSNTFELSASNYKVNLNGKPSDLPIQIGSTSLVGLGRMMKLKDDKLGLTITIDPVNEMFTVGISGWYHGKVRGLFGNSDNEQFNDFMLDNGKIVS--NEVFMKEISYKSQSCKV--VSDEEQTVVKPIKGCPFIRRMVCKFLFKCPFSPLAACFNKVNPKKFHKLCVHSTEEVLTKLDPSI--CKAARQYQAQCQKAGVNIQVPPPCKKCDMPNDKPLSINEFRNVKIKEKVSDIVFIVDEGTC-LNSLYDKLPILVTRLDKGMKTKGINSVHYGLVTYVDDNNNQANFHT-VGQKLLGSSQEMITSLKTLKSSNG-KFKDFTGA--------------ITTA---ANYPFREHASRHLIII---SCTST---KEYPNVLHNLVDKLTKKAIQVSLLTDFSFKLKDSNKQSIIFGVDSQNTYTALSRNGDKNFTSRPESD----------FLYQLTMKMKGVVFDNKYLSASQELTRIRFVSSFAN 17380
            L      Y P   F +I+P ++  A + +     TFD+   T     C  +L++D++   + II N +    +   ++  + TFEL AS+  + +NG+P++ P   G          + ++  K G+ +T +   E+ T  I+G+Y GK RGL G  +NE ++DF   +G++ S  NE F       +Q   V  V   E +          I+   C+ +F    S L+ C   ++P  + + C H   E  TK +  +  C+ A  Y   C    V + VPP C  C +  D  + I +  +VK+ +K +DI+ ++++ T    ++ D +  +V++L + + ++GI+ V   L+ Y        + +T  G KL    ++        K      F +FT +              ITTA    +YPFR  A++ +I +   SC +T   K  P     L D +    I + L+T+      DS +   I G D+ + Y   ++ G K   S    +             Q+ +   G VF+   L  +++        S  N
Sbjct: 2793 LSDLLASYRPSLRFDNIIPPYDATAILLNSHHFFTFDRRHLTFK-GICSYILAQDVQDGNFTIIANIEGGSLKSIIVSDQATTFEL-ASDKSLLVNGRPTEYPADEGEFHAWREYNRVGIQT-KAGVKVTCETSIELCTFEINGFYFGKTRGLLGTINNEPWDDFTKPDGQVASKANE-FGNAWKVDAQCANVDGVDHHEHS----------IKVEECEEVF-SKASLLSPCSLFLDPAPYLEACSHIAHEATTKEEKQLAACRTAAAYVQACSVENVFVSVPPHCVHCSVNGDAAIDIGQSFSVKVPQKSADILIVLEQVTGNAETVKDFVSPIVSQLTQELSSRGISDVWISLLGYGAPGQEYPHLYTSSGGKLSYDGKQKNIQFGERKVLGPFPFDNFTESIDWLDEFTDQAFHLITTADTILDYPFRPGAAKSIIYVLDTSCETTLFLKHLPVKALKLKDAIGSPGIVLHLVTNV-----DSVQSKNIVGFDTNHAY--YNQEGKKRVVSEVTGNEKAALKISETACGQIALATSGTVFNKNNLKQTKKFVAQHIADSLTN 3335          
BLAST of Vitellogenin domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6RG02|VIT_PENME (Vitellogenin OS=Penaeus merguiensis OX=71412 PE=1 SV=2)

HSP 1 Score: 181.8 bits (460), Expect = 1.579e-43
Identity = 148/631 (23.45%), Postives = 294/631 (46.59%), Query Frame = 2
Query:  986 LKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQDRSSAL-SILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTNNYGVN--FDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYLKK---------------EKGAQENLELINIL---NEMSGSVNIKLF--------------------GNQVSFIELIRGTLSSVKKYNIIEEIMYWSQDKSLDFNKNLQL-------VDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLVSWPISVNIDNYISPNINAELHTEIVYQTPFTNYGMRMKLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFSVEGNAYVI 2734
            +K+IC + K +  ++   L  + ++ L+R+      E   ++++   C + +  ++SIF DA  F++   ++ VMV+ I+  R +     ++  +L ++   P+IE +K L  +     P   L L+  ++ + YC+  P +C     +A I     + +   CS P    +D    + I  K +GN+      V      CI  +  + S+R++A E  +  +C +     L  I +    ++E+RI +YL  + C++   L  + E +SKE+  QV  F+  HL NI+ES    KEN+R LL +V +  +F+    KFSRNI+  +    +G+    +SN+I++  SFVPR+V+L   A +     +  E+ AR  G+E ++ +  GP+GYL+                EKG +   +L + L     +  SV    F                    G+++++ + + G+L  V    +IE    + ++ SL+  K+L L       +     +PT+ G PL+ +L G+A   +K++   ++A ++S   +        P ++      + +       G+ M+    + T     I T +N+++ ++ + P+  + + +++   Y++
Sbjct:  305 MKEICDKTKDTVEAEAGALVAKALHVLRRIPDTVVVETAQKVRQGHYCSD-SARLESIFLDAVAFIHESGAVKVMVNEIENGRATGGRLALYTAAL-YLIPRPNIEAVKALTPLFESPRPMPSLLLAAATMVNHYCRHTP-ACYEKAPVARIAEILANRVQTHCS-PSAGVEDNEVALAI-FKTIGNMGVATPAVTRAAVHCIEVEGLETSVRVAAAEAFRQANCFRPAVEKLVDIAVRPAFETEVRIASYLAAVRCAEQEHLETIIEKISKEENTQVRGFVLGHLINIQESTCPAKENLRYLLANV-IPTDFERDFRKFSRNIDVAYHAPAFGMGAGLESNIIYAPGSFVPRAVNLKMKADVDETHMDIAEIGARFVGIESIIEEPLGPQGYLRTATFGKIMEDITGFAGEKGYKVMEQLKHTLRTRRSIDSSVIADFFGKLYGKSRSHTHAELFARFMGHEITYAD-VAGSLKGVTADTLIETFFSFFEN-SLEHMKDLNLNTARTAQLSMDYSLPTIQGTPLRLRLAGTAVAGLKMEGNVNIAQILSDLGNSQTGVKFFPGLSVHATGFVGFDWLLARVGIEMQNTISSATGAAIKIRTTENKKIEMELEVPEKME-LLNIKAETYLV 926          
BLAST of Vitellogenin domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9V496|APLP_DROME (Apolipophorins OS=Drosophila melanogaster OX=7227 GN=apolpp PE=1 SV=2)

HSP 1 Score: 178.333 bits (451), Expect = 1.656e-42
Identity = 229/952 (24.05%), Postives = 422/952 (44.33%), Query Frame = 2
Query:   83 VLLSIITNAARTPQFINPCSMKCSFEEDRIFK--PGQKYVYSYEGESNIKTTK---GSYETTGVKIKSKVTITGLSNCEMKLSLSDVQIFDKTSSDGNQFKESPNSYKFKSALEMNDIFFTKESNEVK-SVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTSHGKCFITSSEKSPKEETNPNSVNFQYDLQTCDNK-MISNSLFGDITRSVIFKTSQVSCKYLYKDQSNLVS-----IRCREEYK-TATIKTNENQMVVEITTNIYKENQLPSPDRTFTNKNMFETGXXXXXXXXXXXXSPYS----AAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCI-TKDTNKLSIRISALEVMKHMDCKQD-RSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTNNYGVNF--DSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYLKKE----------------KGAQENLELINILNEMSG---------------SVNIKLFGNQVSFIEL---IRGTLSSVKKY--NIIEEIMYWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLV--SWPISVNIDNYISPNINAELHTEIVYQTPFTNYGMRM--KLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNI--FSVEGNAYVIHRDKE 2749
            VLL+I  NA       N C++ C   ++ + K  PG  Y YS++    I  +       + T +K+     I    NC   L LS V++   T++  +  K+  NS +         + FT  S  ++  +C D  +  +S NIK+A++ SL   GI+ +   ++    G C    +  S  +  N N +    +L +C ++  I++ L           TS +  +  Y  +S +V+     ++  E YK     K N      +I+  +    +L +P  + T  N   TG        +  E+  S    A KT L D+          +  K F+E +  L++ +S+   EL      + +   K      ++ D  G   T ++ S  V L + S+    ++ + + SL+ ++ V   ETL +  + + + N    L++++G+L   YC +    CQ  P I +I   F   L   C   K  T     +I   LKGLGN K      +  L++C  T  +N+  IR++AL     + C++  +S +L +L N   DSELRI AYL+ + C +     ++ EI++ E VNQVG FI ++L  I++S D  ++  +  L ++ + K F +   ++S N E ++   + GV    D  +I+S+  F+PRS  +N T   F  + N  E S R E +ED+L    GP+G + K+                 G +    +++ ++++S                 V++KLFG++++F+ L   I  +L  +  Y     E+           F+ +   +D  +  PT +G PL+   QG AA  + +    D+  ++  +W  +     ++ P+++   + +I +     + G+R+     S T ++    + ++  E  +V  + P+    +  F+V+   YV  +DK+
Sbjct:   17 VLLTIAVNAE------NACNLGCPKSDNGLLKYIPGNYYDYSFDSILTIGASSDVPNDSDDTSLKVSGSAKIFAKGNCGYTLQLSSVKV---TNTKESVEKKILNSIQ-------KPVQFTLVSGILEPQICSDSSDLDYSLNIKRAVV-SLLQSGIEAE---HEVDVFGMC---PTHTSTSKVGNANIITKARNLNSCSHREQINSGLVSGKVNEKAGITSSLLLQANYIKESRIVNHLIENVQLTETYKFIGNTKRNS-----DISAKVVTILKLKNP--SGTKANSPGTGSTVRSLIFQRPETYTSKNINALKTILSDLVDSTGDYVKKETAKKFVEFIRLLRQSDSETLLELAAFPHPNKVLARK------VYLD--GLFRTSTAESARVILKQLSKFDEKEKLLAILSLNIVKSVDK-ETLNQAASQL-LPNAPKELYIAVGNLVAKYCLKN--YCQG-PEIDAISKKFSDGLK-HC---KPNTKREEERIVYILKGLGNAKSLSGNTVAALSECASTGRSNR--IRVAALHAFSKVKCEETLQSKSLELLKNRNEDSELRIEAYLSAISCPNAEVANQISEIVNSETVNQVGGFISSNLKAIRDSTDVSRDQQKYHLANIRVTKTFPVDYRRYSFNNEVSYKLESLGVGASTDYQIIYSQHGFLPRSSRINVTTEFFGTNYNVFEASVRQENVEDVLEYYLGPKGLVNKDFDEIVKLIEVGNNGVAAGGRARRSIVDDVSKISKKYKMYGVKNVQDLNLDVSLKLFGSELAFLSLGDNIPSSLDDIINYFSTSFEKAKQELSSFEKQFSSHHLFLDTDLAYPTSIGVPLELVAQGFAATKVDLAVSLDINAILEQNWQKAKYRLKFV-PSVDINANVQIGFNAQVLSTGLRVVSSAHSATGSDITVAVISD-GEGFNVDLELPREKLELINFNVDTELYVAEQDKQ 917          

HSP 2 Score: 86.2705 bits (212), Expect = 1.120e-14
Identity = 102/430 (23.72%), Postives = 184/430 (42.79%), Query Frame = 2
Query: 15896 ISKRSVMTFDKASFTLSPDSCRVLLSKDLKFKKWEIIMNQQNNK--QMFTINIGSNTFELSASNYKVNLNGKPSDLPIQIGSTSLVGLGRMMKL---KDDKLGLTITIDPVNEMFTVGISGWYHGKVRGLFGNSDNEQFNDFMLDNGKIVSNEVFMKEISYKSQSCKVVS-DEEQTVVKPIKGCPFIRRMVCKFLFKCPFSPLAACFNKVNPKKFHKLCVHSTEEVLTK-LDPSICKAARQYQAQCQKAGVNIQVPPPCKKCDMPNDKPLSINEFRNVKIKEKVSDIVFIVDEGTCLNSLYDKLPILVTRLDKGMKTKGINSVHYGLVTY----------------VDDNNNQANFHTVGQKLLGSS--QEMITSLKTLKSSNGKFKDFTG--------AITTAANYPFREHASRHLIIISCTSTKEYPN 17086
            +  + + TFD  +F   P +C+ +L++D     + II    N K   +  I+   + FE+ A N  + LNG   + P  +  + L    R   +    +  +G+  T D   ++  + I+G+Y  K RGL GN + E ++DF+L +G +  N   +    Y    C  +  D  Q   K  K     R+ +C  LF    S LA  F  ++ + + K C  +  +V  K  + + C  A  Y +  ++    + +PP C KC  P  +    +EF  VK+     D+VF+VD       L + +   +  + + ++++G + V  G++ +                ++   N A+    G K    +  +++IT  + L   N   +   G        A   A +YPFR  A++ +I +   S  EY N
Sbjct: 2791 VDGKHIFTFDGLNFAY-PGNCKYILAQDSVDNNFTIIGQLTNGKLKSITLIDREGSYFEV-ADNLALKLNGNLVEYPQHL--SGLHAWRRFYTIHLYSEYGVGIVCTSDL--KVCHININGFYTSKTRGLLGNGNAEPYDDFLLIDGTLAENSAALGN-DYGVGKCTAIEFDNNQ--FKSSK-----RQEMCSELFGIE-STLAFNFITLDSRPYRKACDIALAKVAEKEKEATACTFALAYGSAVKQINKWVLLPPRCIKCAGPAGQHDFGDEF-TVKLPNNKVDVVFVVDINVTPGVLSNLIAPAINDIRESLRSRGFSDVQVGVIVFEETKRYPALLTSDGGKINYKGNVADVKLAGIKSFCDNCVEQIITEKRILDIYNSLKEIVKGIAPQADEKAFQLALDYPFRAGAAKSIIGVRSDSL-EYKN 3203          
BLAST of Vitellogenin domain-containing protein vs. UniProt/SwissProt
Match: sp|Q25490|APLP_MANSE (Apolipophorins OS=Manduca sexta OX=7130 PE=2 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 4.067e-38
Identity = 155/679 (22.83%), Postives = 292/679 (43.00%), Query Frame = 2
Query:  968 SAAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQN---DPIIASIVSAFLHNLNGDCSIPKDATD-DYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQD-RSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTNNYGVN--FDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYLKKEKGAQENLELINILNEMSGSVNIKLFGNQVSF---IELIRGTLSS--------------VKKYNIIEEIMYWSQDKSLDFNK-------------------------NLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLVSWPISVNIDNYISPNINAELHTEIVYQTPFTNYGMRM--KLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFSVEGNAYVIHRDK------EIIQLQDKLKEIKMCTSEMTVRILGIRVC 2833
            SA K T + +     +  SSK    F +LV  ++  +  +   +Y +++   +        K ++ DA     T  SI   + ++K+  +S  +Q++   SL   + V +   LK    ++ + N    ++L  G+L   YC+E    C N   + I+A  +S  L +   +C  PK+  D D V  I   LKG+ N+++   ++I+ L  C   +  K  +R  ALE      C      +A+ I+ N + DSE+RI AYL V+ C   ++  +++ +L  E V+QVG+FI + L +I+ S++  K+  +     +    +F + + K+S   E ++  +  G     D  VI+S+ SF+PRSV+ N T  +F +S N +E+  R   L+ ++    GP+ +L+ E        L+    E    V   L   + S    I++    L +              VK +      + +  DK  DFNK                         +L  +D  +  PT +G PL+  L G+A   + + +  D+  +   P +   D    P+ + E+    +      + G+++   L S T     A +  N    + ++   P   Q + +   +   +  +K      ++I+++    E   C  +++   LG+ +C
Sbjct:  296 SAVKETARTVA----NDASSKSAGQFAQLVRIMRTSSKDDLMRIYSQVKAHQL-------EKRVYLDALLRAGTGESIEASIQILKSKDLSQLEQHLVFLSLGNARHVNN-PALKAAAGLLDMPNLPKEVYLGAGALGGAYCREH--DCHNVKPEGIVA--LSNKLGSKLQNCR-PKNKPDEDVVVAI---LKGIRNIRHLEDSLIDKLVHCAVDNNVKARVRAVALEAFHADPCSAKIHKTAMDIMKNRQLDSEIRIKAYLAVIECPCSHSASEIKNLLDSEPVHQVGNFITSSLRHIRSSSNPDKQLAKKHYGQIRTPNKFKVDERKYSFYREMSYKLDALGAGGSVDQTVIYSQTSFLPRSVNFNLTVDLFGQSYNVMELGGRQGNLDRVVEHFLGPKSFLRTEDPQALYDNLVKRFQESKKKVEDSLSRGRRSIKSEIDVFDKNLKAESAPYNNELDLDIYVKLFGTDAVFLSFGDDKGFDFNKMLDQILGGCNSGINKAKHFQQEIRSHLLFMDAELAYPTSVGLPLRLNLIGAATARLDVATNIDIRQIFQSPQNAKADIKFVPSTDFEISGAFIIDADAFSTGIKVITNLHSSTGVHVNAKVLEN-GRGIDLQIGLPVDKQELIAASSDLVFVTAEKGQKEKQKVIKMEKGENEYSACFDQLS-GPLGLTMC 952          
BLAST of Vitellogenin domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7TMA5|APOB_RAT (Apolipoprotein B-100 OS=Rattus norvegicus OX=10116 GN=Apob PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.113e-20
Identity = 159/706 (22.52%), Postives = 310/706 (43.91%), Query Frame = 2
Query:  173 FKPGQKYVYSYEGESN--IKTTKGSYETTGVKIKSKVTITGLSNCEMKLSLSDVQIFDKTSSDGNQF-KESPNSYKFKSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSL--ANQGIQTKPDSYKKTSHGKCFITSSEKSPKEETNPNSVNFQYDLQTCDN-KMISNS-----LFGDITR--SVIFKTSQVSCKYLYKDQSNLVS-IRCREEYKTATIK-TNENQMVVEITTNIYKENQLPSPDRTFTNKNMFETGXXXXXXXXXXXXSPYSAAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELY---------LELQKSDIC--PEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKEL-ETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNL-----KYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQD-RSSALSILLNNENDSELRINAYLTVM---GCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFD--ISKLKFSRN--IEKTF---LTNNYGVNFDSNVIFSEKSFVPRSVSLNTTASIFS-KSTNFLEMSARLEGLEDLLFKIFGPEGYL 2158
            FK  +KYVYSYE ES+  ++ T  S   T +  K ++ +  +    M+ S   ++     + +G    K++ NS +F SA+   ++       +  ++  D  EP +  NIK+ I+ +L    +  + K   ++ T +G C    +  S ++ T    ++ + +LQ CD  + IS S     L   + R  S +  +SQ SC+Y  + +   VS   C E++        N+  ++  +T  +  E+  P  +  F    + + G+     +  +      A   TL+++     S ++++   LF +LV  L+ L+ +    L          + LQ    C  PE  T I         ++ T  +  +++D++              T L  +   PS++ L+E+  T   + + +T   LS    ++    +   S    P++  I    +  ++ +C   +D T        + L+ +GN+     +  PA   + LN C+      L I+ +AL+ ++ M+   + R+      +N+    E R+ AYL +M     SDIN   K+ ++L  E+  QV +F+ +H+ NI  S +   +++++L+ +  +       +   KFSRN  I K+    L +      + N++F   S++P+   L TT ++F   S +  E+    +G E  L  +FG +G+ 
Sbjct:   33 FKHLRKYVYSYEAESSSGVRGTADSRSATKINCKVELEVPQVCTLIMRTSQCTLKEVYGFNPEGKALMKKTKNSEEFASAMSRYELKLAFPEGKRVALYPDLGEPNYILNIKRGIISALLVPPETEEDKQVLFQDTVYGNCSTQVTVNS-RKGTVATEMSTERNLQHCDGFQPISTSVSPLALIKGLVRPLSTLISSSQ-SCQYTLEPKRKHVSEAICNEQHLFLPFSYKNKYGIMTHVTQKLSLEDT-PKINSRFFRGGINQVGLAFESTKSTSPPKQADAVLKTLQELKKLSISEQNAQRANLFHKLVTELRGLSGEAITSLLPQLIEVSSPITLQALIQCGQPECYTHILQ-------WLKTEKAHPLLIDIV--------------TYLMALIPNPSVQRLQEIFNTAKELQSRATLYALSHAVNSYYAIMDHSRS----PVLEDIAGYLMKQIDNECMGDEDRT-------FLILRVIGNMGRTMERVMPALKSSVLN-CVRSTKPSLQIQKAALQALRKMEMGDEVRTILFDTFVNDVAPVEKRLAAYLLLMRSPSSSDIN---KIAKLLQWEQSEQVKNFVASHIANILNSEELYVQDLKNLIKNALVNSRLPTIMDFRKFSRNYQISKSVSIPLFDPVSAKIEGNLVFDPSSYLPKESMLKTTLTVFGIASLDLFEIGLEGKGFEPTLEALFGKQGFF 699          
BLAST of Vitellogenin domain-containing protein vs. TrEMBL
Match: A0A267DH01 (Vitellogenin domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027085g3 PE=4 SV=1)

HSP 1 Score: 523.472 bits (1347), Expect = 1.552e-151
Identity = 331/1028 (32.20%), Postives = 545/1028 (53.02%), Query Frame = 2
Query:  137 CSMKCSFEED----RIFKPGQKYVYSYEGESNIKTTKGSYETTGVKIKSKVTITGLSNCEMKLSLSDVQIFDKTSSDGNQFKESPNSYKFKSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTS---HGKCFITSSEKSPKEETNPNSVNFQYDLQTC-DNKMISNSLFGDITR------SVIFKTSQVSCKYLYKDQSNLVSIRCREEYKTATIKTNENQMVVEITTNI--YKENQLP--SPDRTFTNKNMFETGXXXXXXXXXXXXSPYSAAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQDRSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTN--NYGVNFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYLKKEKGAQEN--LELIN----ILNEMSGSVNIKLFGNQVSFIELIRGTLSSVKKYNIIEEIMYWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLVSWPISVNIDNYISPNINAELHTEIVYQTPFTNYGMRMKLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFSVEGNAYVIHR--DKEIIQLQDKLKEIKMCT-SEMTVRILGIRVCGEAKVLDPSTRKDALLFGPFAA----NVFIEKIDTQTEYILLATSKTSAFISQTGKVYSNRHIKFEFNTPNSKFYNRRFYGEILMDFKQKEFKLELVTPW 3121
            C+  C   +D      + PG+ Y ++Y      +    S E+TG+++ +KV +   S CE+ + + +V++ ++  SD  ++ ESP+  +F+S L  +D+ F   + ++  VC +  EP W  NIKKA +  L N     K +SY        GKC +T S    KE      V    DL +C D + +  S      R      S+    +  +CK +Y    NL S  C EE+      T+    V ++   +       +P  S D TF    +      Q  D  +    P    ++ L D+C +  +S + + PKLF EL++ L+ L+S++   +  E++ S +C       +  F+DA   V+T ++ ++M +L+ + +IS     +WLTSL+F+Q+ P    L+ L  ++   NPS    L +G+L H YCK   E C  DPI+ SI +A    L  DCS     T D    +  +LK +GN  Y    ++ TL +C+ ++ N + +R++A+E ++   C +DR+  + ++ N + DSELRI AYL +M C  +     V+E+L+ E  NQ  SF+WTHLTN+ E++D  K++IR +++DV LKK++D+ KLKFSRN+EK+F +N  N G   +SN+I+S++SF+PRS +LN T  +F KS NF E+  R++GLE LL K  GP+G  +K++    +   EL N    I +E+ GS++IK+FG+Q++F++L R  L      N++E +    Q + +++ K+   +D  V IPT+ GFPL     G+A+  IK   K DV  L+ WP  + ++  +SP+    L   +   T + +YG++M     ++TE +ATI T+  EEL V+F  P+  QNI + + + +VIHR  ++E    +D L + K C+  ++  +ILG+  C E        ++ A L  P AA    +V + K DT T Y L   +K             NRH K   +TP S+  +R+ + E ++D   +  +  L+TPW
Sbjct:   29 CAKSCPRPKDGDAPSPYTPGKSYTFNYMTGVRSEIKGASEESTGLRLTAKVVLDAFSTCELAMRMEEVRVSEQDPSDPTRWTESPHQAQFESELTASDVHFVLRNGQIPEVCAELLEPEWVLNIKKAAISMLQNTN-PNKVESYNGIETDISGKCKVTYSPA--KESGREFEVVKVTDLMSCLDQQRVRGSFQSSSYRVPAQIQSMPLTKANRTCKVVYYSSGNLKSSLCTEEHIFRPFSTDNAGAVTQVEQRMEFIGSGGMPRLSHDHTFKRSPL----EYQHHDFKQPSRVPEQDVRSVLNDLC-ELGTSVTPQTPKLFNELIHRLRGLSSQQLAAIRSEVEGSSVCRRNGQMAQQFFFDALPMVSTAAATAMMKELVLSGKISSTISEMWLTSLAFVQQ-PERAMLESLLPLLEAENPSQQAQLGIGALVHQYCKSRSE-CSKDPIVKSIGAALQRLLGRDCS-----TGDR-KALLTTLKAIGNAGYL-IDLMPTLVQCVNREANLVEVRVAAIEALRRTPCSEDRTPLMKLIRNKDVDSELRITAYLGLMSCPTMELFDTVKELLTAESSNQFASFMWTHLTNLLETSDPHKQDIRLIVEDVKLKKQYDLDKLKFSRNVEKSFFSNYLNAGAKVESNLIWSQRSFLPRSATLNMTLDLFGKSFNFFEVGGRVQGLETLLEKYLGPKGMERKQQTDTNSQLAELDNTFKVIEDEIGGSLDIKVFGHQIAFVDLWRENLER-SGTNLLEWLNSLKQLREVNWQKSFSFLDTQVSIPTISGFPLILGTNGTASFVIKSSGKLDVKKLMQWPPKLEVEGKLSPSGTVHLSGMLGIGTIYGDYGVKMTASIHSSTEMQATIKTSNGEELQVEFQQPRDRQNILNTKTSYFVIHRSVEREQTMRRDLLIKHKACSQGKLMEKILGVEFCAEISYPTLVPQESAPL-APLAAGMEMDVTMFKRDTHTSYQLHLVNKKEGM---------NRHWKALIDTPGSRV-DRKLHAEFVIDSTNQRIEASLLTPW 1027          
BLAST of Vitellogenin domain-containing protein vs. TrEMBL
Match: A0A1I8HY32 (Vitellogenin domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 527.709 bits (1358), Expect = 4.697e-147
Identity = 333/1028 (32.39%), Postives = 545/1028 (53.02%), Query Frame = 2
Query:  137 CSMKCSFEED----RIFKPGQKYVYSYEGESNIKTTKGSYETTGVKIKSKVTITGLSNCEMKLSLSDVQIFDKTSSDGNQFKESPNSYKFKSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTS---HGKCFITSSEKSPKEETNPNSVNFQYDLQTC-DNKMISNSLFGDITR------SVIFKTSQVSCKYLYKDQSNLVSIRCREEYKTATIKTNENQMVVEITTNI--YKENQLP--SPDRTFTNKNMFETGXXXXXXXXXXXXSPYSAAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQDRSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTN--NYGVNFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYLKKEKGAQEN--LELIN----ILNEMSGSVNIKLFGNQVSFIELIRGTLSSVKKYNIIEEIMYWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLVSWPISVNIDNYISPNINAELHTEIVYQTPFTNYGMRMKLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFSVEGNAYVIHR--DKEIIQLQDKLKEIKMCT-SEMTVRILGIRVCGEAKVLDPSTRKDALLFGPFAA----NVFIEKIDTQTEYILLATSKTSAFISQTGKVYSNRHIKFEFNTPNSKFYNRRFYGEILMDFKQKEFKLELVTPW 3121
            C+  C   +D      + PG+ Y ++Y      +    S E+TG+++ +KV +   S CE+ + + +V++ ++  SD  ++ ESP+  +F+S L  +D+ F   + ++  VC +  EP W  NIKKA +  L N     K +SY        GKC +T S    KE      V    DL +C D + +  S      R      S+    +  +CK +Y    NL S  C EE+      T+    V ++   +       +P  S D TF    +      Q  D  +    P    ++ L D+C +  +S + + PKLF EL++ L+ L+S++   +  E++ S +C       +  F+DA   V+T ++ ++M +L+ + +IS     +WLTSL+F+Q+ P    L+ L  ++   NPS    L +G+L H YCK   E C  DPI+ SI +A    L  DCS     T D    +  +LK +GN  Y    ++ TL +C+ ++ N + +R++A+E ++   C +DR+  + ++ N + DSELRI AYL +M C  +     V+E+L+ E  NQ  SF+WTHLTN+ E++D  K++IR +++DV LKK++D+ KLKFSRN+EK+F +N  N G   +SN+I+S++SF+PRS +LN T  +F KS NF E+  R++GLE LL K  GP+G  +K++    +   EL N    I +E+ GS++IK+FG+Q++F++L R  L      N++E +    Q + +++ K+   +D  V IPT+ GFPL     G+A+  IK   K DV  L+ WP  V ++  +SP+    L   +   T + +YG++M     ++TE +ATI T+  EEL V+F  P+  QNI + + + +VIHR  ++E    +D L + K C+  ++  +ILG+  C E        ++ A L  P AA    +V + K DT T Y L   +K             NRH K   +TP S+  +R+ + E ++D   K  +  L+TPW
Sbjct:  424 CAKSCPRPKDGDAPSPYTPGKSYTFNYMTGVRSEIKGASEESTGLRLTAKVVLDAFSTCELAMRMEEVRVSEQDPSDPTRWTESPHQAQFESELTASDVHFVLRNGQIPEVCAELLEPEWVLNIKKAAISMLQNTN-PNKVESYNGIETDISGKCKVTYSPA--KESGREFEVVKVTDLMSCLDQQRVRGSFQSSSYRVPAQIQSMPLTKANRTCKVVYYSSGNLKSSLCTEEHIFRPFSTDNAGAVTQVEQRMEFIGSGGMPRLSHDHTFKRSPL----EYQHHDFKQPSRVPEQDVRSVLNDLC-ELGTSVTPQTPKLFNELIHRLRGLSSQQLAAIRSEVEGSSVCRRNGQMAQQFFFDALPMVSTAAATAMMKELVLSGKISSTISEMWLTSLAFVQQ-PERAMLESLLPLLEAENPSQQAQLGIGALVHQYCKSRSE-CSKDPIVKSIGAALQRLLGRDCS-----TGDR-KALLTTLKAIGNAGYL-IDLMPTLVQCVNREANLVEVRVAAIEALRRTPCSEDRTPLMKLIRNKDVDSELRITAYLGLMSCPTMELFDTVKELLTAESSNQFASFMWTHLTNLLETSDPHKQDIRLIVEDVKLKKQYDLDKLKFSRNVEKSFFSNYLNAGAKVESNLIWSQRSFLPRSATLNMTLDLFGKSFNFFEVGGRVQGLETLLEKYLGPKGMERKQQTDTNSQLAELDNTFKVIEDEIGGSLDIKVFGHQIAFVDLWRENLER-SGTNLLEWLNSLKQLREVNWQKSFSFLDTQVSIPTISGFPLILGTNGTASFVIKSSGKLDVKKLMQWPPKVEVEGKLSPSGTVHLSGMLGIGTIYGDYGVKMTASIHSSTEMQATIKTSNGEELQVEFQQPRDRQNILNTKTSYFVIHRSVEREQTMRRDLLIKHKACSQGKLMEKILGVEFCAEISYPTLVPQESAPL-APLAAGMEMDVTMFKRDTHTSYQLHLVNKKEGM---------NRHWKALIDTPGSRV-DRKLHAEFVIDSTNKRIEASLLTPW 1422          

HSP 2 Score: 87.4261 bits (215), Expect = 1.677e-12
Identity = 72/362 (19.89%), Postives = 155/362 (42.82%), Query Frame = 2
Query: 4457 NPEEFRTLFNVDLNGNSNSDNKIEFDIQALQK-NPVYKQFESVARLALQYPGNRHSIGFKSDFKYSEMVAQIDLIWNKNQRISITSTYQLDNSWTQKGLAASLTVKTPFIGYEQIHFGMTAVGQLRYRKVNFECKWADNKKLIFDIVIQPKSSSDFSLNAKLTSPFKGFNLVTFQAKHLQTSNSINTQCVVEIGPVKRYQIKFETINNSEDKNRDFLSN-----ILIESGI----YPAFKMSLLHKDDSVHYKSQFDVLWMKTQSINVKSDISFNLEDY-EFTTKGNVELFSTIKEAKQMKMVWSLENRDSQFLHNVQMFHNNKNLFQTTIKGFYET---EDNKIKIEFNGVASVMNGRSMK 5500
            N E+       +L  N        F I+   K N +    +   +L + YP        K + ++ +    I++++   +++S    Y +++ WT+KG+ + L + TPF  YE I   +   G LR R++  E    ++++   +++I   + ++F     + +P+   + + F+  HL TS+ I T+  +E    K   + FE     +  N+ F S      + IES       P       HKDD   + S  ++ W   +++++ S+ +F  + Y +  ++G + L +     +   + W  +N +     N ++ +      +  +  + E     D ++   F+ +A  M   ++K
Sbjct: 1757 NKEDDSNRLTAELYWNPRRARSDGFQIEGHMKVNRMAHSLKRDGKLVINYPTGSVEFNLKENNEHLKGNKFIEMVYGNGKKVSANFMYDINDGWTEKGIVSMLKLVTPFRRYEDITLKLDGYGSLRIRQLKIE-SIINSRRFKAELLINLGNINNFHSRLSIVTPWAQASFIKFELTHLLTSSEIKTKLDMEF---KTKNMTFEV----QGHNKGFYSQSSDLGLKIESTSTFEWMPKLLFEFNHKDDGKQFTSNAELTWNDDRTVSMNSNFNFIPQPYNKLESRGTISLTTPFSGYETFSITWDHKNNNQMIGSNCKVTYLPGKTVEVALSAYDELTAHRDRQMGCSFSIMAPFMEPVTLK 2110          
BLAST of Vitellogenin domain-containing protein vs. TrEMBL
Match: A0A267G3Y0 (Vitellogenin domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027085g4 PE=4 SV=1)

HSP 1 Score: 526.554 bits (1355), Expect = 3.074e-145
Identity = 333/1028 (32.39%), Postives = 545/1028 (53.02%), Query Frame = 2
Query:  137 CSMKCSFEED----RIFKPGQKYVYSYEGESNIKTTKGSYETTGVKIKSKVTITGLSNCEMKLSLSDVQIFDKTSSDGNQFKESPNSYKFKSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTS---HGKCFITSSEKSPKEETNPNSVNFQYDLQTC-DNKMISNSLFGDITR------SVIFKTSQVSCKYLYKDQSNLVSIRCREEYKTATIKTNENQMVVEITTNI--YKENQLP--SPDRTFTNKNMFETGXXXXXXXXXXXXSPYSAAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQDRSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTN--NYGVNFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYLKKEKGAQEN--LELIN----ILNEMSGSVNIKLFGNQVSFIELIRGTLSSVKKYNIIEEIMYWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLVSWPISVNIDNYISPNINAELHTEIVYQTPFTNYGMRMKLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFSVEGNAYVIHR--DKEIIQLQDKLKEIKMCT-SEMTVRILGIRVCGEAKVLDPSTRKDALLFGPFAA----NVFIEKIDTQTEYILLATSKTSAFISQTGKVYSNRHIKFEFNTPNSKFYNRRFYGEILMDFKQKEFKLELVTPW 3121
            C+  C   +D      + PG+ Y ++Y      +    S E+TG+++ +KV +   S CE+ + + +V++ ++  SD  ++ ESP+  +F+S L  +D+ F   + ++  VC +  EP W  NIKKA +  L N     K +SY        GKC +T S    KE      V    DL +C D + +  S      R      S+    +  +CK +Y    NL S  C EE+      T+    V ++   +       +P  S D TF    +      Q  D  +    P    ++ L D+C +  +S + + PKLF EL++ L+ L+S++   +  E++ S +C       +  F+DA   V+T ++ ++M +L+ + +IS     +WLTSL+F+Q+ P    L+ L  ++   NPS    L +G+L H YCK   E C  DPI+ SI +A    L  DCS     T D    +  +LK +GN  Y    ++ TL +C+ ++ N + +R++A+E ++   C +DR+  + ++ N + DSELRI AYL +M C  +     V+E+L+ E  NQ  SF+WTHLTN+ E++D  K++IR +++DV LKK++D+ KLKFSRN+EK+F +N  N G   +SN+I+S++SF+PRS +LN T  +F KS NF E+  R++GLE LL K  GP+G  +K++    +   EL N    I +E+ GS++IK+FG+Q++F++L R  L      N++E +    Q + +++ K+   +D  V IPT+ GFPL     G+A+  IK   K DV  L+ WP  V ++  +SP+    L   +   T + +YG++M     ++TE +ATI T+  EEL V+F  P+  QNI + + + +VIHR  ++E    +D L + K C+  ++  +ILG+  C E        ++ A L  P AA    +V + K DT T Y L   +K             NRH K   +TP S+  +R+ + E ++D   K  +  L+TPW
Sbjct:   29 CAKSCPRPKDGDAPSPYTPGKSYTFNYMTGVRSEIKGASEESTGLRLTAKVVLDAFSTCELAMRMEEVRVSEQDPSDPTRWTESPHQAQFESELTASDVHFVLRNGQIPEVCAELLEPEWVLNIKKAAISMLQNTN-PNKVESYNGIETDISGKCKVTYS--PAKESGREFEVVKVTDLMSCLDQQRVRGSFQSSSYRVPAQIQSMPLTKANRTCKVVYYSSGNLKSSLCTEEHIFRPFSTDNAGAVTQVEQRMEFIGSGGMPRLSHDHTFKRSPL----EYQHHDFKQPSRVPEQDVRSVLNDLC-ELGTSVTPQTPKLFNELIHRLRGLSSQQLAAIRSEVEGSSVCRRNGQMAQQFFFDALPMVSTAAATAMMKELVLSGKISSTISEMWLTSLAFVQQ-PERAMLESLLPLLEAENPSQQAQLGIGALVHQYCKSRSE-CSKDPIVKSIGAALQRLLGRDCS-----TGDR-KALLTTLKAIGNAGYL-IDLMPTLVQCVNREANLVEVRVAAIEALRRTPCSEDRTPLMKLIRNKDVDSELRITAYLGLMSCPTMELFDTVKELLTAESSNQFASFMWTHLTNLLETSDPHKQDIRLIVEDVKLKKQYDLDKLKFSRNVEKSFFSNYLNAGAKVESNLIWSQRSFLPRSATLNMTLDLFGKSFNFFEVGGRVQGLETLLEKYLGPKGMERKQQTDTNSQLAELDNTFKVIEDEIGGSLDIKVFGHQIAFVDLWRENLER-SGTNLLEWLNSLKQLREVNWQKSFSFLDTQVSIPTISGFPLILGTNGTASFVIKSSGKLDVKKLMQWPPKVEVEGKLSPSGTVHLSGMLGIGTIYGDYGVKMTASIHSSTEMQATIKTSNGEELQVEFQQPRDRQNILNTKTSYFVIHRSVEREQTMRRDLLIKHKACSQGKLMEKILGVEFCAEISYPTLVPQESAPL-APLAAGMEMDVTMFKRDTHTSYQLHLVNKKEGM---------NRHWKALIDTPGSRV-DRKLHAEFVIDSTNKRIEASLLTPW 1027          

HSP 2 Score: 74.7146 bits (182), Expect = 1.112e-8
Identity = 64/319 (20.06%), Postives = 142/319 (44.51%), Query Frame = 2
Query: 4583 ARLALQYPGNRHSIGFKSDFKYSEMVAQIDLIWNKNQRISITSTYQLDNSWTQKGLAASLTVKTPFIGYEQIHFGMTAVGQLRYRKVNFECKWADNKKLIFDIVIQPKSSSDFSLNAKLTSPFKGFNLVTFQAKHLQTSNSINTQCVVEIGPVKRYQIKFETINNSEDKNRDFLS-----NILIESG----IYPAFKMSLLHKDDSVHYKSQFDVLWMKTQSINVKSDISFNLEDY-EFTTKGNVELFSTIKEAKQMKMVWSLENRDSQFLHNVQMFHNNKNLFQTTIKGFYET---EDNKIKIEFNGVASVMNGRSMK 5500
             +L + YP        K + ++ +    I++++   +++S    Y +++ WT+KG+ + L + TPF  YE I   +   G LR R++  E    ++++   +++I   + ++F     + +P+   + + F+  HL TS+ I T+  +E    K   + FE     +  N+ F S      + IES       P       HKDD   + S  ++ W   +++++ S+ +F  + Y +  ++G + L +     +   + W  +N +     N ++ +      +  +  + E     D ++   F+ +A  M   ++K
Sbjct: 1483 GKLVINYPTGSVEFNLKENNEHLKGNKFIEMVYGNGKKVSANFMYDINDGWTEKGIVSMLKLVTPFRRYEDITLKLDGYGSLRIRQLKIES-IINSRRFKAELLINLGNINNFHSRLSIVTPWAQASFIKFELTHLLTSSEIKTKLDMEF---KTKNMTFEV----QGHNKGFYSQSSDLGLKIESTSTFEWMPKLLFEFNHKDDGKQFTSNAELTWNDDRTVSMNSNFNFIPQPYNKLESRGTISLTTPFSGYETFSITWDHKNNNQMIGSNCKVTYLPGKTVEVALSAYDELTAHRDRQMGCSFSIMAPFMEPVTLK 1793          
BLAST of Vitellogenin domain-containing protein vs. TrEMBL
Match: A0A267GYF7 (Vitellogenin domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016013g3 PE=4 SV=1)

HSP 1 Score: 445.277 bits (1144), Expect = 2.030e-128
Identity = 294/1032 (28.49%), Postives = 522/1032 (50.58%), Query Frame = 2
Query:  137 CSMKCSFEEDRIFKP-----GQKYVYSYEGESNIKTTKGSYETTGVKIKSKVTITGLSNCEMKLSLSDVQIFDKTSSDGNQFKESPNSYKFKSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTS---HGKCFITSSEKSPKEETNPNSVNFQYDLQTC-DNKMISNSLFGDITR------SVIFKTSQVSCKYLYKDQSNLVSIRCREEY--------KTATIKTNENQMVVEITTNIYKENQLPSPDRTFTNKNMFETGXXXXXXXXXXXXS--PYSAAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQDRSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTN--NYGVNFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYLKKEKGAQENLELIN-----ILNEMSGSVNIKLFGNQVSFIELIRGTLSSVKKYNIIEEIMYWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLVSWPISVNIDNYISPNINAELHTEIVYQTPFTNYGMRMKLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFSVEGNAYVIHR--DKEIIQLQDKLKEIKMCTSEMTV-RILGIRVCGEAKV--LDPSTRKDALLFGPFAANVFIEKIDTQTEYILLATSKTSAFISQTGKVYSNRHIKFEFNTPNSKFYNRRFYGEILMDFKQKEFKLELVTPW 3121
            C++ C     R  +P     G+ Y + Y  +        + E+ G+++ ++V    L+ CE+ + LS++++  +    G  + +SP   +F+  L  +D  F   +  V  VC +  EP W  NIKKA++  L N   + + D ++       G+C +T + +  ++ +   SV    DL +C D K + +S      R      S+    +  +C+  Y    +L S  C EE+            + T + +M    T  I +            + ++F+    + +     + S  P    ++ L  +C    ++   K P LF EL+  LK L +++   +  +++   +C       K  F+DA   V T +++ +M  LI + ++S  + + WLTSL+F+Q+ PS E L+ L  ++ V  P T   L + ++ + YC      C+ + ++ S+ +A    +  DCS     T D  T + ++LK +GN  +    + N L +C  K++N + +R++A+E ++   C  DR   L ++ N + DSELRI AYL +M C  I     VRE+L+ E  NQ  SF+WTHLTN+ E++D  K++IR +++DV LKK++D+ KLKFSRNIEK+F +N  N G   +SN+I+S+KSF+PRS +LN T  +F KS NFLE+  R++G+E LL K  GP+     E      L  ++     I  ++ G+++IK+FG+QV+F++L +  +  +   NI++ +    Q + +++ K++  +D  V IPT+ GFPL+  + G+A+  +K KSK ++  L+ WP    ++  + P+    +   +   T F +YG++M     ++TE +A+I     EEL V+ + P+  QNI + + + +++ R  ++E    +D     K C+    + ++LGI  C E +   L       A L   F  ++ + K DT   Y+L   ++             NRH K   + P SK  +R+   E+ +D   ++ +  L TPW
Sbjct:   29 CALSCP----RAVQPPAYSVGRAYTFDYSTDMRAHIRGATEESAGLQLSARVVFDFLAPCEVAMRLSNIRV-QELDPAGEAWLDSPQQARFEQELTASDAHFAFANGLVGDVCAEVAEPDWVLNIKKAMIGLLQNSNTEQR-DGFEGVETDISGRCKVTYNVQ--QDSSKGASVTKVTDLMSCPDQKKVRSSFQSSSYRTSARIQSMPLTRANRTCRAQYDTSGHLKSSVCSEEHLFRPFSTETAGAVTTVQQKMTFVGTGGIVR----------IAHDHVFQRSKLEYQHHDFKQTSENPVENVRSVLSSLC-DLGTAIGPKTPVLFNELIYRLKELTTEQLVTMRRDVEGFSVCRRNNQMAKQFFFDALPAVTTPAAVQMMNGLIASGQVSNTEADAWLTSLAFVQD-PSKEMLESLLPLLQVEEPRTQAQLGITAVVNQYCSSRTR-CETETVVKSVGAALQRLIGSDCS-----TGDRRT-LLVALKAIGNAGHLTELLPN-LARCANKESNLMEVRVAAIEALRRTPCSVDRRPLLRLIRNMDLDSELRITAYLGLMACPTIEVFDTVRELLTAESSNQFASFMWTHLTNLLETSDPHKQDIRLIVEDVKLKKQYDMDKLKFSRNIEKSFFSNYLNAGAKVESNLIWSQKSFLPRSATLNMTLDLFGKSLNFLEVGGRVQGMEVLLEKYLGPKSNKSNETDTNTQLAQLDETFKLIEEKIGGNLDIKIFGHQVAFLDLWKEDM-EISGSNILKLLNSLRQMREINWYKSISFLDTQVTIPTISGFPLRLGINGTASFILKAKSKVNLKKLMQWPPEFEVEGQLVPSGAVHVSGMLGINTVFGDYGVKMVSNVYSSTEMQASIKAANGEELKVEINQPRQRQNILNAKTSFFIVRRSVEREQNMRRDLTVNRKSCSGGGFLQKVLGIEFCSEIRYPSLPAEDAPQAPLVAGFELDLSMLKKDTHESYVLHLINRKEGI---------NRHWKALVDMPGSK-SDRKIQAEVKIDSDSRKAEAILETPW 1021          
BLAST of Vitellogenin domain-containing protein vs. TrEMBL
Match: X2ATR8 (Uncharacterized protein OS=Capitella teleta OX=283909 PE=4 SV=1)

HSP 1 Score: 436.032 bits (1120), Expect = 8.062e-118
Identity = 342/1220 (28.03%), Postives = 576/1220 (47.21%), Query Frame = 2
Query:  137 CSMKCSFEEDRIFKPGQKYVYSYEGESNIKTTKG--SYETTGVKIKSKVTITGLSNCEMKLSLSDVQIFDKTSSDGNQFKESPNSYKFKSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSLAN--QGIQTKPDSYKKTSHGKCFITSSEKSPKEETNPNSVNFQYDLQTCDNKMISNSLF--------GDITRSVIFKTSQVSCKYLYKDQSNLVSIRCREEYKTATIKTNENQMVVEITTNIYKENQLPSPDRTFTNKNMFETGXXXXXXXXXXXXSPYSAAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQDRSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTN--NYGVNFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYLK--KEKGAQENLELINILN--------EMSGSVNIKLFGNQVSFIELIRGTLSSVK-KYNIIEEIMYWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLVSWPISVNIDNYISPNINAELHTEIVYQTPFTNYGMRMKLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFSVEGNAYVIHRD----KEIIQLQDKLKEIKMCTSEMTVRILGIRVCGE-AKVLDPSTRKDALLF---GPFAANVFIEKIDTQTEYILLATSKTSAFISQTGKVYSNRHIKFEFNTPNSKFYNRRFYGEILMDFKQKEFKLELVTPWTDALVAARLKLTDGETKIAFNFKANKQNIIDISAEHLIFSSPKRTNTKGGISI-----QILNLTPIRKRWNLELT-----DDAYSFTFVSKGLLKEETHLKIKVLRKNPMKNLSAFNTYEISGFFNTYFGYGKISGRTSEN------YFGHRWDIKISHKNKQRKEYQIIFRHKVEDKSSKNLNKYILTTTF 3649
            CS  CS  ++  F       + Y+ ES++KT+ G  S E + + +++   I  LS CEM L LS V + D          +   S + K+ LE   + F+    +V+S+C + EEPVW+ NIK+ IL +  N  + +      ++    G C      K      N  +V    DL  C  +    S F         DI    I K++   C+        L    C E +        EN    EITT +    Q+    R         + +       E +      AK TL D+C Q ++     +P LF   V   ++L + +   L+ ++    +C +     +  F DA   + T +S +++  LI+  R +  + +IWLTS+S     PS   +  L+ +++  + S   +L++ SL + YC    E C +D  I +I+  F   L  +C   ++ +DD+   + ++LK LGN  +   + + TL +C       + +R+ AL+  + M C  DR+   ++L N END+ELRI+AYL +M C D NTL +V  +L  E+VNQVGSFIWTHLTN++E+++  K+ IR +L++ +LKK FD+ K KFSRNIE +  +   N G + +SNVIFSEKSF+PRSV LN TA +F +S NF E+  RL+G+E LL + FGP+G +   +EK +    E IN+L+         M  S  +++FGN++ + +L    LS++K K N +E ++  + D   +  K++   D   VIPT  G PLK +  G+A IN+K+  K D+  + + P + +I   + P+   E+ + +         G++M     T+T  +        +  ++ +D P+    I S E   +V+ RD    + ++   ++    K C  +    +LG+ +CGE +   DP    D   F   GP +  V++ K D+ T +   A        +QTG V      K +FNTP S   +R    E  MD   K+ K+ + +PW    + A +  TD    I+       + +ID ++E+ + +   +  T+G  S+      +  + P R+   L+ +     +  +      K L      ++  V + N  + +      E+S  F T    G++ G    N          R  ++ S++  Q +   I+  +K+ DKS++    Y L + +
Sbjct:   33 CSTWCSAGDNDKFSFDADKTHEYQYESDVKTSMGGASEEHSSLHLRATAHIEVLSRCEMALRLSGVSLQDSEPGRYESRSDIERSAELKAVLEARLLRFSFIDGQVESICGEQEEPVWAMNIKRGILSAFQNTMESLDEDKRVFETDVTGICPTEYENKGTL--WNTRTVKKTKDLIGCIERNGPQSAFQGAPFQVPSDIQTLPIMKSTH-ECEQKINGDGLLTQSICTESHVFRPFSRQENGAKTEITTKLTFTRQVAGVTRQRAAVRQRSSLLFDHTLTAEEQAENVRQAKQTLTDLCSQSETDIRPDVPSLFTRFVREARKLQTNDLSRLF-DVAVRGVCGKA----EKFFRDAIPVLGTEASTNLIRKLIQEDRATEAEADIWLTSISTSIHRPSKPMIMALKPLLT-GSTSRKAYLAVSSLINNYCTLN-EGCDSDGEIQAIIRIFTEQLRYNCR--QEGSDDH-DNVLMALKALGNTGH-AESAVPTLQRCAANAELSMELRVVALQSFRRMSCVADRTELFNLLSNIENDAELRIHAYLVLMTCPDANTLQRVLLLLENEQVNQVGSFIWTHLTNLQETSNPHKQQIRAILENEELKKTFDMDKRKFSRNIEMSLFSELLNMGGSVESNVIFSEKSFIPRSVMLNLTAELFGQSINFFELGGRLQGMEQLLERFFGPDGKVSDGREKRSLIRDESINMLDRSFDAERERMGMSYFLRMFGNEIRYGDLHNFDLSNIKDKLNFLEWLIELASDHDFEVTKSMMFFDLAHVIPTSAGLPLKLEADGAATINVKVNGKMDIRRMFTSPSTFDISGSVKPSAALEVTSMMGIDAFVAKTGLKMVTTLHTSTVAQGKFQLAGGKIFNMDWDIPQDKMEIISAESKFFVVWRDVDREQNMLNTGERSSHSK-CIGDKFTTVLGLELCGEISYPWDPKKSNDVPFFPFTGPMSTKVYLNKKDSHTGFHFEAKYIQDKTRAQTG-VQIKDIAKVQFNTPGSSV-DRELAFEFEMDRASKQMKISMKSPWKKVDMNAAMVKTDSVKSIS------ARTMIDDNSEYAVTA---QLTTQGSDSVIKYIPDVQVIIPGRENIVLDGSVTLRQNRKFDVDLALKNLFARPFSVRGSVDKINNRRRMKYGGELELSSSFLT----GRVEGFVDHNKASAGQSLASRLTVEYSYQGGQSQ--SIVLSNKIRDKSTETDMSYSLDSAW 1220          

HSP 2 Score: 184.496 bits (467), Expect = 8.384e-42
Identity = 148/607 (24.38%), Postives = 273/607 (44.98%), Query Frame = 2
Query: 15680 PIPFNDFKSLPDFGYVRRKIHKIQAAINLIKQTIKNQLANGCRYFELRSWFTLYFPQTPFTSILPEFETYATI-SKRSVMTFDKASFTLSPDSCRVLLSKDLKFKKWEIIMNQQNNKQMF---TINIGSNTFELSASN-YKVNLNGKPSDLPIQIGSTSLVGLGRMMKLKDDKLGLTITIDPVNEMFTVGISGWYHGKVRGLFGNSDNEQFNDFMLDNGKIVSNEVFMKEISYKSQSCKVVSDEEQTVVKPIKGCPFIRRMVCKFLFKCPFSPLAACFNKVNPKKFHKLCVHS--TEEVLTKLDPSICKAARQYQAQCQKAGVNIQVPPPCKKCDMPNDKPLSINEFRNVKIKEKV----SDIVFIVDEGTCLNSLYDKLPILVTRLDKGMKTKGINSVHYGLVTYVDDNN-NQANFHTVGQKLLGSSQEMITSLKTLKSSNGKFKDFTGAITTAANYPFREHASRHLIIISCTSTKEYPNVLHNLVDKLTKKAIQVSLLTDFSFKLK-DSNKQSI-IFGVDSQNTYTALSRN-----GDKNFTSRPE--SDFLYQLTMKMKGVVFDNKYLSASQELTRIRFVSSFANQISLRATPAKSSRCVCVDD 17437
            P  ++D   L    Y  R I  IQ  IN+ K+ I N+       F L   +  Y P T + + +P F+TYA +   +  MTFDK  +  + + C  LL++D     + + +N Q  +      +++I +N  ++   N  +V ++G   ++P+  G+T++  +G M+++ D+ LGLT+  +   +  TV ++GWY  K  GLFG  +NE  +DF        S    + +     Q C+  +       +P          +C  +FK   SP   C+  V+P+ F K+C +    +E     +   C A   Y   C++ GVN+++P  C +C++ +       E +N  ++       +D+VFI+    C   +   L  +V  ++K  K+ GI +  Y ++ Y    + N  +  T+  ++  +  +++  L       G+  D   AI  A+  P+R   S+ ++++ CT+  E      ++   L +K I + +L + +FKL  D +  S  IFG DS+  +T          GD     + +   D    L M+  G +F+    + S+   + RF+       + +  P    +C CV D
Sbjct: 4669 PFHWDDIHHL----YRLRDI-DIQKYINMAKEMI-NEYMPVTPEFNLVDLYYRYRPSTDYFNWIPPFKTYAAVMGSQHFMTFDKRFYEFAGE-CSYLLARDFIDGTFSVAVNYQRQRGRPVKKSLSIITNGKQVEVFNDGRVVVDGSRIEMPVAFGNTTISRIGSMIRV-DNTLGLTVDCNLPYDRCTVNVTGWYFSKTGGLFGTYNNEPADDFTTAENTRASTPEQLADSWTAGQRCRPENYAVNVAPEPHTEA----YKICSRMFKEDASPFRPCYKVVDPQPFQKMCENDLMLKENRLPTEQDACNANAFYVDVCRREGVNVRIPHSCVRCEIES-MGAEFTEGQNYTLEGDAVPQSADVVFILQHAECNEVVLANLKDVVDDMEKAFKSTGITNNRYSIIGYGATGSLNTPHIRTMDGQVFNTHDKILLGLDDFTKGYGESADALAAIYYASKLPYRAGVSKSIVMVPCTACMEMSVSYADVEQVLMQKDIHLHMLMEHNFKLNVDKDPVSAYIFGADSRRVFTRKDAGGKVLEGDNELRQQVQMPKDLCAALAMETDGSIFNTLQWTQSRPYMQKRFIDVMVRLFAEKGHPESCQKCDCVSD 5262          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Cavefish
Match: apoba (apolipoprotein B [Source:NCBI gene;Acc:103044560])

HSP 1 Score: 97.8265 bits (242), Expect = 4.411e-19
Identity = 162/703 (23.04%), Postives = 299/703 (42.53%), Query Frame = 2
Query:  173 FKPGQKYVYSYEGESNIKTTKGSYETTGVKIKSKVTITGLSNCEMKLSLSDVQIFDKT--SSDGNQ-FKESPNSYKFKSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTSHGKCFITSSEKSPKEETNPN-SVNFQYDLQTCDNKMISN----------SLFGDITRSVIFKTSQVSCKYLYKDQ-SNLVSIRCREEYKTATIKTNENQ--MVVEITTNIYKENQLPSPDRTFTNKNMFET---GXXXXXXXXXXXXSPYSAAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQK--------------SDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQDRSSAL-SILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTNNYGV------NFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYL 2158
            +K  +KY Y Y  ES    +  +    G +I  KV +     C   L  +D  + +    S+ G   +K    S  F++A+E N + F  E     SV    +EP    NIK+ I+ +L +  ++ + +    T HG C   SSE +     + +  V  + DL  C N    N           L G +++ +   +S  +C Y + ++  ++   +CRE++      ++E+Q  +V E+  ++  +      +R F+N+          E  E      +    ++  TL D+    ++ E +   +LF +LV+ ++ + ++       E+ +              S  C     +I      + G V+     +V+  L   SR                   P  + L+++ T        T L+    ++     K+     Q  P +  + + F+  L GDCS  +D T  ++T   I + G   ++ +P ++ ++L +CI +    LS++ SA++  + M+   D S AL     + E  +E RI AYL +M   ++  + +V + L  E   QV SF+ +H++N+ +  D   + I+D +    L+ + ++S   F++       + NY V      +  SNVIF   +F+PR V L TT   F  S   LE+    EGLE  +  +FG  G+ 
Sbjct:   23 YKNFRKYTYDYTAESTNGVSGTANIKNGPRITCKVELEVPQTCSFVLRTADCALSEVALISAQGQPVYKPVAGSDLFQAAMEKNPLNFVVEQVTEVSVFPKEDEPENILNIKRGIISALLSPVMEEEHNKKMPTIHGLC---SSELTVNSRKDIDVDVTVERDLSQCSNFSPQNLPTSPLSLTPGLNGLVSKLI---SSSQTCNYQFDNRKKHMTETQCREKHVFIPF-SHEDQYGIVSEVKQSLVLQESSKINNRYFSNEGSLHRKLFPEEVEEKLFSQNKEDVLSSMQTLSDLSRLGRNQERA---RLFQKLVSQVRGMKNETLSSAVEEMARISGWLSWQVLLQCGSSECSSAALQILRGLEGSGGEVD-----AVVYTLALLSR-------------------PDPQRLRDILTTAQTRPTKTVLYALANTVKKFPLKD----AQMIPEVREV-AEFMEFLLGDCSGDQDQT--FLTLRVIGVMG-KYMEGFP-SLKSSLLRCIRQSDASLSVQKSAVQSFRLMEIDPDVSRALMDQYQDAEAPAEKRIAAYLMLMRNPEL--VDEVLKTLRDESNLQVKSFVISHISNLMDLTDPDLQTIKDYITRA-LENDENLSAADFTK------FSRNYKVVVPRAGSVQSNVIFDSVNFMPREVMLATTLDAF--SAEILEIGLEGEGLEPTIDALFGENGFF 671          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Cavefish
Match: apoba (apolipoprotein B [Source:NCBI gene;Acc:103044560])

HSP 1 Score: 97.8265 bits (242), Expect = 4.961e-19
Identity = 158/700 (22.57%), Postives = 298/700 (42.57%), Query Frame = 2
Query:  173 FKPGQKYVYSYEGESNIKTTKGSYETTGVKIKSKVTITGLSNCEMKLSLSDVQIFDKT--SSDGNQ-FKESPNSYKFKSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTSHGKCFITSSEKSPKEETNPN-SVNFQYDLQTCDNKMISN----------SLFGDITRSVIFKTSQVSCKYLYKDQ-SNLVSIRCREEYKTATIKTNENQ--MVVEITTNIYKENQLPSPDRTFTNKNMFETGXXXXXXXXXXXXSPYSAAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQK--------------SDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQDRSSAL-SILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTNNYGV------NFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYL 2158
            +K  +KY Y Y  ES    +  +    G +I  KV +     C   L  +D  + +    S+ G   +K    S  F++A+E N + F  E     SV    +EP    NIK+ I+ +L +  ++ + +    T HG C   SSE +     + +  V  + DL  C N    N           L G +++ +   +S  +C Y + ++  ++   +CRE++      ++E+Q  +V E+  ++  +      +R F+N+      +   E E +          ++++ +    +   + +  +LF +LV+ ++ + ++       E+ +              S  C     +I      + G V+     +V+  L   SR                   P  + L+++ T        T L+    ++     K+     Q  P +  + + F+  L GDCS  +D T  ++T   I + G   ++ +P ++ ++L +CI +    LS++ SA++  + M+   D S AL     + E  +E RI AYL +M   ++  + +V + L  E   QV SF+ +H++N+ +  D   + I+D +    L+ + ++S   F++       + NY V      +  SNVIF   +F+PR V L TT   F  S   LE+    EGLE  +  +FG  G+ 
Sbjct:   40 YKNFRKYTYDYTAESTNGVSGTANIKNGPRITCKVELEVPQTCSFVLRTADCALSEVALISAQGQPVYKPVAGSDLFQAAMEKNPLNFVVEQVTEVSVFPKEDEPENILNIKRGIISALLSPVMEEEHNKKMPTIHGLC---SSELTVNSRKDIDVDVTVERDLSQCSNFSPQNLPTSPLSLTPGLNGLVSKLI---SSSQTCNYQFDNRKKHMTETQCREKHVFIPF-SHEDQYGIVSEVKQSLVLQESSKINNRYFSNEGSLHRKLFPEEVEEKLFSQNKEDVLSSMQTLSDLSRLGRNQERARLFQKLVSQVRGMKNETLSSAVEEMARISGWLSWQVLLQCGSSECSSAALQILRGLEGSGGEVD-----AVVYTLALLSR-------------------PDPQRLRDILTTAQTRPTKTVLYALANTVKKFPLKD----AQMIPEVREV-AEFMEFLLGDCSGDQDQT--FLTLRVIGVMG-KYMEGFP-SLKSSLLRCIRQSDASLSVQKSAVQSFRLMEIDPDVSRALMDQYQDAEAPAEKRIAAYLMLMRNPEL--VDEVLKTLRDESNLQVKSFVISHISNLMDLTDPDLQTIKDYITRA-LENDENLSAADFTK------FSRNYKVVVPRAGSVQSNVIFDSVNFMPREVMLATTLDAF--SAEILEIGLEGEGLEPTIDALFGENGFF 688          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Cavefish
Match: apoba (apolipoprotein B [Source:NCBI gene;Acc:103044560])

HSP 1 Score: 97.8265 bits (242), Expect = 4.962e-19
Identity = 162/703 (23.04%), Postives = 299/703 (42.53%), Query Frame = 2
Query:  173 FKPGQKYVYSYEGESNIKTTKGSYETTGVKIKSKVTITGLSNCEMKLSLSDVQIFDKT--SSDGNQ-FKESPNSYKFKSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTSHGKCFITSSEKSPKEETNPN-SVNFQYDLQTCDNKMISN----------SLFGDITRSVIFKTSQVSCKYLYKDQ-SNLVSIRCREEYKTATIKTNENQ--MVVEITTNIYKENQLPSPDRTFTNKNMFET---GXXXXXXXXXXXXSPYSAAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQK--------------SDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQDRSSAL-SILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTNNYGV------NFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYL 2158
            +K  +KY Y Y  ES    +  +    G +I  KV +     C   L  +D  + +    S+ G   +K    S  F++A+E N + F  E     SV    +EP    NIK+ I+ +L +  ++ + +    T HG C   SSE +     + +  V  + DL  C N    N           L G +++ +   +S  +C Y + ++  ++   +CRE++      ++E+Q  +V E+  ++  +      +R F+N+          E  E      +    ++  TL D+    ++ E +   +LF +LV+ ++ + ++       E+ +              S  C     +I      + G V+     +V+  L   SR                   P  + L+++ T        T L+    ++     K+     Q  P +  + + F+  L GDCS  +D T  ++T   I + G   ++ +P ++ ++L +CI +    LS++ SA++  + M+   D S AL     + E  +E RI AYL +M   ++  + +V + L  E   QV SF+ +H++N+ +  D   + I+D +    L+ + ++S   F++       + NY V      +  SNVIF   +F+PR V L TT   F  S   LE+    EGLE  +  +FG  G+ 
Sbjct:   40 YKNFRKYTYDYTAESTNGVSGTANIKNGPRITCKVELEVPQTCSFVLRTADCALSEVALISAQGQPVYKPVAGSDLFQAAMEKNPLNFVVEQVTEVSVFPKEDEPENILNIKRGIISALLSPVMEEEHNKKMPTIHGLC---SSELTVNSRKDIDVDVTVERDLSQCSNFSPQNLPTSPLSLTPGLNGLVSKLI---SSSQTCNYQFDNRKKHMTETQCREKHVFIPF-SHEDQYGIVSEVKQSLVLQESSKINNRYFSNEGSLHRKLFPEEVEEKLFSQNKEDVLSSMQTLSDLSRLGRNQERA---RLFQKLVSQVRGMKNETLSSAVEEMARISGWLSWQVLLQCGSSECSSAALQILRGLEGSGGEVD-----AVVYTLALLSR-------------------PDPQRLRDILTTAQTRPTKTVLYALANTVKKFPLKD----AQMIPEVREV-AEFMEFLLGDCSGDQDQT--FLTLRVIGVMG-KYMEGFP-SLKSSLLRCIRQSDASLSVQKSAVQSFRLMEIDPDVSRALMDQYQDAEAPAEKRIAAYLMLMRNPEL--VDEVLKTLRDESNLQVKSFVISHISNLMDLTDPDLQTIKDYITRA-LENDENLSAADFTK------FSRNYKVVVPRAGSVQSNVIFDSVNFMPREVMLATTLDAF--SAEILEIGLEGEGLEPTIDALFGENGFF 688          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Cavefish
Match: apoba (apolipoprotein B [Source:NCBI gene;Acc:103044560])

HSP 1 Score: 97.4413 bits (241), Expect = 5.762e-19
Identity = 162/703 (23.04%), Postives = 299/703 (42.53%), Query Frame = 2
Query:  173 FKPGQKYVYSYEGESNIKTTKGSYETTGVKIKSKVTITGLSNCEMKLSLSDVQIFDKT--SSDGNQ-FKESPNSYKFKSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTSHGKCFITSSEKSPKEETNPN-SVNFQYDLQTCDNKMISN----------SLFGDITRSVIFKTSQVSCKYLYKDQ-SNLVSIRCREEYKTATIKTNENQ--MVVEITTNIYKENQLPSPDRTFTNKNMFET---GXXXXXXXXXXXXSPYSAAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQK--------------SDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQDRSSAL-SILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTNNYGV------NFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYL 2158
            +K  +KY Y Y  ES    +  +    G +I  KV +     C   L  +D  + +    S+ G   +K    S  F++A+E N + F  E     SV    +EP    NIK+ I+ +L +  ++ + +    T HG C   SSE +     + +  V  + DL  C N    N           L G +++ +   +S  +C Y + ++  ++   +CRE++      ++E+Q  +V E+  ++  +      +R F+N+          E  E      +    ++  TL D+    ++ E +   +LF +LV+ ++ + ++       E+ +              S  C     +I      + G V+     +V+  L   SR                   P  + L+++ T        T L+    ++     K+     Q  P +  + + F+  L GDCS  +D T  ++T   I + G   ++ +P ++ ++L +CI +    LS++ SA++  + M+   D S AL     + E  +E RI AYL +M   ++  + +V + L  E   QV SF+ +H++N+ +  D   + I+D +    L+ + ++S   F++       + NY V      +  SNVIF   +F+PR V L TT   F  S   LE+    EGLE  +  +FG  G+ 
Sbjct:   40 YKNFRKYTYDYTAESTNGVSGTANIKNGPRITCKVELEVPQTCSFVLRTADCALSEVALISAQGQPVYKPVAGSDLFQAAMEKNPLNFVVEQVTEVSVFPKEDEPENILNIKRGIISALLSPVMEEEHNKKMPTIHGLC---SSELTVNSRKDIDVDVTVERDLSQCSNFSPQNLPTSPLSLTPGLNGLVSKLI---SSSQTCNYQFDNRKKHMTETQCREKHVFIPF-SHEDQYGIVSEVKQSLVLQESSKINNRYFSNEGSLHRKLFPEEVEEKLFSQNKEDVLSSMQTLSDLSRLGRNQERA---RLFQKLVSQVRGMKNETLSSAVEEMARISGWLSWQVLLQCGSSECSSAALQILRGLEGSGGEVD-----AVVYTLALLSR-------------------PDPQRLRDILTTAQTRPTKTVLYALANTVKKFPLKD----AQMIPEVREV-AEFMEFLLGDCSGDQDQT--FLTLRVIGVMG-KYMEGFP-SLKSSLLRCIRQSDASLSVQKSAVQSFRLMEIDPDVSRALMDQYQDAEAPAEKRIAAYLMLMRNPEL--VDEVLKTLRDESNLQVKSFVISHISNLMDLTDPDLQTIKDYITRA-LENDENLSAADFTK------FSRNYKVVVPRAGSVQSNVIFDSVNFMPREVMLATTLDAF--SAEILEIGLEGEGLEPTIDALFGENGFF 688          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Cavefish
Match: apobb.2 (apolipoprotein B-100-like [Source:NCBI gene;Acc:103031260])

HSP 1 Score: 76.6406 bits (187), Expect = 1.115e-12
Identity = 196/959 (20.44%), Postives = 375/959 (39.10%), Query Frame = 2
Query:  173 FKPGQKYVYSYEGESNIKTTKGSYETTGVKIKSKVTITGLSNCEMKLSLSDVQIFD--KTSSDGNQ-FKESPNSYKFKSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTSHGKCFITSSEKSPKEETNPNS-------VNFQYDLQTCDN-----------KMISNSLFGDITRSVIFKTSQVSCKYLYKDQ-SNLVSIRCREEYKTATIKTNENQMVVEITTNIYKE-----NQLPSPDRTFTNKNMFETGXXXXXXXXXXXXSPYSAAK---TTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLN----KCITKDTNKLSIRISALEVMKHMDCKQD-RSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESND----QLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTNNYGV-NFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYL---------------------------------KKEKGAQENL---------ELINILNEMS---GSVNIKLFGNQVSFIEL--IRGTLSSVKKYNIIEEI-----------MYWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIK--IKSKFDVAGLVSWP---------ISVNIDNYISPNINAELHTEIVYQTPFTNYGMRMKLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFSVEGN 2722
            ++   KY Y YE ES +    G+    G K   KV I     C   +   +  + +   T +DG+  F+ +  S  FK+ +E N +    E +    +  + +E +   NIK+ I+ +LA   ++ + ++   T  G C         K E   N+       V    DL  CDN            +I+   +G    + +F + Q +C Y + +   ++ S  C E +        E   +    TN+ K+           DR F +    E  ++    +   + SP    K   T + ++    K++   +   L  +LV+ +++ N+            S   PE  T  + + Y A     T    S ++  ++ S  S  + +  + ++  +   PS   +KE+  +          + +  ++  LY  E  +  Q     A  VS  +    GDC+  ++        I ++L+  GN+          L     +CI++      ++ +A++V +     ++ RS  L ++L+     + RI AYL +M     + L ++   L  E+  Q  SF  +H+TNI  S      QL+E I D L   ++ +  + +  +FSR         NY + +   ++IF E   +P+ + L  T + F    +  E+    +G E  +  +FGP G+                                  +K++ A +N+         +LIN L         + ++L G ++ ++++  ++    +V K  ++E++           ++ S D  L    +   +D    +PT  G PL+  L G+ A   K  +K   D++ +   P         I  ++ +Y+   +  E+HT + ++      G+  KL    N + K TI      E   K  S   T ++FSV G+
Sbjct:   33 YRSFHKYEYLYEAES-LNGLNGAL--NGPKASCKVEIEVPGTCHYVVHTKECTLSEVIDTDTDGSPVFRPAAASDNFKAEMEKNPLKVIVEGDNDIKLFPEDDELINILNIKRGIISALAVPVLEEERNNRMPTIFGLC---------KTEYTVNARGDIATDVTLTRDLSRCDNFRPIKDHTSPLALITGMNYG---LAQLFNSKQ-TCNYKFDNTLKHMTSGVCTENHLLVPFSHQEKYGI----TNVAKQTVSLVGVTEYNDRVFDHN---EANMKPLYLDASIDMSPIQDEKAILTVMTELADLSKTNNGRRRAHLAQKLVSMMRKANADTL---------SAFLPEALTVSRFLTYQALFQCGTPECSSAIMKFLRISGSSTAEIDTAVYAMGLVPN-PSRALVKEMLEMARYKPTKLIYYATSNAVRRLYTAEG-KVTQEIQAAADYVSEEI----GDCTGDQE-------HIYLTLRVTGNMAAAVGAASPALKSAVIQCISQPAATPKVQQAAIQVFRLTPIPEEGRSVLLQVVLDGVAPLQKRIAAYLILMKDPQADELTQITAALPNEQNLQAKSFFISHMTNILSSTAPETRQLRERILDALQGNEIGEVMNPA--QFSR---------NYKIGSLQGSMIFGEDE-LPKEIVLEMTLNAFGFDFDMFEVGVEGKGFEPTVEALFGPNGFFPDTVMKTIYFAADKMPPQFNQVLRNIIPELRNDRKKRQATQNIVREITQNVEKLINDLKAQDTPEAMLYLRLLGAELGYLKMEDMQELAHAVSK--VVEKLLKMFPTEYIKGLFSSTDNELFL--HYMFMDNEFYLPTGPGVPLRVALSGTFAPGFKGGLKIARDMSEISCMPSVGVEFVTEIGTHLPDYVQSGL--EMHTSLYHER-----GITAKLALAQN-QIKLTI---PAPETPSKLIS--ITNSLFSVAGD 917          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Nematostella
Match: EDO48127 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK90])

HSP 1 Score: 98.2117 bits (243), Expect = 7.468e-23
Identity = 53/168 (31.55%), Postives = 98/168 (58.33%), Query Frame = 2
Query: 1586 KCITKDTNKLSIRISALEVMKHMDCKQDRSSAL-SILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESND-----QLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTN--NYGVNFDSNVIFSEKSFVPRSVSLNTTASI 2065
            KC   D   +++ I+ALE ++ M C+Q+ +  L +I  ++ ND E+R+ +YL ++ C +   L ++ ++   E  NQVGSF+W+HLTN  ES +      +   ++  L   ++ +EF++++L+FSR +E +F ++    G +   ++I+   SF PRS  LN T  +
Sbjct:    2 KCAVNDNLPINMTIAALESLRRMPCRQETTEQLFNIYASHHNDVEIRVASYLALLKCPNKELLRRIAKVQRTEVNNQVGSFVWSHLTNAMESTEPVHGLPMARMLQKALGG-NVLREFNLNRLRFSRAVEGSFYSDILRAGGSVQGHLIYHPNSFFPRSTHLNITMDV 168          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000015835.2 (pep primary_assembly:ASM223467v1:24:6559546:6567281:-1 gene:ENSORLG00000012638.2 transcript:ENSORLT00000015835.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.0485 bits (227), Expect = 1.498e-17
Identity = 153/694 (22.05%), Postives = 292/694 (42.07%), Query Frame = 2
Query:  185 QKYVYSYEGESNIKTTKGSYETTGVKIKSKVTITGLSNCEMKLSLSDVQIFDKTSSD--GNQ-FKESPNSYKFKSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSLA--------NQGIQTKPDSYKKTSHGKCFITSSEKSPKEETNPNSVNFQYDLQTCDN-----------KMISNSLFGDITRSVIFKTSQVSCKYLYKDQ-SNLVSIRCREEYKTATIKTNENQ----MVVEITTNIYKENQLPSPDRTFTNKNMFETGXXXXXXXXXXXXSPYSAAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGN----LKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQD-RSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESND----QLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTNNYGVNFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYL 2158
            +++VYSY+ E+       S   +G ++   V +     C   L  ++  + + +  D  GN  ++ +  +  F++A+         +  EVK    D +EPV   NIK+ I+ +L         NQ +     +   T HG C    +  S +EE  P  V    DL  CD             +IS     +   S +  ++Q +C Y + +Q  ++ S  C E++      +++N+     VV  T  + +  Q+   DR F     F        D+    ++   A   T++ +    +++   +   LF ELV+ L+ L +   + +  E+   DI         S+ + A     T    S ++  ++T   +  + +  + ++  +Q  PS   +K+L   ++ +  S P+  +L     +  K           I  +       L  DC   K+ T        ++L+ +GN    ++     +  TL KC+ +    LS++++A++  + M    + RS+   +    +   + R+ AYL +M     + +  V +IL++E+  QV +F+ +H+ NI  SND       + I D ++D D+   +D + +K SRN +      +   +   NVIF   S +PR V L TT   F  S++  E+    +G E  +  +FG  G+ 
Sbjct:   50 KRFVYSYKAETFNSVNGASDNKSGPRVSCTVEVDVPQTCSFILRTTECSLSEISGVDDGGNPVYRVAAEAEAFRTAM--------AKQTEVKLYPED-DEPVNILNIKRGIVSALMVPEMTEEKNQNVV----NLFPTVHGVCSTDITVNS-REEI-PTDVTLIRDLSKCDGFTAHRQHTSPLALISGM---NYPLSKMISSTQ-TCNYKFDNQMKHMTSGSCTEKHVFLPF-SHKNEYGISAVVRQTVTLRETEQI--NDRIFDISEFFTVSHLILADDKSPLQTK-DAVIATMQKLNTLSQTANGEERAGLFRELVSELRGLKADLLRSVTDEMM--DIS-------SSLAWQALIQCGTPECTSAILKTLRTYDSAAMEVDAVVYAMGMLQH-PSRLMVKDLLE-MAQSKQSKPIMYALSITKTILTK-----------INDVYEFVTSILGADCPGEKELT-------FLTLRVVGNMGDAMESVDPKIKTTLVKCMRQPATTLSVQLAAIQAFRRMSVNDEVRSNLQRVSQYPKGAVQKRLAAYLILMRNPQDSDIEAVTKILTQEQNPQVKAFVSSHIYNIISSNDPDTKSFGKKILDAMEDTDVATHYDYT-IK-SRNYKLGMAHESLQASVQGNVIFDPSSRLPREVLLETTLKAFGYSSDIWEVGMEGKGFEPTIEALFGENGFF 689          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Medaka
Match: apobb.2 (apolipoprotein B-100-like [Source:NCBI gene;Acc:101158990])

HSP 1 Score: 91.2781 bits (225), Expect = 4.312e-17
Identity = 171/809 (21.14%), Postives = 330/809 (40.79%), Query Frame = 2
Query:  404 LEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTSHGKCFITSSEKSPKEETNPNSVNFQYDLQTCDNKMI----SNSLFGDITR-----SVIFKTSQVSCKYLYKDQS-NLVSIRCREEYKTATIKTNENQMVVEITTNIYKENQLPSPDRTFTNKNMFETGXXXXXXXXXXXXSPYS---AAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLK--YYPAT--VINTLNKCITKDTNKLSIRISALEVMKHMDCKQD-RSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESND-QLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTNNYGVNFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYLK-----------------------------KEKGAQENL------ELINILNEMSGS------VNIKLFGNQVSFIELIRGTLSSVKKYNIIEEIMYWSQ--DKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLVSWPISVNIDNYISPNINAELHTEIVYQTP-FTNYGMRMKL----KSGTNTEF 2629
            +E  D    +   +VK    DGE      N K+ I+ +LA   +Q   +    T HGKC  TS   + +E+   + +N   DL  CD K +     NS    IT      S + ++SQ +C Y + ++  ++ S  C E +            V    TN+ K+ +L     +  N  +F+  ++    E   ++S      AA T ++++ V    SE  + P LF +LV+ ++ L ++           S   P+     + + Y       T    S ++ +++T   +  + +  + +L FM   PS   + ++  +    + S P+  +L ++   + K E +     P I S V+ F+ +  GDC+  +D          ++L+ +GN+    +PA+  +   + +C+ +      ++ +A++  + +   Q+ R   + +LLN  N  + RI AYL +M   + + L ++ +    E  +Q+ +F+ +H+ NI  S D + +  +    D + L   + +  L                   +SN+I+   S++P+ V L+ T   F    + +E+    +G E  +  +FG +G+                               K +  +ENL       +  +L EM  +      V ++L GN++ +++      SS        EI   +Q  D   +F  +   +D    +PT+ G PL+  L G+ A   +        G+    +S        P+   E  T++    P F + G+ M      +SG   EF
Sbjct:    1 MESMDTIVVEGEYDVKLYPEDGETSTIL-NFKRGIVSALAVPSLQEDKNKNMPTIHGKCR-TSYNINAREDIITD-INLNRDLSRCD-KFVPIRDHNSPLALITGMHYPLSQLVRSSQ-TCNYKFDNEKKHMTSGSCTETHILIPFSHKGKYGV----TNVGKQ-ELTLVQVSAHNDRVFDHNVQDLHMEAVKDKSAIQDKEAALTLMREL-VSLPDSEGERRPHLFQKLVSMVRGLTTETL---------SAAVPDALGVSRFLTYQVLAQCGTPECSSAIMQILRTFDTTSPEVDAAIFALGFMSN-PSALLINDMLQMAKFKS-SKPIMYALSNVVKRFYKAEKKLI---PEIHS-VAEFMADELGDCTGDQDHA-------FLTLRVIGNMAPAVFPASPALRKAVLQCVNQPAAGQQVQQAAIQAYRQIPVPQEARKVLMEVLLNKGNPVQQRIAAYLVLMKDPETSELAQLDDAFLNEDNDQLLNFVMSHIINILSSTDPETRHVVAPYFDPMTLSSNYKLGSL-------------------ESNMIYESGSYLPKEVMLDMTLKAFGFEIDMMEIGMEGKGFEPAIVALFGEDGFFPDTTLKAMYFVTENMPDAVSEMLQNIIPALKNRKKRENLIKEIGQNIEKLLREMKAAESPEAMVYLRLLGNELGYLK------SS--------EIASSAQMIDPVTNFFAHYIFMDNEFFLPTVTGVPLRVSLSGTFAPGFR-------GGIQQNSVS------FMPSAGLEFVTQVGSHIPEFVDSGLEMHTNLFHESGIKVEF 730          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Medaka
Match: apoba (apolipoprotein B-100 [Source:NCBI gene;Acc:101156458])

HSP 1 Score: 73.1738 bits (178), Expect = 1.270e-11
Identity = 112/497 (22.54%), Postives = 205/497 (41.25%), Query Frame = 2
Query: 1442 VSAFLHNLNGDCS--IPKDATDDYVTKIQIS---LKGLG----NLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQD-RSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESND----QLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTNNYGVNFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGY-----------------------------------------LKKEKGA-QENLELINILNEMSGSVNIKLFGNQVSFIELIRGTLSSVKKYNIIE--EIMYWSQDKSLDFNKNLQLVDKT--------------VVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLVSWPISVNIDNYISPNINAELHTEIVYQTP-FTNYGMRMKLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFSV 2713
            VS F+  L  DCS  IP  A+D      ++S   L+ +G     ++    ++++++ +C  K    L+ + +AL  ++ MD   + RS+ + +  + ++  E RI AYL +M   D + L  +   L KE+  Q+ SF+ ++L NI  S D    Q+K +I  +L   +L  + ++     SRN +   + +  G +  SN+IF  ++ +P+ V L  T   F  S +  E+     G E  +  +FG +G+                                         LK  KG  Q+ L+ + +      +  ++L G ++       G L + +  NI+E   + Y    + L     L+L   T                +PT  GFPL F L G  A  ++        GL+    S      + P++  E  T +    P + + G++M       +   A I  ++N ++ V   +P +   +FS+
Sbjct:  446 VSTFMEQLLNDCSKEIPDTASDFSPDPKEMSFLVLRVVGVMAQAMQDSSPSLVSSVLRCSQKTDLPLANQKAALRTLQQMDMNDEIRSTLMELYRDTQSPLEKRIAAYLVLMKKPDRSLLRDLVNSLMKERDKQLRSFVVSYLNNILRSEDPQMLQIKADIEKVLQG-ELPPQNNVFH-GLSRNYK---MESPLG-SVHSNIIFDGRNTLPKEVILEATMKAFGSSYDIFEVGVEGAGFEPTVDALFGEKGFFSESISRLMRFLGDKTPLLKEVLDRISPHQERMKRQVTEDHLKAFKGIFQKLLQDVRLSEAPEATAYLRLLGEEI-------GYLKTSEMRNILEGFSLYYHIFIRVLPAQAFLKLTSSTENELFFHYIFMENAFSLPTASGFPLTFSLSGVLAPGVQ-------GGLIP---SAMTSLSVMPSVGLEFITHMGVDIPDYVDAGIQMHTNMYHESSLNAKISISRN-QVRVWIPAPTSNTQVFSI 918          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Medaka
Match: FCGBP (Fc fragment of IgG binding protein [Source:NCBI gene;Acc:101155957])

HSP 1 Score: 60.8474 bits (146), Expect = 6.353e-8
Identity = 56/213 (26.29%), Postives = 91/213 (42.72%), Query Frame = 2
Query: 16037 TINIGSNTFELSASN-YKVNLNGKPSDLPIQIGSTSLVGLGRMMKLKDDKLGLTITIDPVNEMFTVGISGWYHGKVRGLFGNSDNEQFNDFMLDNGKIVSNEVFMKEISYKSQS------------CKVVSDEEQTVVKPIKGCPFIRRMVCKFLFKCPFSPLAACFNKVNPKKFHKLCVHSTEEVLTKLDPSICKAARQYQAQCQKAGVNIQ 16636
            T +I  +T  +S  N YK  LNG+ + LP++      V L     + +   G+TIT D  + +  V +   YHG + GL GN + +  +D  + NGK   +E  + E S++  S            C+  SD ++ V +  + C  I              P   C   V+P  + + CV+   +       S+CKA   Y + CQ  G+ I 
Sbjct: 1689 TFSIYGSTLTISKENPYK--LNGQLAALPLKSNDELAVFLSGSQAVIETAAGITITYDWWSTV-RVTVPSNYHGAMCGLCGNYNGKALDDMTMQNGKTTPDEAKLGE-SWQVASVPGCSSACQGPWCQACSDSQKKVYQASQFCGIIADET---------GPFRECHKFVDPAAYVEDCVYDVCQ-FHGHHGSVCKAVEVYLSACQSQGIPIH 1887          
BLAST of Vitellogenin domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000029569.1 (vitellogenin-1-like [Source:NCBI gene;Acc:101159180])

HSP 1 Score: 58.5362 bits (140), Expect = 3.090e-7
Identity = 80/384 (20.83%), Postives = 161/384 (41.93%), Query Frame = 2
Query: 1355 LFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCI-----TKDTNKLSIRISALEVMKHMDCKQDR---SSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVN-QVGSFIWTHLTNIKESNDQLKENIRDLLDDVD--LKKEFDISKLKFSRNIEKTFLTNNY--GVNFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFK---IFGPEGYLKKEKGAQENLELINIL--NEMSGSVNIKLFGNQVSFI--------ELIRGTLSSVKKYNIIEEIMYWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKL 2428
            +FL  G++   YC E      +D      V      L+   ++ K  T+D +  +++    LGN  + P++ + ++ K I        +  + + I A+  ++++  K+ R     AL + ++   D ELR+ + + +   +    L        K + N QV SF ++H+ ++  S   +  ++    +     L  + D   L++S+ +     ++++  G    +  I    +F+PRSV   T A     + + LE+  R +GL++ L K   +      + K K   + L     L  N+   S  IKLFG +++F         + I  + SS + Y+I           S ++   +   +   ++PT  G P +  L
Sbjct:  428 VFLGYGTMISKYCAE------SDVCPVEFVQPIQKRLSE--AVSKGETEDIILYVKV----LGNAGH-PSS-LKSITKIIPIHGTAAASLPIRVHIEAIMALRNIAKKEPRMVQELALQLYMDKALDPELRMLSCIVLFETNPSMALISTLANAVKSEENLQVASFTYSHMKSLSRSASMIHPSVAAACNVAMKILSPKLDRLSLRYSKAVYGEAYSSSFMLGAAATAFYINDAATFLPRSVVAKTKAFFVGAAADVLEIGVRTDGLQETLLKNPSVLKSGDRITKMKRVIKALSQWRSLPNNKPLASFYIKLFGQEIAFANIDKPLIEQAILASGSSAQTYSIKALKTLLLTGVSFNYTMPVMYTEVRRILPTASGLPFELSL 797          
BLAST of Vitellogenin domain-containing protein vs. Planmine SMEST
Match: SMESG000037977.1 (SMESG000037977.1)

HSP 1 Score: 5722.9 bits (14845), Expect = 0.000e+0
Identity = 2859/2891 (98.89%), Postives = 2865/2891 (99.10%), Query Frame = 2
Query:   53 MNLFGTAFLLVLLSIITNAARTPQFINPCSMKCSFEEDRIFKPGQKYVYSYEGESNIKTTKGSYETTGVKIKSKVTITGLSNCEMKLSLSDVQIFDKTSSDGNQFKESPNSYKFKSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTSHGKCFITSSEKSPKEETNPNSVNFQYDLQTCDNKMISNSLFGDITRSVIFKTSQVSCKYLYKDQSNLVSIRCREEYKTATIKTNENQMVVEITTNIYKENQLPSPDRTFTNKNMFETGXXXXXXXXXXXXSPYSAAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQDRSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTNNYGVNFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYLKKEKGAQENLELINILNEMSGSVNIKLFGNQVSFIELIRGTLSSVKKYNIIEEIMYWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLVSWPISVNIDNYISPNINAELHTEIVYQTPFTNYGMRMKLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFSVEGNAYVIHRDKEIIQLQDKLKEIKMCTSEMTVRILGIRVCGEAKVLDPSTRKDALLFGPFAANVFIEKIDTQTEYILLATSKTSAFISQTGKVYSNRHIKFEFNTPNSKFYNRRFYGEILMDFKQKEFKLELVTPWTDALVAARLKLTDGETKIAFNFKANKQNIIDISAEHLIFSSPKRTNTKGGISIQILNLTPIRKRWNLELTDDAYSFTFVSKGLLKEETHLKIKVLRKNPMKNLSAFNTYEISGFFNTYFGYGKISGRTSENYFGHRWDIKISHKNKQRKEYQIIFRHKVEDKSSKNLNKYILTTTFNYGEKAENFVTFKTENELSDKHIRTSMKASYGGKETPNNKAYEEEMSMKLYGGYTWKSDDIYYAEGSLSFKLPSKNLNYEGRYISEIGKRVFKLSLDFDKDQQSKINLKINYLQPKLYLKDTDFSVLFSLPYHNFDLKWKLMEIDVNKYTYTLDGKYNTYDMKIDGVHTQISRLDHDSYVSIKMPRIQGLPTDVKGKLRVNLVDMAKAKIKGGIEIPNTDYKYSFDSEFSYIPNNLLEISKSEISSVLTYNIEVSSKQRLMKSKFIFTCNPEEFRTLFNVDLNGNSNSDNKIEFDIQALQKNPVYKQFESVARLALQYPGNRHSIGFKSDFKYSEMVAQIDLIWNKNQRISITSTYQLDNSWTQKGLAASLTVKTPFIGYEQIHFGMTAVGQLRYRKVNFECKWADNKKLIFDIVIQPKSSSDFSLNAKLTSPFKGFNLVTFQAKHLQTSNSINTQCVVEIGPVKRYQIKFETINNSEDKNRDFLSNILIESGIYPAFKMSLLHKDDSVHYKSQFDVLWMKTQSINVKSDISFNLEDYEFTTKGNVELFSTIKEAKQMKMVWSLENRDSQFLHNVQMFHNNKNLFQTTIKGFYETEDNKIKIEFNGVASVMNGRSMKIANILIYSPLSIQNQFSVSQETNIIYSHNFNMNXXXXXXXXXIPNIQTKKVEFEYKIDRKQEEAESQIFVKINEKHLFHIEMEEKYQRVXXXXXXXXXXXXFMSDYATVKNFETKTDIKIKPEFFKVDFKLKSENLVLLTVTAEVLKELHKKKIQLVINSKYESLKQLKFDWEHIYKDSDSSFTNSLDFNMNKIIHFNSKINLRGFELIKIDMMLKKRDYVRYFKLKHSRHLLGFEDQMDTNLFSEKFKFTNTIISRGGISVQFRLQTNLFFFKSIEIFGRFSKEHEIKVFYQLPRDSNKIEKIKVIFSNFQGIQKLTVDTTTLFKLEFNFDRKQFKTILFDFKFLPNSDESAVKFKFNFDGNRNALKHSSELKLNIGNRKFEIENKVEKVKWSYLLFETEIKTNDNSFKNYRTGFEYKIRPSKYSTDVKLFFNDKFIKLSSELDSSFGSKVELKIETSFEVLKEVSFELKHKQNSMMTQVTHKCKTVIKSFDNFLRLQNEIEWSGFNYVKVESTFEGNLSDNRYAFEPKSLKFLHQYHKGIMKDNFQLSMSKNRHFKFQLEVPLNRKSKSLFELESSFQNLKQLTIDFNINFSENEEKSLALKIVRNNEIAINMESKLKHQEKFVLMTVDLDTVGNFKSGLSIELVENSFGTKTVKVKLVSSLLKESIILITKVNIQKKEISLSLTAAIDQQASFYGKVSKSQNLIQIKYGKHKFDFETLVDKNDGFKLLKVSLFSIVKFNTELTRSSNYLGLKGDFDNHSLQISYNYKRELKVEFNIKHIFGALKINQIISDSNINYKIEGKSNIPEWTAMHTELDMTKSTKGFTMVFYIKKENRDALKLNFEQKFFQSITFTYSSIHKLFKTGKLEINYENFPQKLNMKFDGKNSISQPITAEYELNATSFSGKITSPFEWLRSCSIKGQLTISNDEVKGKFDINHNKLKQPINGEITIQRKFDLLKVELKTPFLYPLNQLSFRNERSDSILIIELNDAQNQLFYYKLKTYSKAKYDLDASITIPXXXXXXXXXXXXNFDFENPTKSIKFLVKSNQFSDTSLSATYNLNQNEYKIQFSHPKK 8725
            MNLFGTAFLLVLLSIITNAARTPQFINPCSMKCSFEEDRIFKPGQKYVYSYEGESNIKTTKGSYETTGVKIKSKVTITGLSNCEMKLSLSDVQIFDKTSSDGNQFKESPNSYKFKSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTSHGKCFITSSEKSPKEETNPNSVNFQYDLQTCDNKMISNSLFGDITRSVIFKTSQVSCKYLYKDQSNLVSIRCREEYKTATIKTNENQMVVEITTNIYKENQLPSPDRTFTNKNMFETGIEQAEDEIEAEESPYSAAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQDRSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTNNYGVNFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYLKKEKGAQENLELINILNEMSGSVNIKLFGNQVSFIELIRGTLSSVKKYNIIEEIMYWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLVSWPIS+NIDNYISPNINAELHTEIVYQTPFTNYGMRMKLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFSVEGNAYVIHRDKEIIQLQDKLKEIKMCTSEMTVRILGIRVCGEAKVLDPSTRKDALLFGPFAANVFIEKIDTQTEYILLATSKTSAFISQTGKVYSNRHIKFEFNTPNSKFYNRRFYGEILMDFKQKEFKLELVTPWTDALVAARLKLTD ETKIAFNFKANKQNIIDISAEHLIFSSPKRTNTKGGISIQILNLTPIRKRWNLELTDDAYSFTFVSKGLLKEETHLKIKVLRKNPMKNLSAFNTYEISGFFNTYFGYGKISGRTSENYFGHRWDIKISHKNKQRKEYQIIFRHKVEDKSSKNLNKYILTTTFNYGEKAENFVTFKTENELSDKHIRTSMKASYGGKETPNNKAYEEEMSMKLYGGYTWKSDDIYYAEGSLSFKLPSKNLNYEGRYISEIGKRVFKLSLDFDKDQQSKINLKINYLQPKLYLKDTDFSVLFSLPYHNFDLKWKLMEIDVNKYTYTLDGKYNTYDMKIDGVHTQISRLDHDSYVSIKMPRIQGLPTDVKGKLRVNLVDMAKAKIKGGIEIPNTDYKYSFDSEFSYIPNNLLEISKSEISSVLTYNIEVSSKQRLMKSKFIFTCNPEEFRTLFNVDLNGNSNSDNKIEFDIQALQKNPVYKQFESVARLALQYPGNRHSIGFKSDFKYSEMVAQIDLIWNKNQRISITSTYQLDNSWTQKGLAASLTVKTPFIGYEQIHFGMTAVGQLRYRKVNFECKWADNKKLIFDIVIQPKSSSDFSLNAKLTSPFKGFNLVTFQAKHLQTSNSINTQCVVEIGPVKRYQIKFE INNSEDKNRDFLSNILIESGIYPAFKMSLLHKDDSVHYKSQFDVLWMKTQSINVKSDISFNLEDYEFTTKGNVELFSTIKEAKQMKMVWSLENRDSQFLHNVQMFHNNKNLFQTTIKGFYETEDNKIKIEFNGVASVMNGRSMKIANILIYSPLSIQNQFSVSQETNIIYSHNFN+NSKSLKLKLLIPNIQTKKVEFEYKIDRKQEEAESQIFVKINEKHL +++                    FMSDYATVKNFETKTDIKIKPEFFKVDFKLKSENLVLLTVTAEVLKELHKKKIQLVINSKYESLKQLKFDWEHIYKDSDSSFTNSLDFNMNKIIHFNSKINLRGFELIKIDMMLKKRDYVRYFKLKHSRHLLGFEDQMDTNLFSEKFKFTNTIISRGGISVQFRLQTNLFFFKSIEIFGRFSKEHEIKVFYQLPRDSNKIEKIKVIFSNFQGIQKLTVDTTTLFKLEFNFDRKQFKTILFDFKFLPNSDESAVKFKFNFDGNRNALKHSSELKLNIGNRKFEIENKVEKVKWSYLLFETEIKTNDNSFKNYRTGFEYKIRPSKYSTDVKLFFNDKFIKLSSELDSSFGSKVELKIETSFEVLKEVSFELKHKQNSMMTQVTHKCKTVIKSFDNFLRLQNEIEWSGFNYVKVESTFEGNLSDNRYAFEPKSLKFLHQYHKGIMKDNFQLSMSKNRHFKFQLEVPLNRKSKSLFELESSFQNLKQLTIDFNINFSENEEKSLALKIVRNNEIAINMESKLKHQEKFVLMTVDLDTVGNFKSGLSIELVENSFGTKTVKVKLVSSLLKESIILITKVNIQKKEISLSLTAAIDQQASFYGKVSKSQNLIQIKYGKHKFDFETLVDKNDGFKLLKVSLFSIVKFNTELTRSSNYLGLKGDFDNHSLQISYNYKRELKVEFNIK IFGALKINQIISDSNINYKIEGKSNIPEWT MHTELDM KSTKGFTMVFYIKKENRDALKLNFEQKFFQSITFTYSSIHKLFKTGKLEINYENFPQKLN+KFDGKNSISQPITAEYELNATSFSGKITSPFEWLRSCSIKGQLTISNDEVKGKFDINHNKLKQPINGEITIQRKFDLLKVELKTPFLYPLNQLSFRNERSDSILIIELNDAQNQLFYYKLKTYSKAKYDLDASITIPKLLSEFKLSSFSNFDFENPTKSIKFLVKSNQFSDTSLSATYNLNQNEYKIQFSHPKK
Sbjct:    1 MNLFGTAFLLVLLSIITNAARTPQFINPCSMKCSFEEDRIFKPGQKYVYSYEGESNIKTTKGSYETTGVKIKSKVTITGLSNCEMKLSLSDVQIFDKTSSDGNQFKESPNSYKFKSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTSHGKCFITSSEKSPKEETNPNSVNFQYDLQTCDNKMISNSLFGDITRSVIFKTSQVSCKYLYKDQSNLVSIRCREEYKTATIKTNENQMVVEITTNIYKENQLPSPDRTFTNKNMFETGIEQAEDEIEAEESPYSAAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQDRSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTNNYGVNFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYLKKEKGAQENLELINILNEMSGSVNIKLFGNQVSFIELIRGTLSSVKKYNIIEEIMYWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLVSWPISMNIDNYISPNINAELHTEIVYQTPFTNYGMRMKLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFSVEGNAYVIHRDKEIIQLQDKLKEIKMCTSEMTVRILGIRVCGEAKVLDPSTRKDALLFGPFAANVFIEKIDTQTEYILLATSKTSAFISQTGKVYSNRHIKFEFNTPNSKFYNRRFYGEILMDFKQKEFKLELVTPWTDALVAARLKLTDSETKIAFNFKANKQNIIDISAEHLIFSSPKRTNTKGGISIQILNLTPIRKRWNLELTDDAYSFTFVSKGLLKEETHLKIKVLRKNPMKNLSAFNTYEISGFFNTYFGYGKISGRTSENYFGHRWDIKISHKNKQRKEYQIIFRHKVEDKSSKNLNKYILTTTFNYGEKAENFVTFKTENELSDKHIRTSMKASYGGKETPNNKAYEEEMSMKLYGGYTWKSDDIYYAEGSLSFKLPSKNLNYEGRYISEIGKRVFKLSLDFDKDQQSKINLKINYLQPKLYLKDTDFSVLFSLPYHNFDLKWKLMEIDVNKYTYTLDGKYNTYDMKIDGVHTQISRLDHDSYVSIKMPRIQGLPTDVKGKLRVNLVDMAKAKIKGGIEIPNTDYKYSFDSEFSYIPNNLLEISKSEISSVLTYNIEVSSKQRLMKSKFIFTCNPEEFRTLFNVDLNGNSNSDNKIEFDIQALQKNPVYKQFESVARLALQYPGNRHSIGFKSDFKYSEMVAQIDLIWNKNQRISITSTYQLDNSWTQKGLAASLTVKTPFIGYEQIHFGMTAVGQLRYRKVNFECKWADNKKLIFDIVIQPKSSSDFSLNAKLTSPFKGFNLVTFQAKHLQTSNSINTQCVVEIGPVKRYQIKFEAINNSEDKNRDFLSNILIESGIYPAFKMSLLHKDDSVHYKSQFDVLWMKTQSINVKSDISFNLEDYEFTTKGNVELFSTIKEAKQMKMVWSLENRDSQFLHNVQMFHNNKNLFQTTIKGFYETEDNKIKIEFNGVASVMNGRSMKIANILIYSPLSIQNQFSVSQETNIIYSHNFNINSKSLKLKLLIPNIQTKKVEFEYKIDRKQEEAESQIFVKINEKHLENLK--------------------FMSDYATVKNFETKTDIKIKPEFFKVDFKLKSENLVLLTVTAEVLKELHKKKIQLVINSKYESLKQLKFDWEHIYKDSDSSFTNSLDFNMNKIIHFNSKINLRGFELIKIDMMLKKRDYVRYFKLKHSRHLLGFEDQMDTNLFSEKFKFTNTIISRGGISVQFRLQTNLFFFKSIEIFGRFSKEHEIKVFYQLPRDSNKIEKIKVIFSNFQGIQKLTVDTTTLFKLEFNFDRKQFKTILFDFKFLPNSDESAVKFKFNFDGNRNALKHSSELKLNIGNRKFEIENKVEKVKWSYLLFETEIKTNDNSFKNYRTGFEYKIRPSKYSTDVKLFFNDKFIKLSSELDSSFGSKVELKIETSFEVLKEVSFELKHKQNSMMTQVTHKCKTVIKSFDNFLRLQNEIEWSGFNYVKVESTFEGNLSDNRYAFEPKSLKFLHQYHKGIMKDNFQLSMSKNRHFKFQLEVPLNRKSKSLFELESSFQNLKQLTIDFNINFSENEEKSLALKIVRNNEIAINMESKLKHQEKFVLMTVDLDTVGNFKSGLSIELVENSFGTKTVKVKLVSSLLKESIILITKVNIQKKEISLSLTAAIDQQASFYGKVSKSQNLIQIKYGKHKFDFETLVDKNDGFKLLKVSLFSIVKFNTELTRSSNYLGLKGDFDNHSLQISYNYKRELKVEFNIKQIFGALKINQIISDSNINYKIEGKSNIPEWTTMHTELDMAKSTKGFTMVFYIKKENRDALKLNFEQKFFQSITFTYSSIHKLFKTGKLEINYENFPQKLNLKFDGKNSISQPITAEYELNATSFSGKITSPFEWLRSCSIKGQLTISNDEVKGKFDINHNKLKQPINGEITIQRKFDLLKVELKTPFLYPLNQLSFRNERSDSILIIELNDAQNQLFYYKLKTYSKAKYDLDASITIPKLLSEFKLSSFSNFDFENPTKSIKFLVKSNQFSDTSLSATYNLNQNEYKIQFSHPKK 2871          
BLAST of Vitellogenin domain-containing protein vs. Planmine SMEST
Match: SMESG000037978.1 (SMESG000037978.1)

HSP 1 Score: 5510.65 bits (14294), Expect = 0.000e+0
Identity = 2721/2736 (99.45%), Postives = 2729/2736 (99.74%), Query Frame = 2
Query: 9287 MTFSTNTLGKYELISEYKLLSNAEIEISNQINTPTTNRKAYIQINLKNSDSDQSLIGLVEIVGQTYQLSLSRQNRHLQIKINSPFEHLKKFELSMKDKSNFYEIEGFYNHYQMKTIVSQNQEISSLIIQSNTDYFKIISLSIENSMADNLEKSLKIKIKMDEKYFKTDFKINCNKRSLEFNSENDLINYLPKSFSGKVQLSLAPIDIAMELKINDNTPVNFIFHRDQFLISFKRNXXXXXXXXXXXXXXNQLDAKFQLDNDEYSMRTIVDNSREKLTFSINALKNKVNKLIEFNSEIGKRNGNLEMEIEYLSNTVFKFKFTNENLPDRKLSIEMRLFSFNGVTDLIVQRKPSETNLKFSWNLLYNEQQLHIGSIIYGIKSSTPINYLAILNLQKVSYEIQLIQSENGEFQFKLSSPIKILDFEAKYQLEKKLNSYKMWLTWRNNLIGEYSIKSRIQFNQDPEIKFLFSSFRPIVQFKWAMKTSVANEISINTELGLLDWEKLSFDFQLSTKQLIKLIAVLKTPFKPIKNIQITKNIKFISFFDHKYETIIIYNGITNIKYIGSHEVKFSEKIFKFQGGFHNDNTKLIAVNISHTGNHKEMDHSVIWHVRNQKFGWKFNGGFRPLFEGKSEIYTPFHETGKIVLLGKHMGQGIMLEAGDRNQRIGSFEYMNEKDVQMMKITPPKNFGKPLTVKYSSKRLRRSVGNEMETDVTYGVEKLLEWASKFEMTSDEYNALINFKMPKFTEKAAELSLKHNYRDKTWNFDHQLTIKDQESKVYRLFGKLFMESLRNLKVSMNAEHPTFGSMHMSIGHSWTPNQYGHHFVMKSNDKTWITHSGNVKYNFDESSFSTEWKTGMNSKHYTVKASHSGIWKKFLQSLIMEYNDIPHLIFKSEVIPNEQSEVEINFPQLNSMXXXXXXXXXXXXXXXXCELKSDKYVLEVTGTLKHFEIQLNLNEKNIGSLLIKYDRLKLSVEGKYLKNFCTVEMAFQESTISLIVKSSNKKLEKLQLMISANKMSFGIDHYGTPYAIETEYDYAPNSLIIKINSSFKQLSKFALRFQPKQITLELNEFYQKVDYLFTQHHVKLISKNNFLPIQNLLFEVLIENPNNAMWKLTVDTFDTVSKLKFTNDKLSFENRNNYFRVRSLEMEANVKIEKEFTGYTGLLVMNKQQILKIQMANKQQLYFVKLETYLGEHLVASYNVPLKEMIISFKFKENFLNIIQKFQETVKGSSKTFIFNFTIESSHAYLYSFDNSATLIVSDSSYSLRTISEYNTKKVEFRGELSRTKLFCHLRLKYSEFALRLIRTNNDKINIELQAPYNKIMMTLEKEKNKYSTILQFNNKEILVIRTKQNSNIETSVEHESTVEFYGRQVWNYKFKTDYKRYEMKMTAPTTFDMIITNDWNKNEKTKLGFWVKYLLNGKSTECGAGLNFLLTSQSSSVEVNLENQYHIIRLMKTIEMTKNKQITTELINKNTKESWIVIFTTVKDKTIELEWKTPTSNRKIKYNEIVINNVKTSIDLDIVDSLKLTLKTDETDPKIWTGSLSLFKVRIAEIETGKDYVQATINKDGTENNRIFLKWTTSSEGEWKKDYIRTRQVTIVQKSLNINVDIVQKTVMKTSVYSTMTTMKYQLIDKSMKTLKIGASIDFSEKNKIVIDLPNPYMPIKTILIRSQPNQSQLTYQMETYLNEDSKVHGYFTIKTGSNPGVMTRLYYNPEDESEFFHLHSKYIDDRQMETIVYKNIDETKTTYFQVLFRLLNEHHIESTFAIKLDTISTTIKAIRQIKYIAQSKFSDLVINEIKWIALETNNRYNQLKDKIPNFTTMQNQMVLFLRTIKIEMNSFSKELSEIIAKNEFFIQTISEKVYKCLSVRSFLYKFASKVVYVVERALKTVFKILKSKIQDIFMLNCQLYYFSSGIVSWITGPITSLTKAFFKNYFPLAQKYFVNNLEKIKISLDQTLNMIFSTYVQIQKFIKLSILNHTFKIVEKTIEIAKSTLQIIMSGSLDFLKHENELKNLYKNLISCLEKFSKAILNKIDNLMNQVDSNLNNVIGSKFFYIITKSVSTVSSYVIDQMKDEENQKIITSFVYYSIASPLNDWMHKIQIFTMDSINPYSFVIYERKNKQLLNENEFSITVKMTSPIPFNDFKSLPDFGYVRRKIHKIQAAINLIKQTIKNQLANGCRYFELRSWFTLYFPQTPFTSILPEFETYATISKRSVMTFDKASFTLSPDSCRVLLSKDLKFKKWEIIMNQQNNKQMFTINIGSNTFELSASNYKVNLNGKPSDLPIQIGSTSLVGLGRMMKLKDDKLGLTITIDPVNEMFTVGISGWYHGKVRGLFGNSDNEQFNDFMLDNGKIVSNEVFMKEISYKSQSCKVVSDEEQTVVKPIKGCPFIRRMVCKFLFKCPFSPLAACFNKVNPKKFHKLCVHSTEEVLTKLDPSICKAARQYQAQCQKAGVNIQVPPPCKKCDMPNDKPLSINEFRNVKIKEKVSDIVFIVDEGTCLNSLYDKLPILVTRLDKGMKTKGINSVHYGLVTYVDDNNNQANFHTVGQKLLGSSQEMITSLKTLKSSNGKFKDFTGAITTAANYPFREHASRHLIIISCTSTKEYPNVLHNLVDKLTKKAIQVSLLTDFSFKLKDSNKQSIIFGVDSQNTYTALSRNGDKNFTSRPESDFLYQLTMKMKGVVFDNKYLSASQELTRIRFVSSFANQISLRATPAKSSRCVCVDDGDYNCTPLDTHTIFPVKRA 17494
            MTFSTNTLGKYELISEYKLLSNAEIEISNQINTPTTNRKAYIQINLKNSDSDQSLIGLVEIVGQTYQLSLSRQNRHLQIKINSPFEHLKKFELSMKDKSNFYEIEGFYNHYQMKTIVSQNQEISSLIIQSNTDYFK+ISLSIENSMADNLEKS+KIKIKMDEKYFKTDFKINCNKRSLEFNSENDLINYLPKSFSGKVQLSLAPIDIAMELKINDNTPVNFIFHRDQFLISFKRNSKSKISIEISKKIKNQLDAKFQLDNDEYSMRT+VDNSREKLTFSINALKNKVNKLIEFNSEIGKRNGNLEMEIEYLSNTVFKFKFTNENLPDRKLSIEMRLFSFNGVTDLIVQRKPSETNLKFSWNLLYNEQQLHIGSIIYGIKSSTPINYLAILNLQKVSYEIQLIQSENGEFQFK+SSPIKILDFEAKYQLEKKLNSYKMWLTWRNNLIGEYSIKSRIQFNQDPEIKFLFSSFRPIVQFKWAMKTSVANEISINTELGLLDWEKLSFDFQLSTKQLIKLIAVLKTPFKPIKNIQITKNIKFISFFDHKYETIIIYNGITNIKYIGSHEVKFSEKIFKFQGGFHNDNTKLIAVNISHTGNHKEMDHSVIWHVRNQKFGWKFNGGFRPLFEGKSEIYTPFHETGKIVLLGKHMGQGIMLEAGDRNQRIGSFEYMNEKDVQMMKITPPKN+GKPLTVKYSSKRLRRSVGNEMETDVTYGVEKLLEWASKFEMTSDEYNALINFKMPKFTEKAAELSLKHNYRDKTWNFDHQLTIKDQESKVYRLFGKLFMESLRNLKVSMNAEHPTFGSMHMSIGHSWTPNQYGHHFVMKSNDKTWITHSGNVKYNFDESSFSTEWKTGMNSKHYTVKASHSGIWKKFLQSLIMEYNDIPHLIFKSEVIPNEQSEVEINFPQLNSMKWKMIINNNKNKIDLICELKSDKYVLEVTGTLKHFEIQLNLNEKNIGSLLIKYDRLKLSVEGKYLKNFCTVEMAFQESTISLIVKSSNKKLEKLQLMISANKMSFGIDHYGTPYAIETEYDYAPNSLIIKINSSFKQLSKFALRFQPKQITLELNEFYQKVDYLFTQHHVKLISKNNFLPIQNLLFEVLIENPNNAMWKLTVDTFDTVSK+KFTNDKLSFENRNNYFRVRSLEMEANVKIEKEFTGYTGLLVMNKQQILKIQMANKQQLYFVKLETYLGEHLVASY VPLKEMIISFKFKENFLNIIQKFQETVKGSSKTFIFNFTIESSHAYLYSFDNSATL VSDSSYSLRTISEYNTKKVEFRGELSRTKLFCHLRLKYSEFALRLIRTNNDKINIELQAPYNKIMMTLEKEKNKYSTILQFNNKEILVIRTKQNSNIETSVEHESTVEFYGRQVWNYKFKTDYKRYEMKMTAPTTFDMIITNDWNKNEKTKLGFWVKYLLNGKSTECGAGLNFLLTSQSSS EVNLENQYHIIRLMKTIEMTKNKQITTELINKNTKESWIVIFTTVKDKTIELEWKTPTSNRKIKYNEIVINNVKTSIDLDIVDSLKLTLKTDETDPKIWTGSLSLFKVRIAEIETGKDYVQATINKDGTENNRIFLKWTTSSEGEWKKDYIRTRQVTIVQKSLNINVDIVQKTVMKTSVYSTMTTMKYQLIDKSMKTLKIGASIDFSEKNKIVIDLPNPYMPIKTILIRSQPNQSQLTYQMETYLNEDSKVHGYFTIKTGSNPGVMTRLYYNPEDESEFFHLHSKYIDDRQMETIVYKNIDETKTTYFQVLFRLLNEHHIESTFAIKLDTIST IKAIRQIKYIAQSKFSDLVINEIKWIALETNNRYNQLKDKIPNFTTMQNQMVLFLRTIKIEMNSFSKELSEIIAKNEFFIQTISEKVYKCLSVR FLYKFASKVVYVVERALKTVFKILKSKIQDIFM NCQLYYFSSGIVSWITGPITSLTKAFFKNYFPLAQKYFVNNLEKIKISLDQTLNMIFSTYVQIQKFIKLSILNHTFKIVEKTIEIAKSTLQIIMSGSLDFLKHENELKNLYKNLISCLEKFSKAILNKIDNLMNQVDSNLNNVIG+KFFYIITKSVSTVSSYVIDQMKDEENQKIITSFVYYSIASPLNDWMHKIQIFTMDSINPYSFVIYERKNKQLLNENEFSITV+MTSPIPFNDFKSLPDFGYVRRKIHKIQAAINLIKQTIKNQLANGCRYFELRSWFTLYFPQTPFTSILPEFETYATISKRSVMTFDKASFTLSPDSCRVLLSKDLKFKKWEIIMNQQNNKQMFTINIGSNTFELSASNYKVNLNGKPSDLPIQIGSTSLVGLGRMMKLKDDKLGLTITIDPVNEMFTVGISGWYHGKVRGLFGNSDNE FNDFMLDNGKIVSNEVFMKEISYKSQSCKVVSDEEQTVVKPIKGCPFIRRMVCKFLFKCPFSPLAACFNKVNPKKFHKLCVHSTEEVLTKLDPSICKAARQYQAQCQKAGVNIQVPPPCKKCDMPNDKPLSINEFRNVKIKEKVSDIVFIVDEGTCLNSLYDKLPILVTRLDKGMKTKGINSVHYGLVTYVDDNNNQANFHTVGQKLLGSSQEMITSLKTLKSSNGKFKDFTGAITTAANYPFREHASRHLIIISCTSTKEYPNVLHNLVDKLTKKAIQVSLLTDFSFKLKDSNKQSIIFGVDSQNTYTALSRNGDKNFTSRPESDFLYQLTMKMKGVVFDNKYLSASQELTRIRFVSSFANQISLRATPAKSSRCVCVDDGDYNCTPLDTHTIFPVKRA
Sbjct:    1 MTFSTNTLGKYELISEYKLLSNAEIEISNQINTPTTNRKAYIQINLKNSDSDQSLIGLVEIVGQTYQLSLSRQNRHLQIKINSPFEHLKKFELSMKDKSNFYEIEGFYNHYQMKTIVSQNQEISSLIIQSNTDYFKVISLSIENSMADNLEKSIKIKIKMDEKYFKTDFKINCNKRSLEFNSENDLINYLPKSFSGKVQLSLAPIDIAMELKINDNTPVNFIFHRDQFLISFKRNSKSKISIEISKKIKNQLDAKFQLDNDEYSMRTVVDNSREKLTFSINALKNKVNKLIEFNSEIGKRNGNLEMEIEYLSNTVFKFKFTNENLPDRKLSIEMRLFSFNGVTDLIVQRKPSETNLKFSWNLLYNEQQLHIGSIIYGIKSSTPINYLAILNLQKVSYEIQLIQSENGEFQFKISSPIKILDFEAKYQLEKKLNSYKMWLTWRNNLIGEYSIKSRIQFNQDPEIKFLFSSFRPIVQFKWAMKTSVANEISINTELGLLDWEKLSFDFQLSTKQLIKLIAVLKTPFKPIKNIQITKNIKFISFFDHKYETIIIYNGITNIKYIGSHEVKFSEKIFKFQGGFHNDNTKLIAVNISHTGNHKEMDHSVIWHVRNQKFGWKFNGGFRPLFEGKSEIYTPFHETGKIVLLGKHMGQGIMLEAGDRNQRIGSFEYMNEKDVQMMKITPPKNYGKPLTVKYSSKRLRRSVGNEMETDVTYGVEKLLEWASKFEMTSDEYNALINFKMPKFTEKAAELSLKHNYRDKTWNFDHQLTIKDQESKVYRLFGKLFMESLRNLKVSMNAEHPTFGSMHMSIGHSWTPNQYGHHFVMKSNDKTWITHSGNVKYNFDESSFSTEWKTGMNSKHYTVKASHSGIWKKFLQSLIMEYNDIPHLIFKSEVIPNEQSEVEINFPQLNSMKWKMIINNNKNKIDLICELKSDKYVLEVTGTLKHFEIQLNLNEKNIGSLLIKYDRLKLSVEGKYLKNFCTVEMAFQESTISLIVKSSNKKLEKLQLMISANKMSFGIDHYGTPYAIETEYDYAPNSLIIKINSSFKQLSKFALRFQPKQITLELNEFYQKVDYLFTQHHVKLISKNNFLPIQNLLFEVLIENPNNAMWKLTVDTFDTVSKIKFTNDKLSFENRNNYFRVRSLEMEANVKIEKEFTGYTGLLVMNKQQILKIQMANKQQLYFVKLETYLGEHLVASYKVPLKEMIISFKFKENFLNIIQKFQETVKGSSKTFIFNFTIESSHAYLYSFDNSATLTVSDSSYSLRTISEYNTKKVEFRGELSRTKLFCHLRLKYSEFALRLIRTNNDKINIELQAPYNKIMMTLEKEKNKYSTILQFNNKEILVIRTKQNSNIETSVEHESTVEFYGRQVWNYKFKTDYKRYEMKMTAPTTFDMIITNDWNKNEKTKLGFWVKYLLNGKSTECGAGLNFLLTSQSSSAEVNLENQYHIIRLMKTIEMTKNKQITTELINKNTKESWIVIFTTVKDKTIELEWKTPTSNRKIKYNEIVINNVKTSIDLDIVDSLKLTLKTDETDPKIWTGSLSLFKVRIAEIETGKDYVQATINKDGTENNRIFLKWTTSSEGEWKKDYIRTRQVTIVQKSLNINVDIVQKTVMKTSVYSTMTTMKYQLIDKSMKTLKIGASIDFSEKNKIVIDLPNPYMPIKTILIRSQPNQSQLTYQMETYLNEDSKVHGYFTIKTGSNPGVMTRLYYNPEDESEFFHLHSKYIDDRQMETIVYKNIDETKTTYFQVLFRLLNEHHIESTFAIKLDTISTAIKAIRQIKYIAQSKFSDLVINEIKWIALETNNRYNQLKDKIPNFTTMQNQMVLFLRTIKIEMNSFSKELSEIIAKNEFFIQTISEKVYKCLSVRFFLYKFASKVVYVVERALKTVFKILKSKIQDIFMFNCQLYYFSSGIVSWITGPITSLTKAFFKNYFPLAQKYFVNNLEKIKISLDQTLNMIFSTYVQIQKFIKLSILNHTFKIVEKTIEIAKSTLQIIMSGSLDFLKHENELKNLYKNLISCLEKFSKAILNKIDNLMNQVDSNLNNVIGAKFFYIITKSVSTVSSYVIDQMKDEENQKIITSFVYYSIASPLNDWMHKIQIFTMDSINPYSFVIYERKNKQLLNENEFSITVRMTSPIPFNDFKSLPDFGYVRRKIHKIQAAINLIKQTIKNQLANGCRYFELRSWFTLYFPQTPFTSILPEFETYATISKRSVMTFDKASFTLSPDSCRVLLSKDLKFKKWEIIMNQQNNKQMFTINIGSNTFELSASNYKVNLNGKPSDLPIQIGSTSLVGLGRMMKLKDDKLGLTITIDPVNEMFTVGISGWYHGKVRGLFGNSDNEPFNDFMLDNGKIVSNEVFMKEISYKSQSCKVVSDEEQTVVKPIKGCPFIRRMVCKFLFKCPFSPLAACFNKVNPKKFHKLCVHSTEEVLTKLDPSICKAARQYQAQCQKAGVNIQVPPPCKKCDMPNDKPLSINEFRNVKIKEKVSDIVFIVDEGTCLNSLYDKLPILVTRLDKGMKTKGINSVHYGLVTYVDDNNNQANFHTVGQKLLGSSQEMITSLKTLKSSNGKFKDFTGAITTAANYPFREHASRHLIIISCTSTKEYPNVLHNLVDKLTKKAIQVSLLTDFSFKLKDSNKQSIIFGVDSQNTYTALSRNGDKNFTSRPESDFLYQLTMKMKGVVFDNKYLSASQELTRIRFVSSFANQISLRATPAKSSRCVCVDDGDYNCTPLDTHTIFPVKRA 2736          
BLAST of Vitellogenin domain-containing protein vs. Planmine SMEST
Match: SMESG000037977.1 (SMESG000037977.1)

HSP 1 Score: 3851.21 bits (9986), Expect = 0.000e+0
Identity = 1901/1905 (99.79%), Postives = 1903/1905 (99.90%), Query Frame = 2
Query:   53 MNLFGTAFLLVLLSIITNAARTPQFINPCSMKCSFEEDRIFKPGQKYVYSYEGESNIKTTKGSYETTGVKIKSKVTITGLSNCEMKLSLSDVQIFDKTSSDGNQFKESPNSYKFKSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTSHGKCFITSSEKSPKEETNPNSVNFQYDLQTCDNKMISNSLFGDITRSVIFKTSQVSCKYLYKDQSNLVSIRCREEYKTATIKTNENQMVVEITTNIYKENQLPSPDRTFTNKNMFETGXXXXXXXXXXXXSPYSAAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQDRSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTNNYGVNFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYLKKEKGAQENLELINILNEMSGSVNIKLFGNQVSFIELIRGTLSSVKKYNIIEEIMYWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLVSWPISVNIDNYISPNINAELHTEIVYQTPFTNYGMRMKLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFSVEGNAYVIHRDKEIIQLQDKLKEIKMCTSEMTVRILGIRVCGEAKVLDPSTRKDALLFGPFAANVFIEKIDTQTEYILLATSKTSAFISQTGKVYSNRHIKFEFNTPNSKFYNRRFYGEILMDFKQKEFKLELVTPWTDALVAARLKLTDGETKIAFNFKANKQNIIDISAEHLIFSSPKRTNTKGGISIQILNLTPIRKRWNLELTDDAYSFTFVSKGLLKEETHLKIKVLRKNPMKNLSAFNTYEISGFFNTYFGYGKISGRTSENYFGHRWDIKISHKNKQRKEYQIIFRHKVEDKSSKNLNKYILTTTFNYGEKAENFVTFKTENELSDKHIRTSMKASYGGKETPNNKAYEEEMSMKLYGGYTWKSDDIYYAEGSLSFKLPSKNLNYEGRYISEIGKRVFKLSLDFDKDQQSKINLKINYLQPKLYLKDTDFSVLFSLPYHNFDLKWKLMEIDVNKYTYTLDGKYNTYDMKIDGVHTQISRLDHDSYVSIKMPRIQGLPTDVKGKLRVNLVDMAKAKIKGGIEIPNTDYKYSFDSEFSYIPNNLLEISKSEISSVLTYNIEVSSKQRLMKSKFIFTCNPEEFRTLFNVDLNGNSNSDNKIEFDIQALQKNPVYKQFESVARLALQYPGNRHSIGFKSDFKYSEMVAQIDLIWNKNQRISITSTYQLDNSWTQKGLAASLTVKTPFIGYEQIHFGMTAVGQLRYRKVNFECKWADNKKLIFDIVIQPKSSSDFSLNAKLTSPFKGFNLVTFQAKHLQTSNSINTQCVVEIGPVKRYQIKFETINNSEDKNRDFLSNILIESGIYPAFKMSLLHKDDSVHYKSQFDVLWMKTQSINVKSDISFNLEDYEFTTKGNVELFSTIKEAKQMKMVWSLENRDSQFLHNVQMFHNNKNLFQTTIKGFYETEDNKIKIEFNGVASVMNGRSMKIANILIYSPLSIQNQFSVSQETNIIYSHNFNMNXXXXXXXXXIPNIQTKKVEFEYKIDRKQEEAESQIFVKINEKHLFHIEMEEKYQRV 5767
            MNLFGTAFLLVLLSIITNAARTPQFINPCSMKCSFEEDRIFKPGQKYVYSYEGESNIKTTKGSYETTGVKIKSKVTITGLSNCEMKLSLSDVQIFDKTSSDGNQFKESPNSYKFKSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTSHGKCFITSSEKSPKEETNPNSVNFQYDLQTCDNKMISNSLFGDITRSVIFKTSQVSCKYLYKDQSNLVSIRCREEYKTATIKTNENQMVVEITTNIYKENQLPSPDRTFTNKNMFETGIEQAEDEIEAEESPYSAAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQDRSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTNNYGVNFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYLKKEKGAQENLELINILNEMSGSVNIKLFGNQVSFIELIRGTLSSVKKYNIIEEIMYWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLVSWPIS+NIDNYISPNINAELHTEIVYQTPFTNYGMRMKLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFSVEGNAYVIHRDKEIIQLQDKLKEIKMCTSEMTVRILGIRVCGEAKVLDPSTRKDALLFGPFAANVFIEKIDTQTEYILLATSKTSAFISQTGKVYSNRHIKFEFNTPNSKFYNRRFYGEILMDFKQKEFKLELVTPWTDALVAARLKLTD ETKIAFNFKANKQNIIDISAEHLIFSSPKRTNTKGGISIQILNLTPIRKRWNLELTDDAYSFTFVSKGLLKEETHLKIKVLRKNPMKNLSAFNTYEISGFFNTYFGYGKISGRTSENYFGHRWDIKISHKNKQRKEYQIIFRHKVEDKSSKNLNKYILTTTFNYGEKAENFVTFKTENELSDKHIRTSMKASYGGKETPNNKAYEEEMSMKLYGGYTWKSDDIYYAEGSLSFKLPSKNLNYEGRYISEIGKRVFKLSLDFDKDQQSKINLKINYLQPKLYLKDTDFSVLFSLPYHNFDLKWKLMEIDVNKYTYTLDGKYNTYDMKIDGVHTQISRLDHDSYVSIKMPRIQGLPTDVKGKLRVNLVDMAKAKIKGGIEIPNTDYKYSFDSEFSYIPNNLLEISKSEISSVLTYNIEVSSKQRLMKSKFIFTCNPEEFRTLFNVDLNGNSNSDNKIEFDIQALQKNPVYKQFESVARLALQYPGNRHSIGFKSDFKYSEMVAQIDLIWNKNQRISITSTYQLDNSWTQKGLAASLTVKTPFIGYEQIHFGMTAVGQLRYRKVNFECKWADNKKLIFDIVIQPKSSSDFSLNAKLTSPFKGFNLVTFQAKHLQTSNSINTQCVVEIGPVKRYQIKFE INNSEDKNRDFLSNILIESGIYPAFKMSLLHKDDSVHYKSQFDVLWMKTQSINVKSDISFNLEDYEFTTKGNVELFSTIKEAKQMKMVWSLENRDSQFLHNVQMFHNNKNLFQTTIKGFYETEDNKIKIEFNGVASVMNGRSMKIANILIYSPLSIQNQFSVSQETNIIYSHNFN+NSKSLKLKLLIPNIQTKKVEFEYKIDRKQEEAESQIFVKINEKHLFHIEMEEKYQRV
Sbjct:    1 MNLFGTAFLLVLLSIITNAARTPQFINPCSMKCSFEEDRIFKPGQKYVYSYEGESNIKTTKGSYETTGVKIKSKVTITGLSNCEMKLSLSDVQIFDKTSSDGNQFKESPNSYKFKSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKKAILDSLANQGIQTKPDSYKKTSHGKCFITSSEKSPKEETNPNSVNFQYDLQTCDNKMISNSLFGDITRSVIFKTSQVSCKYLYKDQSNLVSIRCREEYKTATIKTNENQMVVEITTNIYKENQLPSPDRTFTNKNMFETGIEQAEDEIEAEESPYSAAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQDRSSALSILLNNENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTNNYGVNFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYLKKEKGAQENLELINILNEMSGSVNIKLFGNQVSFIELIRGTLSSVKKYNIIEEIMYWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLVSWPISMNIDNYISPNINAELHTEIVYQTPFTNYGMRMKLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFSVEGNAYVIHRDKEIIQLQDKLKEIKMCTSEMTVRILGIRVCGEAKVLDPSTRKDALLFGPFAANVFIEKIDTQTEYILLATSKTSAFISQTGKVYSNRHIKFEFNTPNSKFYNRRFYGEILMDFKQKEFKLELVTPWTDALVAARLKLTDSETKIAFNFKANKQNIIDISAEHLIFSSPKRTNTKGGISIQILNLTPIRKRWNLELTDDAYSFTFVSKGLLKEETHLKIKVLRKNPMKNLSAFNTYEISGFFNTYFGYGKISGRTSENYFGHRWDIKISHKNKQRKEYQIIFRHKVEDKSSKNLNKYILTTTFNYGEKAENFVTFKTENELSDKHIRTSMKASYGGKETPNNKAYEEEMSMKLYGGYTWKSDDIYYAEGSLSFKLPSKNLNYEGRYISEIGKRVFKLSLDFDKDQQSKINLKINYLQPKLYLKDTDFSVLFSLPYHNFDLKWKLMEIDVNKYTYTLDGKYNTYDMKIDGVHTQISRLDHDSYVSIKMPRIQGLPTDVKGKLRVNLVDMAKAKIKGGIEIPNTDYKYSFDSEFSYIPNNLLEISKSEISSVLTYNIEVSSKQRLMKSKFIFTCNPEEFRTLFNVDLNGNSNSDNKIEFDIQALQKNPVYKQFESVARLALQYPGNRHSIGFKSDFKYSEMVAQIDLIWNKNQRISITSTYQLDNSWTQKGLAASLTVKTPFIGYEQIHFGMTAVGQLRYRKVNFECKWADNKKLIFDIVIQPKSSSDFSLNAKLTSPFKGFNLVTFQAKHLQTSNSINTQCVVEIGPVKRYQIKFEAINNSEDKNRDFLSNILIESGIYPAFKMSLLHKDDSVHYKSQFDVLWMKTQSINVKSDISFNLEDYEFTTKGNVELFSTIKEAKQMKMVWSLENRDSQFLHNVQMFHNNKNLFQTTIKGFYETEDNKIKIEFNGVASVMNGRSMKIANILIYSPLSIQNQFSVSQETNIIYSHNFNINSKSLKLKLLIPNIQTKKVEFEYKIDRKQEEAESQIFVKINEKHLFHIEMEEKYQRV 1905          
BLAST of Vitellogenin domain-containing protein vs. Planmine SMEST
Match: SMESG000073666.1 (SMESG000073666.1)

HSP 1 Score: 138.272 bits (347), Expect = 1.700e-31
Identity = 148/644 (22.98%), Postives = 294/644 (45.65%), Query Frame = 2
Query:  989 KDICVQYK-SSESSKIPKLFMELVNHLKRLNSKEFKELYLELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQNIWLTSLSFMQEV-PSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEEPESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLKYYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQDRSSALSILLNNEND-SELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIKESNDQLKENIRDLLDDV-----DLKKEFDISKLKFSRNIEKTFLTNNYGVNFDSNVIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEGYLKKEKGAQENLELINILNEMSG-----SVNIKLFGNQVSFIELIRGTLSSVKKYNIIEEIMYWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINIKIKSKFDVAGLVSWPISVNIDNYISPNINAELH-----TEIVYQTPFT-----NYGMRMKLKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFSVEGNAYVIHRDKEIIQLQDKLKE-IKMCTSEMTVRILGIRVCGEAKV 2848
            K +C+  K ++ +S+  +LF++ +  L  ++ K  KE+      +  C    +++K++  DA        +      LI+ S +    QN     +SF +   P+I  +K     I          L+L S+   +C + P  C  +P I   ++  + ++   C    +  ++ V     +L   GN   Y   +I  L  C++   ++  ++I A+E ++   C  D  + L  + ++ +  SE+RI AYL+++ C    T  K+ + L++E   Q+GSF+W+H++N+ E++D+ K  +RDLL        DL ++F++    +S+NIEKTF      V  D+N++FS         + N +  IF +S N LE   R +G+ + LF  F P    K  K A  ++  +   +E  G      V  ++ G ++ +   +   L+     +I+   M +  DKS        L+D  V + T+ GFP++  ++ + ++++   +   +       I++++ N ++  +  +L      T++  Q+  T      +G ++K  SG   +   T  T+   E++   D  K    + ++     +IH  K I + + K    +  CTS+  + + G ++C    V
Sbjct:  323 KQLCMTLKKNNAASEKAQLFVKFIRALSDIDYKTIKEVEKYFNDNSECSPNKSKLKNLLIDALPHTKNEEAFKF---LIEDSNL----QNFQDLGISFFENTTPTI--IKLFSNKIGDPKFDNSALLTLSSMIKSFCDKTP-GCVLNPDIIYAMNKLVKHIENSCYFDNNKDNEKVLYTLRALGNSGNFHNYKL-LIKILESCVSSKVSQNDVKIFAVEALRQFPCHADIDNFLWKVYDDISYLSEVRIQAYLSLIRCPFRETFRKIIQKLNQEDNQQLGSFVWSHISNLMETSDRFKTELRDLLQIFTKPMNDLTRKFNLDFRSYSKNIEKTFQRGYSAVKLDTNILFSNSPIPSSIST-NVSVDIFGRSVNILEFGIRGKGISEKLFGRFYP----KPHKNAHPDIVKMQKKSENKGEKLSLGVYSRIMGREIFYSPNVLSALT----MSILNPNMKFYVDKS------FLLLDVIVSVSTITGFPIELTIESALSVDLSSNNMIKLGD-----INLSLQNNVALQVIGKLQINAHCTKVGIQSYGTVSSDAEFGGKLKTISGLKKD-DGTSLTDYQFEINKIPDDKK----LLAISNELSLIHNLK-IEEAKPKYSALLNKCTSDAFLELRGFKLCALVSV 929          

HSP 2 Score: 86.6557 bits (213), Expect = 7.475e-16
Identity = 163/707 (23.06%), Postives = 304/707 (43.00%), Query Frame = 2
Query: 15233 EIAKSTLQIIMSGSLDFLKHENELKNLYKN-----LISCLEKFSKAILNKIDNLMNQVDSNLNNVIGSKFFYIITKSVSTVSSYVIDQMKD-EENQKIITSF-----VYYSIASPLNDWMHKIQ-IFTMDSINPYSFVIYERKNKQLLNENEFSITVKM-TSPIPFNDFKSLPDFGYVRRKIHKIQAAINLIKQTIKNQLANGCRYFELRSWFTLYFPQTPFTSI---LPEF-ETYATISKRSVMTFDKASFTLSPDSCRVLLSKDLKFKKWEIIMN--QQNNKQMFTINIGSNTFELSASNYKVNLNGK-----PSDLPIQIGSTSLVGLGRMMKLKDDKLGLTITIDPVNEMFTVGIS--GWYHGKVRGLFGNSDNEQFNDFMLDNGKIVSNEVFMKEISYKSQSCKVVSDEEQTVVKPIKGCPFIRRMVCKFLFKC-PFSPLAACFNKVNPKKFHKLCVHSTEEVLTK----LDPSICKAARQYQAQCQKAGVNIQVPPPCKKCDMPN-DKPLSINEFRNVKIKEKVSDIVFIVDEGTCLNSLYDKLPILVTRLDK--GMKTKGINSVHYGLVTY-VDDNNNQANFHTVGQKLLGSSQEMITSLK--------TLKSSNGKFKDFTGAITTAANYPFREHASRHLIIISCTSTKEYPNVLHNLVDKLTKKA-IQVSLLTDFSFKLKDSNKQSIIFGVDSQNTYT 17221
            E AK TL   +S SL     +N LKN+Y N     L S +      +LN ++ +M Q D             II + +     Y  D +KD EE   +I SF      Y+  ++ + + +  I+ I ++     +  ++   + K  +N +E SI  KM   P+    FK L  F          Q    + K  I ++L      F    +    +    F S+   LP F +T   +   S++TFD  +  +    C  LL++D K   + ++MN   +NNK  + ++  +    +  ++ +V+++GK     P+    +  + ++     ++K+K  +    I I   NE  ++ I   G++HG ++GL G++D E+ ND     G I  +   +     KS S      + +T +  IK     +   C+  F     S L  CF+ +NP+ +  LC H T +   K        +C  +R Y  +C+  G+ I++   C  C   N +K +S +E +    K      +FI+++  C+ S      +L+  L K  G+K++ I    + L+++   D   + +F T+  K+  +  E++  L+        T K +  K  +   AI            +  +++++C++  E+    ++L+  L   A I +S LT  +F    +   S + G+ ++  YT
Sbjct: 3072 EKAKKTL--FLSNSL-----KNALKNVYSNSLIMDLFSIMADLKTEVLNILEKIM-QTD-------------IIKQRIK----YYQDAIKDSEETINLILSFKNKVLEYFKTSNAVTNILKTIEFIRSLKYKEAFLNLVKLEETKLQMNLDEASIEFKMYVPPVSMTYFKILKTF----TNWLPSQTFYKVAKLRISDKL---LELFYRYEYIMFNYGSYNFESLRKLLPPFSKTAWVLDGNSILTFDGNAIKIGSGQCSYLLARDFKKGSFSLVMNVDSKNNKIEYELSYINKI--VIRNDGRVSVDGKIVNILPAVFKDEKRNFAIYRNDDLVKIKTSE---GIVIKYFNEFKSLKIMAIGFWHGSIKGLLGSNDFEKSNDLSTPTGLITHDAGVLS----KSWSLGKCDAKTKTGLYSIK-ISTSQLQECENTFHPDSLSYLKRCFSLINPEPYFALC-HRTLQYGPKSKSEFKELLCSLSRNYVMRCKSKGILIRLDKTCVNCGKINLNKKISDHELQ----KNSKFHYIFIIEQSKCIES----YRVLIENLAKMMGLKSENI----FTLLSFNGKDVYKEVHFKTINNKMYVNYDEIMKLLQEAFSPEQLTSKMTEKKITEPGQAIYDVIKMSSVPGFTEKIVLLTCSACSEHQKYGYSLLAGLLNNAGISISYLTTETF----TGGNSDVVGIANKMVYT 3719          
The following BLAST results are available for this feature:
BLAST of Vitellogenin domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
AC099489.16.239e-6923.46novel lipoprotein amino terminal region containing... [more]
AC099489.12.106e-1124.72novel lipoprotein amino terminal region containing... [more]
MUC29.335e-628.92mucin 2, oligomeric mucus/gel-forming [Source:HGNC... [more]
back to top
BLAST of Vitellogenin domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Vitellogenin domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Apoltp1.805e-4627.39gene:FBgn0032136 transcript:FBtr0303874[more]
apolpp1.652e-4324.05gene:FBgn0087002 transcript:FBtr0345297[more]
apolpp1.652e-4324.05gene:FBgn0087002 transcript:FBtr0334627[more]
apolpp1.652e-4324.05gene:FBgn0087002 transcript:FBtr0345296[more]
apolpp1.652e-4324.05gene:FBgn0087002 transcript:FBtr0089188[more]
back to top
BLAST of Vitellogenin domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkeyp-106c3.31.498e-3122.28si:dkeyp-106c3.3 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
apoba6.752e-1922.26apolipoprotein Ba [Source:ZFIN;Acc:ZDB-GENE-070702... [more]
apobb.15.278e-1821.11apolipoprotein Bb, tandem duplicate 1 [Source:ZFIN... [more]
apobb.11.816e-1320.54apolipoprotein Bb, tandem duplicate 1 [Source:ZFIN... [more]
vtg38.830e-1121.43vitellogenin 3, phosvitinless [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Vitellogenin domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fosb1.536e-3436.28FBJ murine osteosarcoma viral oncogene homolog B [... [more]
fosb1.751e-3436.28FBJ murine osteosarcoma viral oncogene homolog B [... [more]
ddx61.324e-2020.43DEAD-box helicase 6 [Source:Xenbase;Acc:XB-GENE-92... [more]
ddx62.618e-2020.43DEAD-box helicase 6 [Source:Xenbase;Acc:XB-GENE-92... [more]
ddx62.945e-2021.22DEAD-box helicase 6 [Source:Xenbase;Acc:XB-GENE-92... [more]
back to top
BLAST of Vitellogenin domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Apob1.979e-1922.25apolipoprotein B [Source:MGI Symbol;Acc:MGI:88052][more]
Apob3.992e-1922.57apolipoprotein B [Source:MGI Symbol;Acc:MGI:88052][more]
back to top
BLAST of Vitellogenin domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9U943|APLP_LOCMI5.951e-5423.46Apolipophorins OS=Locusta migratoria OX=7004 PE=1 ... [more]
sp|Q6RG02|VIT_PENME1.579e-4323.45Vitellogenin OS=Penaeus merguiensis OX=71412 PE=1 ... [more]
sp|Q9V496|APLP_DROME1.656e-4224.05Apolipophorins OS=Drosophila melanogaster OX=7227 ... [more]
sp|Q25490|APLP_MANSE4.067e-3822.83Apolipophorins OS=Manduca sexta OX=7130 PE=2 SV=1[more]
sp|Q7TMA5|APOB_RAT1.113e-2022.52Apolipoprotein B-100 OS=Rattus norvegicus OX=10116... [more]
back to top
BLAST of Vitellogenin domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DH011.552e-15132.20Vitellogenin domain-containing protein OS=Macrosto... [more]
A0A1I8HY324.697e-14732.39Vitellogenin domain-containing protein OS=Macrosto... [more]
A0A267G3Y03.074e-14532.39Vitellogenin domain-containing protein OS=Macrosto... [more]
A0A267GYF72.030e-12828.49Vitellogenin domain-containing protein (Fragment) ... [more]
X2ATR88.062e-11828.03Uncharacterized protein OS=Capitella teleta OX=283... [more]
back to top
BLAST of Vitellogenin domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
apoba4.411e-1923.04apolipoprotein B [Source:NCBI gene;Acc:103044560][more]
apoba4.961e-1922.57apolipoprotein B [Source:NCBI gene;Acc:103044560][more]
apoba4.962e-1923.04apolipoprotein B [Source:NCBI gene;Acc:103044560][more]
apoba5.762e-1923.04apolipoprotein B [Source:NCBI gene;Acc:103044560][more]
apobb.21.115e-1220.44apolipoprotein B-100-like [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Vitellogenin domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Vitellogenin domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Vitellogenin domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO481277.468e-2331.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Vitellogenin domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000015835.21.498e-1722.05pep primary_assembly:ASM223467v1:24:6559546:656728... [more]
apobb.24.312e-1721.14apolipoprotein B-100-like [Source:NCBI gene;Acc:10... [more]
apoba1.270e-1122.54apolipoprotein B-100 [Source:NCBI gene;Acc:1011564... [more]
FCGBP6.353e-826.29Fc fragment of IgG binding protein [Source:NCBI ge... [more]
ENSORLT00000029569.13.090e-720.83vitellogenin-1-like [Source:NCBI gene;Acc:10115918... [more]
back to top
BLAST of Vitellogenin domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000037977.10.000e+098.89SMESG000037977.1[more]
SMESG000037978.10.000e+099.45SMESG000037978.1[more]
SMESG000037977.10.000e+099.79SMESG000037977.1[more]
SMESG000073666.11.700e-3122.98SMESG000073666.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020296 ID=SMED30020296|Name=Vitellogenin domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=17504bp
CGAAAAAATATTACACGATATTAAATTTTAGAATATTTTTAACCAATAGA
AAATGAACCTTTTTGGCACAGCCTTTCTGTTGGTGCTGTTGTCGATCATC
ACCAATGCAGCAAGAACGCCTCAATTTATCAATCCTTGTTCAATGAAATG
CTCATTTGAGGAAGATAGAATTTTCAAACCCGGACAAAAGTATGTATACT
CATATGAAGGAGAATCAAACATCAAAACGACAAAAGGATCATACGAAACG
ACAGGCGTCAAGATAAAGTCCAAAGTTACAATTACCGGCTTGTCAAATTG
TGAAATGAAGCTTTCATTATCCGACGTACAAATCTTTGATAAAACGTCAA
GCGACGGAAACCAATTCAAAGAATCGCCGAACAGCTACAAATTCAAATCG
GCTTTGGAAATGAATGATATCTTTTTCACCAAAGAATCCAATGAAGTCAA
ATCCGTGTGCATGGATGGTGAAGAACCTGTTTGGTCGGGAAATATCAAAA
AAGCCATTTTAGACAGTCTAGCAAATCAAGGAATCCAAACAAAACCTGAC
TCTTACAAGAAAACAAGTCATGGAAAATGTTTCATCACATCTTCTGAAAA
GTCACCAAAAGAAGAAACAAACCCAAACTCTGTTAACTTCCAATACGATT
TACAAACCTGTGACAATAAAATGATCTCGAATTCTTTATTCGGCGATATC
ACTCGATCAGTAATATTCAAAACTTCTCAAGTCTCCTGCAAATATCTTTA
CAAAGACCAATCAAACTTGGTTTCAATCCGATGTCGAGAAGAATACAAAA
CTGCCACGATTAAAACAAATGAAAACCAAATGGTCGTAGAAATAACAACA
AATATTTATAAAGAAAATCAACTACCGAGTCCAGACCGAACATTTACGAA
TAAAAATATGTTTGAAACTGGCATTGAACAAGCGGAAGATGAAATAGAAG
CTGAAGAGTCGCCGTATTCAGCTGCTAAGACAACTCTAAAAGACATTTGC
GTCCAGTATAAATCATCTGAATCGTCAAAGATTCCAAAACTATTCATGGA
ATTGGTAAATCATCTAAAACGCTTAAATTCAAAGGAATTTAAAGAACTGT
ATCTGGAACTTCAAAAATCTGATATCTGTCCCGAAAAAACAACGGAAATA
AAATCAATTTTCTACGATGCTTCAGGATTCGTAAACACCCGATCTTCGAT
ATCAGTAATGGTCGATTTAATAAAAACTTCGCGAATTTCATTATTTGACC
AAAACATTTGGCTAACATCATTGTCTTTCATGCAAGAAGTTCCATCAATT
GAAACACTCAAAGAACTCGAAACAATTATTTCGGTCGCAAATCCTAGCAC
ACCATTGTTTCTCAGTCTGGGTTCACTTACCCATCTTTATTGCAAAGAGG
AACCGGAATCATGCCAGAATGATCCAATTATTGCCAGTATAGTTTCGGCA
TTTCTTCACAATCTCAATGGAGATTGCTCGATTCCTAAGGATGCAACCGA
TGATTACGTCACAAAAATACAAATATCCCTCAAAGGTCTTGGTAATCTAA
AATACTATCCTGCAACTGTCATTAACACTCTCAACAAATGCATAACCAAG
GACACTAATAAACTATCAATCAGAATCAGTGCATTAGAGGTCATGAAACA
TATGGACTGCAAACAAGACCGATCAAGTGCTTTGAGTATCTTGCTCAATA
ACGAAAATGACTCGGAACTGAGAATCAACGCTTATTTAACTGTAATGGGC
TGCTCCGATATCAATACTCTTTTCAAGGTCCGAGAGATTTTATCCAAAGA
GAAAGTCAATCAAGTCGGTTCATTCATTTGGACCCATCTAACAAACATCA
AAGAATCAAATGACCAATTAAAAGAAAACATAAGAGATTTGTTAGACGAT
GTAGACTTAAAGAAAGAATTTGACATAAGTAAATTGAAATTCTCCAGAAA
CATTGAAAAGACCTTCCTGACAAACAACTATGGAGTAAATTTCGATTCCA
ATGTTATTTTTTCAGAAAAGTCTTTTGTACCGCGATCAGTGTCATTGAAC
ACAACTGCATCAATATTTTCAAAATCTACCAATTTTCTTGAAATGTCAGC
AAGACTTGAAGGTCTGGAAGATCTTCTTTTTAAAATATTCGGACCAGAAG
GCTATCTAAAGAAAGAAAAGGGTGCCCAAGAAAACTTGGAATTGATCAAT
ATACTAAATGAGATGAGTGGCAGTGTAAACATAAAACTGTTTGGAAATCA
AGTTTCATTCATTGAATTAATACGAGGAACTTTAAGTTCAGTCAAAAAAT
ACAATATCATTGAAGAAATAATGTATTGGAGTCAGGATAAAAGTCTCGAT
TTCAACAAGAATCTACAACTCGTTGATAAGACCGTAGTCATTCCGACATT
ATTGGGATTTCCTTTGAAATTCAAGCTACAAGGATCTGCCGCGATCAACA
TAAAGATCAAATCCAAATTTGACGTTGCTGGATTGGTCAGTTGGCCGATA
TCCGTGAATATAGACAATTACATTTCTCCGAATATTAACGCAGAACTTCA
TACGGAAATTGTTTATCAGACACCTTTCACGAATTACGGAATGAGAATGA
AGTTAAAGTCAGGAACGAACACCGAATTCAAGGCAACAATATTCACCAAC
AAAAACGAAGAACTATCCGTAAAATTTGACAGTCCAAAGACCACTCAGAA
TATTTTCTCAGTAGAAGGAAATGCATACGTAATACATAGAGATAAAGAAA
TTATCCAATTACAAGATAAATTAAAAGAAATCAAAATGTGTACATCAGAG
ATGACAGTGAGAATTTTGGGAATACGAGTCTGCGGAGAAGCTAAAGTACT
GGATCCTTCAACTCGCAAAGATGCACTTCTTTTTGGACCTTTTGCCGCAA
ACGTGTTCATTGAAAAAATTGACACTCAAACTGAATACATTCTACTAGCC
ACTTCGAAAACCTCAGCATTCATTTCACAAACTGGAAAAGTATATTCAAA
CCGCCATATTAAATTCGAATTCAACACTCCTAATTCAAAGTTCTACAATC
GAAGATTTTATGGAGAAATTTTGATGGACTTCAAACAAAAAGAATTCAAA
TTAGAACTCGTAACCCCATGGACCGACGCACTTGTTGCAGCGAGACTGAA
ACTAACTGACGGTGAAACGAAAATTGCTTTCAATTTCAAAGCAAACAAAC
AAAACATCATTGACATTTCGGCAGAACATTTGATATTTTCCTCACCAAAA
AGAACCAACACCAAAGGAGGTATTTCAATTCAAATCTTGAATTTGACACC
AATTAGAAAACGATGGAATTTGGAACTGACTGATGATGCGTACTCATTCA
CCTTTGTTTCCAAAGGATTACTAAAAGAAGAAACTCACTTAAAAATCAAA
GTCTTGCGAAAAAATCCCATGAAAAATTTATCTGCGTTTAATACATACGA
AATCTCTGGATTCTTTAATACCTATTTTGGATATGGAAAGATTTCAGGAA
GAACGAGTGAAAACTACTTTGGACATCGATGGGATATAAAGATAAGCCAC
AAGAATAAACAGCGGAAAGAATACCAAATCATTTTCCGACACAAAGTCGA
AGATAAAAGCTCAAAAAATCTCAATAAATACATTTTAACTACGACCTTTA
ATTACGGAGAAAAGGCGGAAAACTTTGTAACTTTCAAAACCGAAAACGAG
TTATCTGATAAACATATTCGAACATCAATGAAAGCCAGTTACGGAGGGAA
AGAAACTCCTAATAACAAAGCGTACGAAGAAGAAATGAGTATGAAATTGT
ATGGAGGTTACACTTGGAAAAGCGATGACATTTATTACGCTGAAGGAAGT
CTCAGTTTCAAGTTACCGTCGAAAAATCTTAATTACGAAGGACGTTACAT
AAGCGAAATCGGCAAAAGAGTATTCAAATTATCACTAGATTTTGATAAGG
ACCAACAATCAAAAATCAACCTAAAAATCAACTATCTCCAGCCGAAACTT
TACTTGAAGGATACCGATTTCTCTGTCTTGTTTTCTCTGCCTTACCATAA
CTTTGATCTCAAATGGAAACTCATGGAAATTGATGTCAACAAATATACCT
ACACCCTTGACGGCAAATACAACACATATGACATGAAAATCGACGGAGTT
CATACCCAAATTTCGAGACTGGATCACGACTCATATGTCTCTATAAAAAT
GCCTCGAATCCAAGGATTGCCAACAGATGTCAAAGGAAAATTGAGAGTCA
ATCTAGTTGACATGGCAAAAGCAAAAATCAAAGGAGGAATAGAAATCCCA
AACACAGATTACAAATATTCTTTCGACAGTGAGTTTTCATATATTCCAAA
TAACCTCCTTGAAATCTCGAAATCCGAAATCAGTTCCGTGCTGACATACA
ATATCGAAGTTTCCAGCAAACAAAGACTAATGAAATCTAAATTCATCTTC
ACTTGTAATCCAGAAGAGTTCAGAACCCTCTTCAACGTCGACTTGAATGG
AAACAGCAACTCCGATAATAAAATCGAGTTTGACATTCAAGCTTTGCAAA
AAAACCCAGTTTATAAACAATTCGAAAGCGTTGCCCGTTTAGCACTTCAA
TATCCAGGAAACCGACATTCAATCGGTTTTAAATCCGATTTCAAATATAG
CGAAATGGTCGCTCAAATAGACCTGATCTGGAATAAGAACCAACGAATAT
CCATTACATCGACATATCAATTGGATAACAGTTGGACACAGAAAGGTTTG
GCAGCCTCTTTAACAGTGAAAACTCCATTCATCGGTTACGAACAGATACA
TTTCGGAATGACTGCTGTTGGACAACTTCGTTACAGAAAGGTCAACTTTG
AATGCAAATGGGCTGACAATAAAAAACTAATATTTGATATAGTTATTCAA
CCGAAAAGCTCTAGCGATTTTTCACTAAATGCCAAGCTGACTAGTCCCTT
TAAAGGATTCAATTTGGTGACGTTTCAAGCAAAACATCTCCAAACTTCAA
ATTCGATTAACACTCAATGCGTCGTTGAAATCGGACCTGTCAAACGATAC
CAAATAAAGTTCGAAACAATCAACAATAGCGAAGACAAGAATCGAGACTT
TCTGTCAAATATTCTAATAGAGAGTGGTATCTATCCTGCATTCAAAATGT
CTTTATTGCACAAAGACGATTCAGTACATTACAAGAGTCAGTTCGATGTC
CTATGGATGAAGACCCAATCAATCAACGTCAAAAGTGACATTTCATTCAA
TCTAGAGGATTACGAATTCACAACAAAAGGAAATGTCGAATTATTCTCCA
CCATTAAAGAAGCCAAACAAATGAAAATGGTCTGGTCATTAGAGAATCGT
GACAGTCAGTTTCTACACAATGTCCAAATGTTCCATAATAACAAAAACCT
TTTCCAAACAACAATCAAAGGATTCTATGAAACCGAAGATAACAAGATAA
AAATTGAGTTCAATGGAGTCGCTTCGGTAATGAATGGAAGATCCATGAAG
ATTGCCAACATTTTAATCTACAGTCCACTCTCTATTCAAAATCAGTTCTC
CGTCAGTCAAGAAACCAACATAATTTACTCTCACAATTTCAATATGAATT
CCAAAAGTCTTAAACTGAAACTTCTCATTCCAAACATCCAAACGAAAAAG
GTTGAATTCGAATACAAAATCGACAGAAAACAAGAAGAGGCTGAAAGTCA
AATCTTCGTGAAAATCAACGAAAAGCATTTGTTCCATATTGAGATGGAGG
AGAAATATCAAAGGGTAGAAGAGAATGAAATCAAAATAGAGAAAATCTTG
AAATTCATGTCCGACTATGCAACAGTCAAGAACTTCGAAACGAAAACCGA
CATTAAAATAAAACCTGAATTTTTCAAAGTGGATTTCAAACTGAAATCGG
AAAATCTCGTCTTGTTAACGGTGACAGCGGAGGTGTTGAAAGAACTCCAT
AAGAAGAAGATTCAGCTTGTTATCAACTCAAAATACGAATCCCTAAAACA
ACTGAAATTCGACTGGGAGCATATTTATAAAGATTCCGACAGTTCGTTTA
CTAACAGTTTGGACTTTAATATGAATAAAATTATACATTTCAACTCAAAG
ATCAATCTCAGGGGTTTTGAACTGATCAAAATAGACATGATGCTGAAAAA
AAGAGACTATGTGAGATACTTTAAGCTTAAACACTCTCGACATTTGCTGG
GATTTGAAGACCAAATGGACACTAACTTATTCAGTGAAAAGTTCAAATTC
ACAAACACAATAATATCAAGAGGAGGAATATCTGTTCAATTTCGACTCCA
AACCAACCTATTTTTCTTTAAATCCATTGAAATCTTCGGCAGATTCAGCA
AAGAGCACGAAATAAAAGTATTCTACCAACTACCAAGAGACTCGAATAAA
ATCGAAAAGATCAAAGTGATTTTCTCCAATTTCCAAGGAATCCAAAAACT
GACTGTAGACACCACAACGCTTTTCAAGCTCGAGTTCAATTTCGACAGAA
AACAATTCAAAACTATCCTGTTCGACTTCAAGTTCCTTCCGAACTCAGAC
GAATCAGCAGTGAAATTCAAATTCAACTTCGATGGAAACAGAAATGCCTT
AAAGCATTCGAGCGAATTGAAACTAAATATCGGAAATAGAAAATTTGAAA
TAGAAAACAAAGTTGAAAAAGTCAAATGGAGCTATTTACTCTTTGAAACC
GAAATCAAAACCAACGACAATAGCTTTAAAAACTACCGAACCGGTTTTGA
ATATAAAATCCGACCGTCGAAATATTCCACAGACGTCAAGCTATTTTTCA
ACGATAAATTCATCAAATTGTCTTCGGAATTGGACTCAAGTTTCGGATCA
AAGGTCGAATTAAAAATCGAAACCTCCTTTGAAGTTCTAAAAGAAGTCTC
GTTTGAACTGAAACACAAACAAAACTCGATGATGACCCAAGTGACCCACA
AGTGTAAAACTGTTATTAAATCCTTCGATAATTTCTTGAGACTACAAAAC
GAAATCGAATGGAGCGGATTCAATTACGTTAAAGTGGAATCAACTTTCGA
AGGAAACCTTTCTGACAATCGTTACGCATTTGAACCAAAATCATTGAAAT
TTCTTCATCAATATCACAAAGGTATAATGAAAGACAATTTCCAATTAAGC
ATGTCAAAGAACAGACATTTCAAATTCCAACTCGAAGTACCATTGAATAG
AAAATCCAAATCCCTATTTGAATTAGAATCTTCCTTTCAAAATCTCAAAC
AACTGACCATTGATTTCAATATCAACTTCTCTGAAAACGAAGAAAAGTCA
CTCGCCTTAAAGATCGTTAGAAACAATGAAATAGCCATTAATATGGAATC
AAAATTGAAACACCAAGAAAAATTCGTTCTCATGACTGTGGACCTAGACA
CTGTTGGAAACTTTAAATCTGGACTTTCAATTGAATTGGTTGAAAATAGT
TTCGGAACGAAAACTGTCAAAGTAAAACTCGTCAGTTCTTTGTTAAAAGA
ATCCATCATTTTGATAACAAAAGTCAACATTCAGAAAAAAGAAATCTCTC
TGTCTCTCACTGCAGCAATAGATCAACAAGCATCCTTTTATGGAAAAGTA
TCTAAAAGTCAAAATCTTATACAAATTAAATACGGAAAGCACAAATTCGA
TTTTGAGACTTTAGTGGACAAAAACGACGGATTCAAACTGCTAAAAGTTT
CATTGTTTTCTATTGTTAAATTCAACACGGAACTAACTCGTTCCTCCAAC
TATTTGGGATTAAAAGGAGACTTTGATAATCATTCACTTCAAATTTCCTA
TAACTACAAAAGAGAACTCAAAGTCGAATTTAACATTAAACACATATTCG
GTGCACTAAAAATCAACCAAATTATTTCAGACTCCAATATCAACTACAAA
ATCGAAGGAAAATCTAACATTCCAGAATGGACAGCAATGCATACCGAATT
GGATATGACCAAATCCACCAAAGGTTTCACAATGGTATTCTACATTAAAA
AAGAAAACAGAGATGCATTGAAGTTGAATTTCGAACAAAAGTTTTTCCAA
TCAATCACCTTCACTTATTCATCGATCCACAAACTCTTCAAAACCGGAAA
ACTTGAAATAAACTATGAAAATTTTCCACAAAAATTGAATATGAAATTCG
ATGGGAAAAATTCCATATCACAGCCAATTACTGCCGAGTACGAGTTGAAT
GCCACCTCTTTCTCCGGAAAAATTACAAGCCCATTCGAATGGCTACGATC
ATGCTCCATCAAAGGTCAACTGACGATTTCAAACGACGAAGTTAAAGGTA
AATTCGACATAAATCATAATAAATTAAAACAACCAATCAACGGCGAGATA
ACAATTCAAAGGAAATTTGATTTATTAAAAGTTGAACTAAAAACTCCATT
TTTGTATCCATTGAACCAATTGAGCTTTCGAAATGAAAGATCAGATTCGA
TTTTAATAATCGAATTAAATGATGCCCAAAATCAACTATTTTATTACAAA
CTCAAGACCTATTCAAAAGCTAAATACGACCTCGATGCATCCATAACAAT
TCCGAAACTTTTATCAGAATTCAAATTGAGTTCTTTCTCCAATTTTGATT
TCGAAAATCCAACAAAATCTATCAAATTCCTCGTAAAATCAAACCAATTC
TCTGACACTAGTCTCAGTGCCACATACAATCTCAATCAAAATGAATACAA
AATCCAATTTTCCCATCCGAAAAAAGACGGTCATTTCGTTTTGAAAATCT
CTCAATATCAAGAGTCCGGAAAACAAATCGAACTATCAGCGCAAATTGGT
GACATGAAACACGAAGCAGAAATTGTCTACCAGATCAAAGATCCAAATGA
TGTTTTTATCAAATCGACTGTAAAATGCATTTCTCATTTTTCGTCTCCTG
CTAGTTTTGAACTCAACTACAAACACAAATTGAACATGCCAAAGAATTTC
AACATCGACACCCAACTTCGATTTAATGACAAAACCGTTTTAGACAAAAC
CATCTCATGGAAACTCCAGTCCGATTACAGTTTCGACTTTGTAGGAAAAA
TGACCGTTTCACCCCAAACAAAAGAATACGAAAACAAAATCGAATTATCT
AACAAACGAGGAGAAATATTTGAATTGATAATTTCTGCCACTGAAATTCT
CCGAGATGAAATTAAAGTTCGTGTCGTTCGAAAGGAAGACAATTTGGAAA
TTTTATTGAAAACTCCATTTGAATATACTAAATCTGTCAATTTTAACATA
CAAAAAGAACTGAAACCAAACTCGTGGACACAAAGAATGACTTTCTCTAC
GAATACTCTGGGAAAATATGAATTGATCTCTGAATACAAATTGTTATCGA
ATGCAGAAATCGAAATATCCAATCAAATTAATACTCCAACAACCAATCGG
AAAGCTTATATTCAAATCAATTTAAAAAATTCAGACAGTGATCAATCGCT
GATTGGATTAGTAGAAATTGTTGGTCAAACTTATCAGTTGAGCTTATCAA
GACAAAACCGACATTTACAAATCAAAATAAATTCTCCTTTTGAACATCTG
AAAAAATTCGAATTGTCAATGAAGGACAAATCAAATTTCTATGAAATTGA
AGGATTTTACAATCATTATCAAATGAAAACCATCGTTTCACAGAATCAAG
AAATTTCCAGTTTAATAATCCAATCAAATACCGATTATTTCAAGATCATT
TCGCTATCGATTGAAAATTCCATGGCCGATAATTTAGAAAAATCGTTAAA
AATCAAAATCAAAATGGATGAAAAATATTTCAAAACCGATTTCAAAATCA
ATTGCAATAAAAGATCATTGGAATTCAATTCGGAAAATGACTTAATAAAT
TACCTACCGAAATCTTTCTCAGGAAAAGTTCAACTATCTTTGGCGCCGAT
CGACATTGCAATGGAACTGAAAATCAACGACAATACACCTGTGAATTTCA
TTTTCCACCGAGACCAATTTCTAATCAGTTTCAAAAGAAACTCCAAAAGC
AAAATATCAATTGAAATTTCCAAAAAAATCAAAAATCAACTCGACGCAAA
ATTCCAACTTGACAATGATGAATATTCAATGAGAACTATTGTCGATAATT
CACGCGAAAAATTGACTTTTTCAATAAATGCATTGAAAAACAAAGTTAAC
AAACTAATCGAATTCAACAGTGAAATCGGCAAAAGAAACGGAAATCTCGA
AATGGAAATCGAATATTTATCCAATACGGTTTTCAAATTCAAATTTACCA
ATGAAAATCTACCCGACCGAAAACTTTCAATTGAAATGAGATTATTTTCT
TTTAATGGAGTTACCGATCTGATTGTCCAGCGAAAACCATCGGAAACCAA
TTTGAAGTTTTCATGGAATCTTCTTTACAATGAACAACAATTGCATATCG
GATCAATAATATACGGAATTAAATCATCCACACCAATCAATTACCTCGCC
ATTTTGAACTTACAAAAGGTTTCATATGAAATACAACTTATCCAATCGGA
AAACGGGGAATTCCAATTCAAACTCTCTAGTCCAATCAAAATACTTGATT
TCGAAGCGAAATATCAACTGGAAAAGAAACTCAATAGTTACAAAATGTGG
CTGACATGGAGAAATAACCTGATTGGAGAGTACAGCATCAAATCTCGAAT
ACAATTTAATCAGGATCCAGAAATTAAATTCCTGTTCTCATCTTTCAGAC
CAATTGTTCAATTCAAATGGGCTATGAAAACATCTGTTGCAAATGAGATC
TCTATCAACACCGAACTTGGATTGTTGGACTGGGAAAAATTGTCCTTCGA
TTTTCAATTATCCACAAAACAACTGATAAAATTGATTGCCGTTCTAAAAA
CTCCTTTCAAACCGATTAAAAATATTCAAATAACGAAAAACATCAAATTC
ATTTCTTTCTTTGATCACAAATACGAAACAATCATCATATACAATGGCAT
TACAAATATCAAATACATCGGCAGCCACGAAGTCAAATTCTCTGAGAAAA
TATTCAAATTTCAAGGAGGTTTCCACAACGACAACACAAAACTGATAGCG
GTTAATATAAGTCATACCGGAAATCACAAAGAAATGGACCATTCCGTTAT
ATGGCATGTCAGAAACCAGAAATTCGGATGGAAATTCAATGGTGGGTTTA
GACCATTGTTTGAAGGTAAAAGTGAAATATACACTCCATTCCATGAAACT
GGAAAAATAGTATTATTGGGCAAACATATGGGACAAGGAATTATGCTTGA
AGCTGGAGACAGAAATCAACGCATAGGATCATTTGAGTATATGAATGAGA
AAGATGTGCAAATGATGAAAATAACCCCTCCAAAAAATTTTGGAAAACCA
CTAACTGTGAAATATAGTTCAAAAAGACTAAGAAGAAGTGTTGGTAACGA
AATGGAAACTGATGTAACATATGGAGTTGAAAAGCTTCTAGAATGGGCCA
GTAAATTTGAGATGACAAGCGATGAATACAACGCATTAATCAATTTTAAA
ATGCCGAAATTCACAGAAAAAGCAGCAGAACTCTCATTGAAACACAACTA
TCGTGACAAAACTTGGAATTTTGATCACCAACTTACAATAAAAGATCAAG
AATCCAAAGTCTACCGATTGTTTGGCAAGTTGTTCATGGAAAGTTTGAGA
AATTTAAAAGTTTCAATGAATGCAGAACATCCAACTTTCGGTTCAATGCA
TATGTCTATTGGACATTCTTGGACTCCAAACCAATACGGGCATCATTTTG
TCATGAAATCGAACGATAAGACTTGGATAACCCACAGCGGTAATGTGAAA
TACAATTTCGACGAATCCTCATTTTCTACTGAATGGAAAACTGGCATGAA
TTCCAAACACTATACTGTCAAAGCGTCTCACTCGGGTATATGGAAAAAAT
TCCTACAAAGTCTCATAATGGAATACAATGACATTCCACATCTGATTTTC
AAAAGTGAAGTGATTCCAAATGAACAATCGGAAGTCGAAATCAATTTTCC
ACAACTTAATTCAATGAAATGGAAAATGATTATTAATAACAACAAAAATA
AAATTGATTTAATCTGTGAGCTTAAATCTGACAAATACGTTTTAGAAGTG
ACAGGCACATTGAAACATTTTGAAATTCAATTGAATTTGAACGAGAAAAA
TATTGGATCACTATTAATTAAATATGACCGATTAAAGCTTTCTGTCGAGG
GAAAGTATCTCAAGAATTTCTGTACTGTTGAAATGGCTTTCCAAGAATCA
ACAATTTCACTGATAGTAAAATCCTCCAATAAAAAATTAGAAAAATTACA
ATTAATGATTTCAGCCAATAAGATGAGTTTTGGAATCGATCATTACGGAA
CTCCTTACGCAATAGAAACCGAGTACGATTACGCTCCAAATAGTCTCATC
ATTAAAATAAACTCGTCATTTAAACAGTTATCAAAATTTGCTCTTCGTTT
TCAACCGAAGCAAATCACGTTGGAACTCAACGAATTCTATCAAAAAGTCG
ACTATCTTTTCACCCAACACCACGTCAAACTTATTTCTAAAAACAACTTT
CTACCAATCCAAAACTTGCTTTTCGAAGTCCTCATTGAGAATCCAAATAA
TGCCATGTGGAAGCTGACTGTTGATACTTTCGACACAGTATCAAAATTAA
AATTCACGAATGATAAATTAAGTTTTGAGAATCGAAACAACTATTTCCGT
GTCCGGTCATTGGAAATGGAGGCTAATGTTAAAATTGAAAAAGAATTCAC
CGGTTACACTGGGTTGTTGGTTATGAACAAACAGCAAATTCTTAAAATAC
AAATGGCGAATAAACAACAACTTTATTTTGTTAAATTAGAAACCTACCTT
GGAGAACACTTGGTTGCATCATACAACGTTCCATTAAAAGAAATGATTAT
AAGTTTTAAATTCAAAGAAAACTTTCTAAATATCATTCAAAAGTTCCAAG
AAACAGTTAAAGGTTCCTCGAAAACTTTCATTTTCAATTTCACAATTGAA
TCATCACATGCTTACCTATATTCCTTTGACAACAGTGCCACCCTCATAGT
TTCCGATTCTTCATACAGTTTAAGAACAATTTCCGAATATAATACGAAAA
AAGTCGAATTCAGAGGGGAATTATCAAGAACGAAATTGTTTTGTCATTTG
AGACTAAAATATTCTGAGTTTGCATTGAGACTTATACGAACCAATAATGA
TAAAATAAACATCGAACTTCAAGCCCCATATAATAAAATAATGATGACTT
TAGAGAAAGAAAAAAATAAATATTCAACAATTCTACAATTCAATAACAAA
GAGATTCTTGTCATTCGAACAAAACAAAATTCAAACATAGAAACATCCGT
TGAACATGAATCGACAGTTGAGTTTTACGGCCGACAAGTTTGGAATTACA
AGTTCAAAACCGACTATAAGCGATACGAAATGAAAATGACTGCCCCGACG
ACTTTCGATATGATTATCACAAATGATTGGAATAAAAATGAAAAGACTAA
ATTAGGCTTCTGGGTGAAATATTTGCTCAACGGAAAGTCAACTGAATGCG
GTGCCGGATTGAATTTTCTGTTAACAAGTCAATCAAGTTCTGTGGAAGTT
AATCTCGAAAATCAGTATCACATCATTAGATTAATGAAAACCATTGAAAT
GACAAAAAACAAACAAATAACTACCGAGCTAATTAATAAAAATACAAAAG
AGTCCTGGATAGTAATCTTCACGACGGTTAAAGACAAAACAATCGAATTA
GAATGGAAAACTCCGACAAGTAATAGAAAAATAAAATACAATGAAATCGT
AATAAACAACGTAAAAACATCAATTGATTTGGATATTGTTGACAGTTTGA
AACTGACATTGAAAACCGACGAGACAGATCCAAAGATTTGGACTGGAAGT
TTAAGTTTATTCAAAGTAAGAATTGCAGAAATTGAAACCGGTAAAGACTA
TGTGCAAGCAACTATTAATAAAGACGGCACAGAAAACAACAGAATTTTCT
TGAAATGGACAACTTCATCAGAAGGCGAATGGAAAAAAGACTATATCAGA
ACTAGACAAGTGACAATTGTGCAAAAATCACTAAACATTAATGTTGACAT
TGTACAAAAAACCGTAATGAAGACCTCTGTTTATTCAACCATGACCACAA
TGAAATATCAACTCATTGACAAATCGATGAAAACTCTGAAAATTGGTGCC
AGTATTGATTTCAGCGAAAAAAACAAAATTGTCATAGATCTTCCGAATCC
TTACATGCCAATCAAAACAATTCTCATACGATCTCAACCAAATCAATCTC
AACTTACATACCAAATGGAAACGTACTTGAATGAAGACTCAAAAGTCCAT
GGATATTTCACAATCAAAACCGGATCAAATCCAGGAGTAATGACCAGGCT
TTATTACAATCCAGAAGACGAATCAGAATTCTTCCACTTGCATTCGAAAT
ATATCGATGATCGACAAATGGAAACGATCGTTTATAAAAATATAGATGAA
ACGAAAACTACCTATTTCCAAGTGTTGTTTAGGCTTCTGAATGAGCATCA
CATTGAATCGACATTCGCGATCAAACTCGACACGATATCCACAACAATCA
AAGCGATTAGACAAATCAAATACATTGCCCAATCAAAATTCAGCGATCTC
GTGATCAATGAAATCAAATGGATAGCCCTTGAAACTAATAACCGATACAA
TCAATTGAAGGACAAAATTCCAAATTTTACAACAATGCAAAATCAGATGG
TTTTGTTTCTCAGAACAATCAAAATTGAAATGAATTCATTCTCAAAAGAA
TTGAGCGAAATTATAGCAAAAAATGAATTTTTTATCCAAACGATATCAGA
AAAAGTCTACAAATGCTTGTCCGTGAGATCTTTTCTCTATAAATTCGCCA
GCAAAGTGGTATACGTAGTTGAAAGAGCTTTGAAAACTGTTTTTAAGATT
CTAAAATCCAAAATCCAAGACATTTTCATGCTTAATTGTCAACTTTATTA
CTTCAGTTCTGGCATTGTTTCTTGGATAACAGGACCGATTACAAGCCTTA
CGAAAGCCTTTTTCAAAAACTATTTTCCATTGGCTCAGAAATATTTTGTA
AATAATCTGGAAAAGATAAAAATATCTCTCGATCAAACACTGAACATGAT
TTTCTCGACATATGTTCAAATACAAAAATTCATAAAGTTATCAATTTTAA
ATCATACCTTTAAAATAGTGGAAAAGACCATTGAAATTGCAAAATCTACA
CTGCAAATCATCATGTCGGGTTCTTTGGATTTCCTTAAGCACGAAAATGA
GTTGAAAAACCTTTACAAAAATTTGATAAGCTGTTTAGAAAAATTCTCCA
AAGCGATTTTAAACAAAATCGACAATTTAATGAACCAAGTCGACTCCAAT
CTGAACAATGTAATAGGATCAAAATTCTTTTACATTATCACAAAATCTGT
GTCAACCGTGTCGAGCTATGTAATTGATCAGATGAAAGATGAAGAAAATC
AGAAAATTATTACGTCTTTTGTTTATTACTCAATCGCTTCTCCTCTCAAT
GACTGGATGCATAAAATACAAATATTTACAATGGACTCAATCAATCCATA
TTCCTTTGTAATATATGAAAGAAAAAACAAACAGCTCCTCAACGAAAATG
AGTTCTCAATTACTGTGAAAATGACTTCTCCTATTCCGTTTAATGACTTC
AAATCTTTGCCAGATTTCGGGTACGTAAGAAGAAAAATCCACAAAATTCA
AGCTGCAATCAATTTAATAAAACAAACAATCAAAAATCAACTTGCAAATG
GATGCAGATACTTCGAACTGAGAAGTTGGTTTACATTGTATTTCCCACAA
ACGCCATTCACATCAATTCTACCGGAATTCGAAACCTATGCGACAATATC
TAAAAGATCCGTAATGACATTTGACAAAGCATCATTTACGCTCAGCCCTG
ATTCTTGCAGAGTTCTATTAAGCAAGGACTTAAAATTCAAGAAATGGGAA
ATTATCATGAATCAACAAAACAATAAACAAATGTTCACAATTAATATCGG
ATCAAACACATTTGAACTGTCAGCATCAAATTATAAAGTAAATTTGAATG
GAAAACCCTCAGATCTACCAATTCAAATCGGTTCAACAAGCCTTGTTGGA
TTGGGAAGAATGATGAAATTAAAAGACGATAAACTCGGCTTGACTATCAC
AATAGATCCAGTAAACGAGATGTTCACCGTCGGCATCAGTGGTTGGTATC
ATGGAAAGGTGCGAGGATTATTTGGAAATTCTGACAACGAACAATTTAAC
GATTTTATGCTAGACAACGGAAAGATAGTTTCCAATGAAGTGTTCATGAA
AGAAATAAGTTATAAAAGTCAAAGTTGTAAAGTTGTATCAGATGAAGAAC
AAACAGTAGTGAAACCAATAAAAGGCTGTCCTTTCATACGACGAATGGTT
TGTAAATTTTTATTCAAATGCCCATTTTCACCATTAGCTGCCTGTTTCAA
CAAAGTCAATCCAAAGAAATTTCATAAACTATGCGTCCACAGCACAGAAG
AAGTTCTTACAAAATTAGATCCATCAATCTGCAAAGCAGCGAGACAATAT
CAAGCTCAATGCCAAAAGGCCGGTGTCAATATACAAGTGCCACCTCCTTG
CAAAAAATGTGATATGCCAAACGACAAGCCCCTCTCTATCAATGAATTCA
GAAACGTTAAAATCAAAGAGAAAGTTTCCGATATCGTATTTATCGTCGAT
GAAGGAACTTGTTTAAATTCTTTATATGACAAGCTACCAATTCTCGTAAC
CAGACTTGATAAAGGAATGAAAACTAAAGGAATTAATTCTGTCCATTACG
GCCTCGTAACCTATGTTGATGATAACAACAACCAAGCAAATTTCCATACT
GTTGGTCAGAAATTATTAGGATCAAGCCAAGAAATGATCACATCCTTGAA
AACTCTCAAATCCAGCAATGGGAAATTTAAGGACTTTACTGGAGCGATTA
CAACAGCCGCGAACTATCCATTCCGAGAGCACGCATCGAGACATTTGATC
ATCATTTCATGCACCAGCACTAAAGAATATCCAAATGTATTACATAATCT
GGTAGATAAATTGACAAAGAAAGCGATCCAAGTCAGTTTGTTGACAGACT
TTTCCTTCAAACTCAAAGACTCAAACAAGCAGTCCATCATATTTGGAGTT
GATTCACAAAATACCTACACTGCATTGTCCAGAAATGGCGATAAAAATTT
CACATCTCGACCAGAAAGTGATTTCTTGTATCAATTGACAATGAAAATGA
AAGGAGTCGTATTTGACAACAAATATCTCAGTGCTAGTCAAGAATTAACT
AGAATCCGATTCGTCAGTTCATTCGCCAATCAAATCAGTCTGAGAGCAAC
ACCAGCAAAATCATCAAGATGTGTCTGTGTTGACGATGGCGATTACAACT
GCACACCGTTAGACACACACACAATCTTTCCAGTAAAACGAGCTTAATAC
AGAC
back to top

protein sequence of SMED30020296-orf-1

>SMED30020296-orf-1 ID=SMED30020296-orf-1|Name=SMED30020296-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=5815bp
MNLFGTAFLLVLLSIITNAARTPQFINPCSMKCSFEEDRIFKPGQKYVYS
YEGESNIKTTKGSYETTGVKIKSKVTITGLSNCEMKLSLSDVQIFDKTSS
DGNQFKESPNSYKFKSALEMNDIFFTKESNEVKSVCMDGEEPVWSGNIKK
AILDSLANQGIQTKPDSYKKTSHGKCFITSSEKSPKEETNPNSVNFQYDL
QTCDNKMISNSLFGDITRSVIFKTSQVSCKYLYKDQSNLVSIRCREEYKT
ATIKTNENQMVVEITTNIYKENQLPSPDRTFTNKNMFETGIEQAEDEIEA
EESPYSAAKTTLKDICVQYKSSESSKIPKLFMELVNHLKRLNSKEFKELY
LELQKSDICPEKTTEIKSIFYDASGFVNTRSSISVMVDLIKTSRISLFDQ
NIWLTSLSFMQEVPSIETLKELETIISVANPSTPLFLSLGSLTHLYCKEE
PESCQNDPIIASIVSAFLHNLNGDCSIPKDATDDYVTKIQISLKGLGNLK
YYPATVINTLNKCITKDTNKLSIRISALEVMKHMDCKQDRSSALSILLNN
ENDSELRINAYLTVMGCSDINTLFKVREILSKEKVNQVGSFIWTHLTNIK
ESNDQLKENIRDLLDDVDLKKEFDISKLKFSRNIEKTFLTNNYGVNFDSN
VIFSEKSFVPRSVSLNTTASIFSKSTNFLEMSARLEGLEDLLFKIFGPEG
YLKKEKGAQENLELINILNEMSGSVNIKLFGNQVSFIELIRGTLSSVKKY
NIIEEIMYWSQDKSLDFNKNLQLVDKTVVIPTLLGFPLKFKLQGSAAINI
KIKSKFDVAGLVSWPISVNIDNYISPNINAELHTEIVYQTPFTNYGMRMK
LKSGTNTEFKATIFTNKNEELSVKFDSPKTTQNIFSVEGNAYVIHRDKEI
IQLQDKLKEIKMCTSEMTVRILGIRVCGEAKVLDPSTRKDALLFGPFAAN
VFIEKIDTQTEYILLATSKTSAFISQTGKVYSNRHIKFEFNTPNSKFYNR
RFYGEILMDFKQKEFKLELVTPWTDALVAARLKLTDGETKIAFNFKANKQ
NIIDISAEHLIFSSPKRTNTKGGISIQILNLTPIRKRWNLELTDDAYSFT
FVSKGLLKEETHLKIKVLRKNPMKNLSAFNTYEISGFFNTYFGYGKISGR
TSENYFGHRWDIKISHKNKQRKEYQIIFRHKVEDKSSKNLNKYILTTTFN
YGEKAENFVTFKTENELSDKHIRTSMKASYGGKETPNNKAYEEEMSMKLY
GGYTWKSDDIYYAEGSLSFKLPSKNLNYEGRYISEIGKRVFKLSLDFDKD
QQSKINLKINYLQPKLYLKDTDFSVLFSLPYHNFDLKWKLMEIDVNKYTY
TLDGKYNTYDMKIDGVHTQISRLDHDSYVSIKMPRIQGLPTDVKGKLRVN
LVDMAKAKIKGGIEIPNTDYKYSFDSEFSYIPNNLLEISKSEISSVLTYN
IEVSSKQRLMKSKFIFTCNPEEFRTLFNVDLNGNSNSDNKIEFDIQALQK
NPVYKQFESVARLALQYPGNRHSIGFKSDFKYSEMVAQIDLIWNKNQRIS
ITSTYQLDNSWTQKGLAASLTVKTPFIGYEQIHFGMTAVGQLRYRKVNFE
CKWADNKKLIFDIVIQPKSSSDFSLNAKLTSPFKGFNLVTFQAKHLQTSN
SINTQCVVEIGPVKRYQIKFETINNSEDKNRDFLSNILIESGIYPAFKMS
LLHKDDSVHYKSQFDVLWMKTQSINVKSDISFNLEDYEFTTKGNVELFST
IKEAKQMKMVWSLENRDSQFLHNVQMFHNNKNLFQTTIKGFYETEDNKIK
IEFNGVASVMNGRSMKIANILIYSPLSIQNQFSVSQETNIIYSHNFNMNS
KSLKLKLLIPNIQTKKVEFEYKIDRKQEEAESQIFVKINEKHLFHIEMEE
KYQRVEENEIKIEKILKFMSDYATVKNFETKTDIKIKPEFFKVDFKLKSE
NLVLLTVTAEVLKELHKKKIQLVINSKYESLKQLKFDWEHIYKDSDSSFT
NSLDFNMNKIIHFNSKINLRGFELIKIDMMLKKRDYVRYFKLKHSRHLLG
FEDQMDTNLFSEKFKFTNTIISRGGISVQFRLQTNLFFFKSIEIFGRFSK
EHEIKVFYQLPRDSNKIEKIKVIFSNFQGIQKLTVDTTTLFKLEFNFDRK
QFKTILFDFKFLPNSDESAVKFKFNFDGNRNALKHSSELKLNIGNRKFEI
ENKVEKVKWSYLLFETEIKTNDNSFKNYRTGFEYKIRPSKYSTDVKLFFN
DKFIKLSSELDSSFGSKVELKIETSFEVLKEVSFELKHKQNSMMTQVTHK
CKTVIKSFDNFLRLQNEIEWSGFNYVKVESTFEGNLSDNRYAFEPKSLKF
LHQYHKGIMKDNFQLSMSKNRHFKFQLEVPLNRKSKSLFELESSFQNLKQ
LTIDFNINFSENEEKSLALKIVRNNEIAINMESKLKHQEKFVLMTVDLDT
VGNFKSGLSIELVENSFGTKTVKVKLVSSLLKESIILITKVNIQKKEISL
SLTAAIDQQASFYGKVSKSQNLIQIKYGKHKFDFETLVDKNDGFKLLKVS
LFSIVKFNTELTRSSNYLGLKGDFDNHSLQISYNYKRELKVEFNIKHIFG
ALKINQIISDSNINYKIEGKSNIPEWTAMHTELDMTKSTKGFTMVFYIKK
ENRDALKLNFEQKFFQSITFTYSSIHKLFKTGKLEINYENFPQKLNMKFD
GKNSISQPITAEYELNATSFSGKITSPFEWLRSCSIKGQLTISNDEVKGK
FDINHNKLKQPINGEITIQRKFDLLKVELKTPFLYPLNQLSFRNERSDSI
LIIELNDAQNQLFYYKLKTYSKAKYDLDASITIPKLLSEFKLSSFSNFDF
ENPTKSIKFLVKSNQFSDTSLSATYNLNQNEYKIQFSHPKKDGHFVLKIS
QYQESGKQIELSAQIGDMKHEAEIVYQIKDPNDVFIKSTVKCISHFSSPA
SFELNYKHKLNMPKNFNIDTQLRFNDKTVLDKTISWKLQSDYSFDFVGKM
TVSPQTKEYENKIELSNKRGEIFELIISATEILRDEIKVRVVRKEDNLEI
LLKTPFEYTKSVNFNIQKELKPNSWTQRMTFSTNTLGKYELISEYKLLSN
AEIEISNQINTPTTNRKAYIQINLKNSDSDQSLIGLVEIVGQTYQLSLSR
QNRHLQIKINSPFEHLKKFELSMKDKSNFYEIEGFYNHYQMKTIVSQNQE
ISSLIIQSNTDYFKIISLSIENSMADNLEKSLKIKIKMDEKYFKTDFKIN
CNKRSLEFNSENDLINYLPKSFSGKVQLSLAPIDIAMELKINDNTPVNFI
FHRDQFLISFKRNSKSKISIEISKKIKNQLDAKFQLDNDEYSMRTIVDNS
REKLTFSINALKNKVNKLIEFNSEIGKRNGNLEMEIEYLSNTVFKFKFTN
ENLPDRKLSIEMRLFSFNGVTDLIVQRKPSETNLKFSWNLLYNEQQLHIG
SIIYGIKSSTPINYLAILNLQKVSYEIQLIQSENGEFQFKLSSPIKILDF
EAKYQLEKKLNSYKMWLTWRNNLIGEYSIKSRIQFNQDPEIKFLFSSFRP
IVQFKWAMKTSVANEISINTELGLLDWEKLSFDFQLSTKQLIKLIAVLKT
PFKPIKNIQITKNIKFISFFDHKYETIIIYNGITNIKYIGSHEVKFSEKI
FKFQGGFHNDNTKLIAVNISHTGNHKEMDHSVIWHVRNQKFGWKFNGGFR
PLFEGKSEIYTPFHETGKIVLLGKHMGQGIMLEAGDRNQRIGSFEYMNEK
DVQMMKITPPKNFGKPLTVKYSSKRLRRSVGNEMETDVTYGVEKLLEWAS
KFEMTSDEYNALINFKMPKFTEKAAELSLKHNYRDKTWNFDHQLTIKDQE
SKVYRLFGKLFMESLRNLKVSMNAEHPTFGSMHMSIGHSWTPNQYGHHFV
MKSNDKTWITHSGNVKYNFDESSFSTEWKTGMNSKHYTVKASHSGIWKKF
LQSLIMEYNDIPHLIFKSEVIPNEQSEVEINFPQLNSMKWKMIINNNKNK
IDLICELKSDKYVLEVTGTLKHFEIQLNLNEKNIGSLLIKYDRLKLSVEG
KYLKNFCTVEMAFQESTISLIVKSSNKKLEKLQLMISANKMSFGIDHYGT
PYAIETEYDYAPNSLIIKINSSFKQLSKFALRFQPKQITLELNEFYQKVD
YLFTQHHVKLISKNNFLPIQNLLFEVLIENPNNAMWKLTVDTFDTVSKLK
FTNDKLSFENRNNYFRVRSLEMEANVKIEKEFTGYTGLLVMNKQQILKIQ
MANKQQLYFVKLETYLGEHLVASYNVPLKEMIISFKFKENFLNIIQKFQE
TVKGSSKTFIFNFTIESSHAYLYSFDNSATLIVSDSSYSLRTISEYNTKK
VEFRGELSRTKLFCHLRLKYSEFALRLIRTNNDKINIELQAPYNKIMMTL
EKEKNKYSTILQFNNKEILVIRTKQNSNIETSVEHESTVEFYGRQVWNYK
FKTDYKRYEMKMTAPTTFDMIITNDWNKNEKTKLGFWVKYLLNGKSTECG
AGLNFLLTSQSSSVEVNLENQYHIIRLMKTIEMTKNKQITTELINKNTKE
SWIVIFTTVKDKTIELEWKTPTSNRKIKYNEIVINNVKTSIDLDIVDSLK
LTLKTDETDPKIWTGSLSLFKVRIAEIETGKDYVQATINKDGTENNRIFL
KWTTSSEGEWKKDYIRTRQVTIVQKSLNINVDIVQKTVMKTSVYSTMTTM
KYQLIDKSMKTLKIGASIDFSEKNKIVIDLPNPYMPIKTILIRSQPNQSQ
LTYQMETYLNEDSKVHGYFTIKTGSNPGVMTRLYYNPEDESEFFHLHSKY
IDDRQMETIVYKNIDETKTTYFQVLFRLLNEHHIESTFAIKLDTISTTIK
AIRQIKYIAQSKFSDLVINEIKWIALETNNRYNQLKDKIPNFTTMQNQMV
LFLRTIKIEMNSFSKELSEIIAKNEFFIQTISEKVYKCLSVRSFLYKFAS
KVVYVVERALKTVFKILKSKIQDIFMLNCQLYYFSSGIVSWITGPITSLT
KAFFKNYFPLAQKYFVNNLEKIKISLDQTLNMIFSTYVQIQKFIKLSILN
HTFKIVEKTIEIAKSTLQIIMSGSLDFLKHENELKNLYKNLISCLEKFSK
AILNKIDNLMNQVDSNLNNVIGSKFFYIITKSVSTVSSYVIDQMKDEENQ
KIITSFVYYSIASPLNDWMHKIQIFTMDSINPYSFVIYERKNKQLLNENE
FSITVKMTSPIPFNDFKSLPDFGYVRRKIHKIQAAINLIKQTIKNQLANG
CRYFELRSWFTLYFPQTPFTSILPEFETYATISKRSVMTFDKASFTLSPD
SCRVLLSKDLKFKKWEIIMNQQNNKQMFTINIGSNTFELSASNYKVNLNG
KPSDLPIQIGSTSLVGLGRMMKLKDDKLGLTITIDPVNEMFTVGISGWYH
GKVRGLFGNSDNEQFNDFMLDNGKIVSNEVFMKEISYKSQSCKVVSDEEQ
TVVKPIKGCPFIRRMVCKFLFKCPFSPLAACFNKVNPKKFHKLCVHSTEE
VLTKLDPSICKAARQYQAQCQKAGVNIQVPPPCKKCDMPNDKPLSINEFR
NVKIKEKVSDIVFIVDEGTCLNSLYDKLPILVTRLDKGMKTKGINSVHYG
LVTYVDDNNNQANFHTVGQKLLGSSQEMITSLKTLKSSNGKFKDFTGAIT
TAANYPFREHASRHLIIISCTSTKEYPNVLHNLVDKLTKKAIQVSLLTDF
SFKLKDSNKQSIIFGVDSQNTYTALSRNGDKNFTSRPESDFLYQLTMKMK
GVVFDNKYLSASQELTRIRFVSSFANQISLRATPAKSSRCVCVDDGDYNC
TPLDTHTIFPVKRA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000419prepharyngeal region
PLANA:0002030early male germ cell
PLANA:0002073phagocytic cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR001747Lipid_transpt_N
IPR015255Vitellinogen_open_b-sht
IPR001846VWF_type-D
IPR015817Vitellinogen_open_b-sht_sub1
IPR015816Vitellinogen_b-sht_N
IPR014853Unchr_dom_Cys-rich
IPR011030Lipovitellin_superhlx_dom
IPR015818Vitellinogen_open_b-sht_sub2
IPR002035VWF_A
IPR015819Lipid_transp_b-sht_shell
Vocabulary: molecular function
TermDefinition
GO:0005319lipid transporter activity
Vocabulary: biological process
TermDefinition
GO:0006869lipid transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001846von Willebrand factor, type D domainSMARTSM00216VWD_2coord: 2353..2506
e-value: 7.8E-10
score: 48.7
IPR001846von Willebrand factor, type D domainPFAMPF00094VWDcoord: 2366..2507
e-value: 5.9E-9
score: 36.4
IPR001846von Willebrand factor, type D domainPROSITEPS51233VWFDcoord: 2361..2567
score: 22.522
IPR014853Uncharacterised domain, cysteine-richPFAMPF08742C8coord: 2550..2610
e-value: 8.7E-6
score: 26.1
NoneNo IPR availablePANTHERPTHR37860FAMILY NOT NAMEDcoord: 2359..2656
IPR002035von Willebrand factor, type APROSITEPS50234VWFAcoord: 2643..2861
score: 9.619