Centrosomal protein 104

Overview
NameCentrosomal protein 104
Smed IDSMED30020291
Length (bp)2871
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Centrosomal protein 104 (SMED30020291) t-SNE clustered cells

Violin plots show distribution of expression levels for Centrosomal protein 104 (SMED30020291) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Centrosomal protein 104 (SMED30020291) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Centrosomal protein 104 (SMED30020291) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020291

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30020291h1SMcG0007982 SmedASXL_017699SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30020291h1SMcG0007982 dd_Smed_v4_10228_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30020291h1SMcG0007982 dd_Smed_v4_10228_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020291h1SMcG0007982 dd_Smed_v4_10228_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020291h1SMcG0007982 dd_Smed_v4_10228_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30020291h1SMcG0007982 dd_Smed_v4_10228_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30020291h1SMcG0007982 dd_Smed_v6_10228_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30020291h1SMcG0007982 dd_Smed_v4_10228_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Centrosomal protein 104 vs. Ensembl Human
Match: CEP104 (centrosomal protein 104 [Source:HGNC Symbol;Acc:HGNC:24866])

HSP 1 Score: 522.316 bits (1344), Expect = 2.616e-170
Identity = 340/928 (36.64%), Postives = 516/928 (55.60%), Query Frame = 3
Query:   42 MPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNA-KFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIGD------ELFSVNKDE-IENFNG------------PLQQDYISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQXXXXXXXXXXXXXXXASDNENYDRAKVKKQQIDQYRHRIYKELDA-----LEFLNMPVNLQKPALK------FEKPIVE-PELYSQRGYNQNNNALIAEEPRMY-------------------PNP---------EDRPLPALKNQPIEVL--PSQRNDFREPIPEKSFIASPEPALFTGDEIDSEEINAMTKSDLSEASEAIEVYGLPLVSKVYSKNWTHQENALLEIEKRLTEMPSDMDKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKXXXXXXXXXXGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYSIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDGINPFVNKNNKINDQE-SARQKELDNNQVEQKPKEPVRTKPVKQLNKKQSIHPNIQKEPQSSRTAQQKPSQ---QISAPAPAHASGNLAKLELQDDPTLDWNTTCIFCGEKNESL-KDNMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPAD-QKNSIRCPLCHENITLGQFVDSPEALWQYHLMDETNGCPQNPRRLVAIQR 2621
            MPHK+ F V+ ++  ED   A E+  H PT  GW+S  FC +PQ+IV+ +  RC+I+K+QLL+HQ +I++KIEF++ +      F+P  A +F RLGYVSL DNEKT  KARELKSV+VDA+ +F+KL+ H N +NK+N YNQV ++A+N+IGD      E  + ++++ I+++ G              + DYIS  +DLAFD+  DPE AQIIR L++ K +AV++E++D A K++  +  LQ+VGE+LG+ E+EK+ A + E+YD AK KKQQ++QYR  +Y++L+       E +  P +L    L        +KP+   P+L  +   NQ     + E+P  Y                   P+P         ++RPLPA++    E +  P   N           +  PEP               +T+  L EAS AI+V G  LV++ Y K W+++E+ALL + K+L EMP    K+D+K  +RA+  L+++A K  VT V Q +  + K+++ + + +  ++K E  + +++ IP +     D+ A++R    N++ EM+ +  V+    I S  ++P   N        ++ LL  L       +  FT+DN MK++V AL+H+  E+RE+A  +I+ +YR     ++  YLPPDD  TR+N+LYK +FE   KIDG         +  D E  AR+K       +QK       + +K L  + +    IQ E Q   +   KP     Q    APA A G      + D+  LD    CIFCGE++ES  ++ +DLHYWK+C +L RC +CKQ VEISSLT+H L EC+++  FG+C RC+EA+ K EL +HI    CNPA  +K + RCPLCHEN + G      E  W+ HLM    GC  N R+   +Q+
Sbjct:    1 MPHKIGFVVVSSSGHEDGFSARELMIHAPTVSGWRSPRFCQFPQEIVLQMVERCRIRKLQLLAHQYMISSKIEFYISESLPEY-FAPYQAERFRRLGYVSLCDNEKTGCKARELKSVYVDAVGQFLKLIFHQNHVNKYNIYNQVALVAINIIGDPADFSDESNTASREKLIDHYLGHNSEDPALEGTYARKSDYISPLDDLAFDMYQDPEVAQIIRKLDERKREAVQKERYDYAKKLKQAIADLQKVGERLGRYEVEKRCAVEKEDYDLAKEKKQQMEQYRAEVYEQLELHSLLDAELMRRPFDLPLQPLARSGSPCHQKPMPSLPQLEERGTENQFAEPFLQEKPSSYSLTISPQHSAVDPLLPATDPHPKINAESLPYDERPLPAIRKHYGEAVVEPEMSNADISDARRGGMLGEPEP---------------LTEKALREASSAIDVLGETLVAEAYCKTWSYREDALLALSKKLMEMPVGTPKEDLKNTLRASVFLVRRAIKDIVTSVFQASLKLLKMIITQYIPKHKLSKLETAHCVERTIPVLLTRTGDSSARLRVTAANFIQEMALFKEVKSLQIIPSYLVQPLKANSSVHLAMSQMGLLARLLKDLGTGSSGFTIDNVMKFSVSALEHRVYEVRETAVRIILDMYRQHQASIL-EYLPPDDSNTRRNILYKTIFEGFAKIDG---------RATDAEMRARRKAATEEAEKQK------KEEIKALQGQLAALKEIQAEVQEKESDAVKPKNQDIQGGKAAPAEALG------IPDEHYLD--NLCIFCGERSESFTEEGLDLHYWKHCLMLTRCDHCKQVVEISSLTEHLLTECDKKDGFGKCYRCSEAVFKEELPRHIKHKDCNPAKPEKLANRCPLCHENFSPG------EEAWKAHLMGPA-GCTMNLRKTHILQK 881          
BLAST of Centrosomal protein 104 vs. Ensembl Human
Match: CEP104 (centrosomal protein 104 [Source:HGNC Symbol;Acc:HGNC:24866])

HSP 1 Score: 171.785 bits (434), Expect = 9.897e-48
Identity = 80/154 (51.95%), Postives = 113/154 (73.38%), Query Frame = 3
Query:   42 MPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNA-KFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIGD 500
            MPHK+ F V+ ++  ED   A E+  H PT  GW+S  FC +PQ+IV+ +  RC+I+K+QLL+HQ +I++KIEF++ +      F+P  A +F RLGYVSL DNEKT  KARELKSV+VDA+ +F+KL+ H N +NK+N YNQV ++A+N+IGD
Sbjct:    1 MPHKIGFVVVSSSGHEDGFSARELMIHAPTVSGWRSPRFCQFPQEIVLQMVERCRIRKLQLLAHQYMISSKIEFYISESLPEY-FAPYQAERFRRLGYVSLCDNEKTGCKARELKSVYVDAVGQFLKLIFHQNHVNKYNIYNQVALVAINIIGD 153          
BLAST of Centrosomal protein 104 vs. Ensembl Human
Match: CEP104 (centrosomal protein 104 [Source:HGNC Symbol;Acc:HGNC:24866])

HSP 1 Score: 141.739 bits (356), Expect = 7.941e-38
Identity = 83/185 (44.86%), Postives = 109/185 (58.92%), Query Frame = 3
Query: 2082 IQKEPQSSRTAQQKPSQQ---ISAPAPAHASGNLAKLELQDDPTLDWNTTCIFCGEKNESL-KDNMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPAD-QKNSIRCPLCHENITLGQFVDSPEALWQYHLMDETNGCPQNPRRLVAIQR 2621
            IQ E Q   +   KP  Q       APA A G      + D+  LD    CIFCGE++ES  ++ +DLHYWK+C +L RC +CKQ VEISSLT+H L EC+++  FG+C RC+EA+ K EL +HI    CNPA  +K + RCPLCHEN + G      E  W+ HLM    GC  N R+   +Q+
Sbjct:    9 IQAEVQEKESDAVKPKNQDIQGGKAAPAEALG------IPDEHYLD--NLCIFCGERSESFTEEGLDLHYWKHCLMLTRCDHCKQVVEISSLTEHLLTECDKKDGFGKCYRCSEAVFKEELPRHIKHKDCNPAKPEKLANRCPLCHENFSPG------EEAWKAHLMGPA-GCTMNLRKTHILQK 178          
BLAST of Centrosomal protein 104 vs. Ensembl Human
Match: CEP104 (centrosomal protein 104 [Source:HGNC Symbol;Acc:HGNC:24866])

HSP 1 Score: 133.65 bits (335), Expect = 4.710e-35
Identity = 74/155 (47.74%), Postives = 97/155 (62.58%), Query Frame = 3
Query: 2082 IQKEPQSSRTAQQKPSQQ---ISAPAPAHASGNLAKLELQDDPTLDWNTTCIFCGEKNESL-KDNMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPAD-QKNSIRCPLCHENITLGQFV 2531
            IQ E Q   +   KP  Q       APA A G      + D+  LD    CIFCGE++ES  ++ +DLHYWK+C +L RC +CKQ VEISSLT+H L EC+++  FG+C RC+EA+ K EL +HI    CNPA  +K + RCPLCHEN + G+ V
Sbjct:   31 IQAEVQEKESDAVKPKNQDIQGGKAAPAEALG------IPDEHYLD--NLCIFCGERSESFTEEGLDLHYWKHCLMLTRCDHCKQVVEISSLTEHLLTECDKKDGFGKCYRCSEAVFKEELPRHIKHKDCNPAKPEKLANRCPLCHENFSPGEEV 177          
BLAST of Centrosomal protein 104 vs. Ensembl Human
Match: CEP104 (centrosomal protein 104 [Source:HGNC Symbol;Acc:HGNC:24866])

HSP 1 Score: 122.865 bits (307), Expect = 3.498e-31
Identity = 68/159 (42.77%), Postives = 104/159 (65.41%), Query Frame = 3
Query:  297 SPSNAKFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIG------DELFSVNKDE-IENFNG------------PLQQDYISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQ 716
            +P+ + +    YVSL DNEKT  KARELKSV+VDA+ +F+KL+ H N +NK+N YNQV ++A+N+IG      DE  + ++++ I+++ G              + DYIS  +DLAFD+  DPE AQIIR L++ K +AV++E++D A K++  +  LQ
Sbjct:   28 APTVSGWRSPSYVSLCDNEKTGCKARELKSVYVDAVGQFLKLIFHQNHVNKYNIYNQVALVAINIIGDPADFSDESNTASREKLIDHYLGHNSEDPALEGTYARKSDYISPLDDLAFDMYQDPEVAQIIRKLDERKREAVQKERYDYAKKLKQAIADLQ 186          
BLAST of Centrosomal protein 104 vs. Ensembl Celegans
Match: T06D8.2 (pep chromosome:WBcel235:II:11226679:11232835:1 gene:WBGene00011523.1 transcript:T06D8.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T06D8.2)

HSP 1 Score: 56.225 bits (134), Expect = 9.687e-8
Identity = 67/250 (26.80%), Postives = 109/250 (43.60%), Query Frame = 3
Query:  135 KGWQSANFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNAKFTRLGYVSLSDNEKTQFKAR-------ELKSVHVDAICRFVKLVV---HTNFINKFNHYNQVGIIAVNLIGDELFSVNKDEIE--NFNGPLQQDYISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQXXXXXXXXXXXXXXXASDNENYDRAKVKKQQIDQYRHRIYKELD 848
            K W S     +P +I + L  + +I+KI++++H   I  KI  + G                  GY+        QFK+R       ELK+V +D IC  + L V   H + IN  N  + VG++ V L G  L S    E +  +F   + Q+ I        D     E   +I  +E+ K  AV  E F  A   +  V+ L++  +++ +LE +K  A  +E++ RA   + +I   R  I   +D
Sbjct:   24 KQWVSEKSLTFPVEIELHLRQKSEIEKIEIVAHNKFIPKKISIYSGRDEE--------------GYIG-----DVQFKSRKSDDQKYELKNVFLDEICSMLLLSVSEAHADVIN--NLESLVGLVDVKLFGKYLPSDEPIEADPRDFKPGIPQNVIP-------DHKYSKELQAMIGAIERNKQTAVANEDFKLAKSAQLAVRDLKKSTKEMEELENDKGEAVADEDFQRANDLQDEITALRSNILASVD 245          
BLAST of Centrosomal protein 104 vs. Ensembl Fly
Match: CG10137 (gene:FBgn0032800 transcript:FBtr0081248)

HSP 1 Score: 146.747 bits (369), Expect = 1.606e-35
Identity = 96/289 (33.22%), Postives = 164/289 (56.75%), Query Frame = 3
Query:   42 MPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSA-NFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNAKFTRLGYVSLSDNEKTQFKARELKSVHVDAIC----RFVKLVVHTNFINKFNHYNQVGIIAVNLIGDEL-----FSVNKDEIENFNGPL-----QQDYISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQXXXXXXXXXXXXXXXASDNENYDRAKVKKQQIDQYRHRIYKELDALEFL 863
            M  K+PF V+ A+ ++    ASE++NH PT  GW+SA N  L   DI++  +   +I +IQLL+HQ LI  K+E ++   P ++  +PS+  F  LG+V+L+DN  T +K+REL+SV    +C      +KL +     N +N   Q+ ++AVN++G++L         ++ + N   PL     +    S  +DL F + V+    Q IR LE+ K+ AV  E+F+ A K++  +  L+  GE+LG+  + K+ A   E++  A+++K+QI+ YR  + ++L   + L
Sbjct:    1 MAKKIPFNVVFASDEDVNFPASELNNHGPTVHGWRSAPNGSLTSHDIILRFQQPAKIYRIQLLAHQYLIPEKVELWLHYSPKSLPSTPSSQYFDFLGFVALADNANTNYKSRELQSV---TVCPRRGTHLKLRLIGVQGNDYNDTGQISLLAVNVLGEDLEVGPNNGNGEEHLANEAPPLDTATGELALASVCDDLLFSMYVEESIVQTIRELEQRKILAVNSERFEYARKLKLCMTALRTAGERLGRYALAKRQAVQQEDFTTARLRKEQIEMYRAAVLRQLQVHQLL 286          

HSP 2 Score: 144.05 bits (362), Expect = 9.048e-35
Identity = 117/497 (23.54%), Postives = 227/497 (45.67%), Query Frame = 3
Query: 1182 EASEAIEVYGLPLVSKVYSKNWTHQENALLEI-----EKRLTEMPSDMDKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKXXXXXXXXXXGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYSIHRLT---NHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDGINPFVNKNNKINDQESARQKELDNNQVEQKPKEPVRTKPVKQLNKKQSIHPNIQKEPQSSRT-----AQQKPSQQISAPAPAHAS---GNLAKLELQDD-------PTLDWNTTCIFCGEKNESLKDNMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPADQKNSIRCPLCHENITLGQFVDSPEALWQYHLMDETNGCPQNPRR 2603
            +A+  I V+G  LV + YS+ +  +E+ L+ +     E  L E  S+          R+ A LL +A +  V  V   A    +++ LE V    ++  EV   +D+++PE+     D  A++  + Q+ ++ ++    V +   +     +        R    +L++L +L +   ++   +   T     +     + H +  +R+ AE +++++Y+  +  +VR  LPPDD  TR+N+LY++LF + DK+D     +++  ++ +           +       +   +    +L   +S H N+     SS        +Q+ ++Q+     + ++   G+ +  E  +D       P  DW+     C   + +    +D HYWK CP L +CP C Q +E+++L  H   EC+ +  +  C RCTE++ K   + H  +  C    +  + RCPLCH+++ L Q     +  W+ HL+    GCP N R+
Sbjct:  461 QAALPILVFGNELVEQFYSRQFQDREDGLMRLRNFLKEHDLLEASSNEHAASPNKVARSAALLLHRAVRDAVYSVFSQATETVRMLFLEYVPGR-VSPNEVARCVDRLLPELLAKSGDPSARLHTLAQHTILSIAACPEVAEQHLVAPALSRSVGSGTHQRLAMSRLQMLEQLVNTQGISTDKHSGLTCRALSECGCSGIHHPAEPVRKVAERILLLVYK-VNPRLVRKQLPPDDDITRRNLLYRQLFTEFDKLD-----LDRKQELLEASKYGGGHSSGDAATPPADKASTSSDASRLMNSRSGH-NLGPMASSSNGYASCNGKQQYNEQLKRSMLSVSNSRKGSASNSESTEDNTPKIRCPFCDWS-----CAGSDAT---QLDRHYWKACPFLTKCPQCSQVLEVAALNYHLTTECDAKESYVVCVRCTESVHKQLYELHQMEDYCREL-KTGAARCPLCHDDVHLPQ-----DGGWKLHLLS-AGGCPGNIRK 934          
BLAST of Centrosomal protein 104 vs. Ensembl Zebrafish
Match: cep104 (centrosomal protein 104 [Source:ZFIN;Acc:ZDB-GENE-060503-195])

HSP 1 Score: 504.212 bits (1297), Expect = 3.945e-163
Identity = 317/925 (34.27%), Postives = 498/925 (53.84%), Query Frame = 3
Query:   30 FKTSMPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNAKFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIGDEL------FSVNKDEI-------ENFNGPLQQDY----------ISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQXXXXXXXXXXXXXXXASDNENYDRAKVKKQQIDQYRHRIYKELDALEFLNMPVNLQKPALKFEKPIVEPELYSQRGY-------------------NQNNNALIAEEPRMYPNP----------------EDRPLPALKNQPIEVLPSQRNDFREPIPEKSFIASPEPALFTGDEIDSEEINAMTKSDLSEASEAIEVYGLPLVSKVYSKNWTHQENALLEIEKRLTEMPSDMDKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKXXXXXXXXXXGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYSIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDGINPFVNKNNKINDQESARQKELDNNQVEQKPKEPVRT-----KPVKQLNKKQSIHPNI--QKEPQSSRTAQQKPSQQISAPAPAHASGNLAKLELQDDPTLDWNTTCIFCGEKNESL-KDNMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCN-PADQKNSIRCPLCHENITLGQFVDSPEALWQYHLMDETNGCPQNPRR 2603
             +T MPHK+ F VI  +  E  + A ++  H PT  GW+S  FC +PQ+I++ L  RC+I+K+QLL+HQ  I +K+EF VGD       +       RLGYVSLSDNEKT F+ARELKSVHVDA+  F+KL  H N +N++N YNQV ++A+N++GD +       ++++D +         ++  L   Y          IS  +DLAFD+  DPE A IIR L++ K   V EE+FD A +++  +  LQ+VGE+LG+ ++EK  A + E+YD AK KK+Q+D YR  +Y +L+    L++   + + +   +   + P + +Q+                      Q+ +   + +  +   P                ++RPLP L+N+    L  Q     + I   +  ASP     +G      +   +T+    EAS  IE+YG  LV+  YSK W+++E+ALL + K+L E+PS   K ++++  RA   L KKA   +V+ V   + N+ K +L E +    + K E+ + +++    +     D+ +++R     ++ EM+ +  VR    +  E ++P   ++ AR    +LEL+ +L       +  FTLD+ M++    L+H SA +RE +  LI  +YR   K V+ +YLPPDD  TRKNVLYK LF+ L K+DG          IN Q+S +  E D  + E   KE +R+       +K++++K   +  +  +K  +++++  +K +Q +S    A  S  +  L          +  CIFCGE++ES  +D +DLHYWK+CP+L+RC  C+Q VEI+SLT+H L ECE+ + F QCP C+EA+++ +L +H     CN P+  +N   CPLCHEN T G      E  W+ HLM    GC  N RR
Sbjct:    9 LRTGMPHKIGFSVISWSGHEGNYNAKKLMVHAPTVSGWRSTRFCPFPQEIILQLAERCRIRKLQLLAHQYFIPSKVEFHVGDMLPESNSAQQAHSLHRLGYVSLSDNEKTGFRARELKSVHVDAVGSFLKLTFHRNHVNQYNVYNQVALVALNILGDPIDGSDIGTTLSRDHLIDQFLNSSQYSSSLDGTYTGLSSYKCESISPLDDLAFDMYQDPEVAHIIRLLDQKKQVMVREERFDSAKELKQAIADLQKVGERLGRYDVEKLSAIEREDYDTAKQKKEQMDAYRLAVYHQLEIHNLLDIS-QIHRMSGLSDSGFLSPRVGTQKHMPHPPDTHRKKRQGPVKDTDEQDTSKTTSPKHTIPSTPFTPPHVSKIDINSLPYDERPLPTLRNR----LSDQSVSELDEILPLADTASPRSPRASG------QPEELTEKAQREASLPIEIYGESLVAGAYSKTWSYREDALLAVRKKLMEVPSGSSKAELRSMTRAAVFLCKKALTDKVSSVFLASLNLLKTILSEFIPNHQLGKSEISHCVEQTWNNLISRAGDSTSRLRTPAITFIQEMALFKEVRALQMVPVELVRPMQSSVPARQALSRLELIEKLLEQLGTKDSGFTLDSIMRFLTGGLEHSSASVRELSMRLIQTVYRLHGKPVL-NYLPPDDSSTRKNVLYKNLFDSLAKLDGTT--------INTQKSKKGAERDEGERE---KEEIRSLQEQLAVLKEISEKGKDNAKVPEKKTEKATKSGAKKVNQSVSGDVKASQSSAVNYL----------DNLCIFCGERDESFTEDGLDLHYWKHCPMLQRCLQCRQVVEIASLTEHLLTECERRTDFSQCPLCSEALMRDKLTEHAQSTACNPPSSDENCNHCPLCHENFTSG------EEGWKSHLMG-PEGCKHNSRR 893          
BLAST of Centrosomal protein 104 vs. Ensembl Zebrafish
Match: cep104 (centrosomal protein 104 [Source:ZFIN;Acc:ZDB-GENE-060503-195])

HSP 1 Score: 502.671 bits (1293), Expect = 2.092e-162
Identity = 318/933 (34.08%), Postives = 499/933 (53.48%), Query Frame = 3
Query:   24 LYFKTSMPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNAKFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIGDEL------FSVNKDEI-------ENFNGPLQQDY----------ISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQXXXXXXXXXXXXXXXASDNENYDRAKVKKQQIDQYRHRIYKELDALEFLNMPVNLQKPALKFEKPIVEPELYSQRGY-------------------NQNNNALIAEEPRMYPNP----------------EDRPLPALKNQPIEVLPSQRNDFREPIPEKSFIASPEPALFTGDEIDSEEINAMTKSDLSEASEAIEVYGLPLVSKVYSKNWTHQENALLEIEKRLTEMPSDMDKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKXXXXXXXXXXGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYSIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDGINPFVNKNNKINDQESARQKELDNNQVEQKPKEPVRT-----KPVKQLNKKQSIHPNI--QKEPQSSRTAQQKPSQQISAPAPAHASGNLAKLELQDDPTLDWNTTCIFCGEKNESL-KDNMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCN-------PADQKNSIRCPLCHENITLGQFVDSPEALWQYHLMDETNGCPQNPRR 2603
            L  +T MPHK+ F VI  +  E  + A ++  H PT  GW+S  FC +PQ+I++ L  RC+I+K+QLL+HQ  I +K+EF VGD       +       RLGYVSLSDNEKT F+ARELKSVHVDA+  F+KL  H N +N++N YNQV ++A+N++GD +       ++++D +         ++  L   Y          IS  +DLAFD+  DPE A IIR L++ K   V EE+FD A +++  +  LQ+VGE+LG+ ++EK  A + E+YD AK KK+Q+D YR  +Y +L+    L++   + + +   +   + P + +Q+                      Q+ +   + +  +   P                ++RPLP L+N+    L  Q     + I   +  ASP     +G      +   +T+    EAS  IE+YG  LV+  YSK W+++E+ALL + K+L E+PS   K ++++  RA   L KKA   +V+ V   + N+ K +L E +    + K E+ + +++    +     D+ +++R     ++ EM+ +  VR    +  E ++P   ++ AR    +LEL+ +L       +  FTLD+ M++    L+H SA +RE +  LI  +YR   K V+ +YLPPDD  TRKNVLYK LF+ L K+DG          IN Q+S +  E D  + E   KE +R+       +K++++K   +  +  +K  +++++  +K +Q +S    A  S  +  L          +  CIFCGE++ES  +D +DLHYWK+CP+L+RC  C+Q VEI+SLT+H L ECE+ + F QCP C+EA+++ +L +H     CN       P+  +N   CPLCHEN T G      E  W+ HLM    GC  N RR
Sbjct:   19 LELRTGMPHKIGFSVISWSGHEGNYNAKKLMVHAPTVSGWRSTRFCPFPQEIILQLAERCRIRKLQLLAHQYFIPSKVEFHVGDMLPESNSAQQAHSLHRLGYVSLSDNEKTGFRARELKSVHVDAVGSFLKLTFHRNHVNQYNVYNQVALVALNILGDPIDGSDIGTTLSRDHLIDQFLNSSQYSSSLDGTYTGLSSYKCESISPLDDLAFDMYQDPEVAHIIRLLDQKKQVMVREERFDSAKELKQAIADLQKVGERLGRYDVEKLSAIEREDYDTAKQKKEQMDAYRLAVYHQLEIHNLLDIS-QIHRMSGLSDSGFLSPRVGTQKHMPHPPDTHRKKRQGPVKDTDEQDTSKTTSPKHTIPSTPFTPPHVSKIDINSLPYDERPLPTLRNR----LSDQSVSELDEILPLADTASPRSPRASG------QPEELTEKAQREASLPIEIYGESLVAGAYSKTWSYREDALLAVRKKLMEVPSGSSKAELRSMTRAAVFLCKKALTDKVSSVFLASLNLLKTILSEFIPNHQLGKSEISHCVEQTWNNLISRAGDSTSRLRTPAITFIQEMALFKEVRALQMVPVELVRPMQSSVPARQALSRLELIEKLLEQLGTKDSGFTLDSIMRFLTGGLEHSSASVRELSMRLIQTVYRLHGKPVL-NYLPPDDSSTRKNVLYKNLFDSLAKLDGTT--------INTQKSKKGAERDEGERE---KEEIRSLQEQLAVLKEISEKGKDNAKVPEKKTEKATKSGAKKVNQSVSGDVKASQSSAVNYL----------DNLCIFCGERDESFTEDGLDLHYWKHCPMLQRCLQCRQVVEIASLTEHLLTECERRTDFSQCPLCSEALMRDKLTEHAQSTACNRESPLWAPSSDENCNHCPLCHENFTSG------EEGWKSHLMG-PEGCKHNSRR 911          
BLAST of Centrosomal protein 104 vs. Ensembl Xenopus
Match: slc11a1 (solute carrier family 11 member 1 [Source:Xenbase;Acc:XB-GENE-482302])

HSP 1 Score: 529.635 bits (1363), Expect = 6.310e-173
Identity = 331/929 (35.63%), Postives = 516/929 (55.54%), Query Frame = 3
Query:   42 MPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNAKFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIG------------------DELFSVNKDEI---ENFNGPLQQDYISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQXXXXXXXXXXXXXXXASDNENYDRAKVKKQQIDQYRHRIYKELDALEFLNMPVNLQKPALKFEKPI--VEPELYSQRGYNQNNNALIAEEPRMYPNPEDRP---LPALKNQPIEV---------------------------------------LPSQRNDFREPIPEKSFIASPEPALFTGDEIDSEEINAMTKSDLSEASEAIEVYGLPLVSKVYSKNWTHQENALLEIEKRLTEMPSDMDKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKXXXXXXXXXXGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYSIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDG--INPFVNKNNKINDQESARQKELDNNQVEQKPKEPVRTKPVKQLNKKQSIHPNIQKEPQSSRTAQQKPSQQISAPAPAHASGNLAKLELQDDPTLDWNTTCIFCGEKNESLKD-NMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPA-DQKNSIRCPLCHENITLGQFVDSPEALWQYHLMDETNGCPQNPRRLVAIQR 2621
            MPHKL F V+ ++  ED   A E+  H PT  GW+S  FC YPQ+I+I +  RC+I+K+QLL+HQ +I++KIEF++ +   +      + +F RLGYVSLSDNEKT +KARELKSV+V+A+ +++KL+ H N+ N++N YNQV +IA+N+IG                  D+      D+     ++ G L  D IS  +DLAFD+  DPE AQIIR L++ K +AV  E++D A K++  +  LQ+VGE+LG+ E+EK+ A + E+YD AK KKQQ+++YR ++Y++L+  + L++ + +++ +     PI  V P         Q + AL   +P    + E +P    PA+  +P +V                                       LP+QR +  +         + EP L T     + E   +T+  L EA  AIEV+G  LV+  YSK W+++E+AL+ + K+L ++ S M KDD+K  +RA   L+++A K +VT V Q +  + K+++ + + +  + K E  + ++K +P++     D+ A+ R I+ N++ EM+ +  V+    I +  ++P  P + +R  Q +++LL  L     + +  FT+DN MK+AV AL++  +E+R+ A  +I+ LY+    +V+  Y+P +D   RKN+LYK LFE   KIDG   +  +    K   +E+ RQK+ +   ++++       +   Q  K + +H N  K  + SR     P+   S                  D  LD    CIFCGE++ES  D  +DLHYWKNCP+L+RC +CKQ VEI+SLT H L EC+Q+  FG+C RC+EAI K  L +H+    CN A  +K +  CPLCHEN + G      E  W+ HLM +  GC  NPRR  A+QR
Sbjct:    1 MPHKLGFVVVSSSGHEDGFSAKELMVHAPTVSGWRSPRFCQYPQEIIIQMVERCRIRKLQLLAHQYMISSKIEFYISESLPDYFVPYQSERFRRLGYVSLSDNEKTGYKARELKSVYVEAVGQYLKLIFHKNYSNRYNLYNQVALIAINIIGDPVDFNEESNMPSREKLIDQYLGNGSDDSALDASYTGKL--DAISPLDDLAFDMYQDPEVAQIIRKLDEKKQEAVRHERYDYAKKLKQAIADLQKVGERLGRYEVEKRCAVEKEDYDLAKQKKQQMEEYRQKVYQQLELHDLLDIAL-IRRGSETSLDPIESVSP---------QQHRALSPPQPEKERSTEKKPKKEQPAVTEKPPKVLSPKPILESRRSPSPPPAASPALVAPNINVDALPYDERPLPAQRKNKEDSFSYLEPEVNEEPVLDTPRTRITGEPEPLTEKALREAGFAIEVFGEALVAGAYSKTWSYREDALIAVSKKLADIASGMSKDDLKNLLRAAMFLVRRAIKDKVTSVFQASLRLLKMIITDYIPKHKLGKGETTHCVEKCLPDLLVRTGDSTARHRLISSNFIQEMALFKEVKPLQIIPTHLVQPLKPTMPSRLAQSQVDLLENLLKELGVESSGFTVDNVMKFAVGALEYTISEVRDKAVQIILYLYKQHPSQVL-EYMPTEDSSARKNILYKTLFEGFAKIDGRPTDSELKAQKKKMAEEAERQKKEEIKALQEQLAALKEIQTEVQTGKAKDVHVNKSKTDERSRKVAGSPNADTSDAV---------------DNYLD--NLCIFCGERDESFTDEGLDLHYWKNCPMLKRCEHCKQVVEIASLTDHLLTECDQKDSFGKCQRCSEAIPKDVLLEHVKAKSCNAAKGEKVANHCPLCHENFSPG------EEAWKSHLMGK-EGCRMNPRRTQALQR 892          
BLAST of Centrosomal protein 104 vs. Ensembl Xenopus
Match: slc11a1 (solute carrier family 11 member 1 [Source:Xenbase;Acc:XB-GENE-482302])

HSP 1 Score: 509.605 bits (1311), Expect = 1.596e-166
Identity = 317/880 (36.02%), Postives = 500/880 (56.82%), Query Frame = 3
Query:   42 MPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNAKFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIGDEL-FSVNKDEIENFN-----------GPLQQDYISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQXXXXXXXXXXXXXXXASDNENYDRAKVKKQQIDQYRHRIYKELDALEFLNMPVNLQKP----------ALKFEKPIVEPELYSQRGYNQNNNALIAEEPR-MYPNP------------------------EDRPLPALKNQPIEVLPSQRNDFREPIPEKSFIASPEPALFTGDEIDSEEINAMTKSDLSEASEAIEVYGLPLVSKVYSKNWTHQENALLEIEKRLTEMPSDMDKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKXXXXXXXXXXGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYSIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDGINPFVNKNNKINDQESARQKELDNNQVEQKPKEPVRTKPVKQLNKKQSIHPNIQKEPQSSRTAQ-QKPSQQISAPAPAHASGNLAKLELQDDPTLDWNTTCIFCGEKNESLKD-NMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPA-DQKNSIRCPLCHENITLGQFV 2531
            MPHKL F V+ ++  ED   A E+  H PT  GW+S  FC YPQ+I+I +  RC+I+K+QLL+HQ +I++KIEF++ +   +      + +F RLGYVSLSDNEKT +KARELKSV+V+A+ +++KL+ H N+ N++N YNQV +IA+N+IGD + F+   + +  F               + D IS  +DLAFD+  DPE AQIIR L++ K +AV  E++D A K++  +  LQ+VGE+LG+ E+EK+ A + E+YD AK KKQQ+++YR ++Y++L+  + L++ +    P          AL   +P  E E  +++   +   A+  + P+ + P P                        ++RPLPA +        ++ + F    PE     + EP L T     + E   +T+  L EA  AIEV+G  LV+  YSK W+++E+AL+ + K+L ++ S M KDD+K  +RA   L+++A K +VT V Q +  + K+++ + + +  + K E  + ++K +P++     D+ A+ R I+ N++ EM+ +  V+    I +  ++P  P + +R  Q +++LL  L     + +  FT+DN MK+AV AL++  +E+R+ A  +I+ LY+    +V+  Y+P +D   RKN+LYK LFE   KIDG         +  D E   QK+    + E++ KE      +K L ++ +    IQ E Q+ +        Q  +      AS  +  L             CIFCGE++ES  D  +DLHYWKNCP+L+RC +CKQ VEI+SLT H L EC+Q+  FG+C RC+EAI K  L +H+    CN A  +K +  CPLCHEN + G+ V
Sbjct:    1 MPHKLGFVVVSSSGHEDGFSAKELMVHAPTVSGWRSPRFCQYPQEIIIQMVERCRIRKLQLLAHQYMISSKIEFYISESLPDYFVPYQSERFRRLGYVSLSDNEKTGYKARELKSVYVEAVGQYLKLIFHKNYSNRYNLYNQVALIAINIIGDPVDFNEESNMVSIFKCFIFLSRYVFIASRKLDAISPLDDLAFDMYQDPEVAQIIRKLDEKKQEAVRHERYDYAKKLKQAIADLQKVGERLGRYEVEKRCAVEKEDYDLAKQKKQQMEEYRQKVYQQLELHDLLDIALTSLDPIESVSPQQHRALSPPQP--EKERSTEKKPKKEQPAVTEKPPKVLSPKPILESRRSPSPPPAASPALVDALPYDERPLPAQRK-------NKEDSFSYLEPE----VNEEPVLDTPRTRITGEPEPLTEKALREAGFAIEVFGEALVAGAYSKTWSYREDALIAVSKKLADIASGMSKDDLKNLLRAAMFLVRRAIKDKVTSVFQASLRLLKMIITDYIPKHKLGKGETTHCVEKCLPDLLVRTGDSTARHRLISSNFIQEMALFKEVKPLQIIPTHLVQPLKPTMPSRLAQSQVDLLENLLKELGVESSGFTVDNVMKFAVGALEYTISEVRDKAVQIILYLYKQHPSQVL-EYMPTEDSSARKNILYKTLFEGFAKIDG---------RPTDSELKAQKKKMAEEAERQKKE-----EIKALQEQLAALKEIQTEVQTGKVLSIVNIMQSFADSNDFMASAYICSL-------------CIFCGERDESFTDEGLDLHYWKNCPMLKRCEHCKQVVEIASLTDHLLTECDQKDSFGKCQRCSEAIPKDVLLEHVKAKSCNAAKGEKVANHCPLCHENFSPGEEV 839          
BLAST of Centrosomal protein 104 vs. Ensembl Xenopus
Match: slc11a1 (solute carrier family 11 member 1 [Source:Xenbase;Acc:XB-GENE-482302])

HSP 1 Score: 502.671 bits (1293), Expect = 8.126e-164
Identity = 320/890 (35.96%), Postives = 498/890 (55.96%), Query Frame = 3
Query:   42 MPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNAKFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIGDEL-------FSVNKDEIENFNG-------------PLQQDYISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQXXXXXXXXXXXXXXXASDNENYDRAKVKKQQIDQYRHRIYKELDALEFLNMPVNLQKPALKFEKPI--VEPELYSQRGYNQNNNALIAEEPRMYPNPEDRPLPALKNQPIEVLP-------------SQRNDFR---------------EPIP------EKSFI-----ASPEPALFTGDEIDSEEINAMTKSDLSEASEAIEVYGLPLVSKVYSKNWTHQENALLEIEKRLTEMPSDMDKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKXXXXXXXXXXGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYSIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDGINPFVNKNNKINDQESARQKELDNNQVEQKPKEPVRTKPVKQLNKKQSIHPNIQKEPQSSRTAQQKPSQQISAPAPAHASGNLAKLELQDDPTLDWNTTCIFCGEKNESLKD-NMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPA-DQKNSIRCPLCHENITLG 2522
            MPHKL F V+ ++  ED   A E+  H PT  GW+S  FC YPQ+I+I +  RC+I+K+QLL+HQ +I++KIEF++ +   +      + +F RLGYVSLSDNEKT +KARELKSV+V+A+ +++KL+ H N+ N++N YNQV +IA+N+IGD +           +  I+ + G               + D IS  +DLAFD+  DPE AQIIR L++ K +AV  E++D A K++  +  LQ+VGE+LG+ E+EK+ A + E+YD AK KKQQ+++YR ++Y++L+  + L++ + +++ +     PI  V P         Q + AL   +P    + E +P    K QP    P             SQ+  FR                P+P      E SF       + EP L T     + E   +T+  L EA  AIEV+G  LV+  YSK W+++E+AL+ + K+L ++ S M KDD+K  +RA   L+++A K +VT V Q +  + K+++ + + +  + K E  + ++K +P++     D+ A+ R I+ N++ EM+ +  V+    I +  ++P  P + +R  Q +++LL  L     + +  FT+DN MK+AV AL++  +E+R+ A  +I+ LY+    +V+  Y+P +D   RKN+LYK LFE   KIDG         +  D E   QK+    + E++ KE      +K L ++ +    IQ E Q+ ++         +      AS  +  L             CIFCGE++ES  D  +DLHYWKNCP+L+RC +CKQ VEI+SLT H L EC+Q+  FG+C RC+EAI K  L +H+    CN A  +K +  CPLCHEN T+ 
Sbjct:    1 MPHKLGFVVVSSSGHEDGFSAKELMVHAPTVSGWRSPRFCQYPQEIIIQMVERCRIRKLQLLAHQYMISSKIEFYISESLPDYFVPYQSERFRRLGYVSLSDNEKTGYKARELKSVYVEAVGQYLKLIFHKNYSNRYNLYNQVALIAINIIGDPVDFNEESNMPSREKLIDQYLGNGSDDSALDASYTGRKLDAISPLDDLAFDMYQDPEVAQIIRKLDEKKQEAVRHERYDYAKKLKQAIADLQKVGERLGRYEVEKRCAVEKEDYDLAKQKKQQMEEYRQKVYQQLELHDLLDIAL-IRRGSETSLDPIESVSP---------QQHRALSPPQPEKERSTEKKP---KKEQPALFFPRSGHYFNLRHPILSQKCVFRSCIILLQVDALPYDERPLPAQRKNKEDSFSYLEPEVNEEPVLDTPRTRITGEPEPLTEKALREAGFAIEVFGEALVAGAYSKTWSYREDALIAVSKKLADIASGMSKDDLKNLLRAAMFLVRRAIKDKVTSVFQASLRLLKMIITDYIPKHKLGKGETTHCVEKCLPDLLVRTGDSTARHRLISSNFIQEMALFKEVKPLQIIPTHLVQPLKPTMPSRLAQSQVDLLENLLKELGVESSGFTVDNVMKFAVGALEYTISEVRDKAVQIILYLYKQHPSQVL-EYMPTEDSSARKNILYKTLFEGFAKIDG---------RPTDSELKAQKKKMAEEAERQKKE-----EIKALQEQLAALKEIQTEVQTGKS--------FADSNDFMASAYICSL-------------CIFCGERDESFTDEGLDLHYWKNCPMLKRCEHCKQVVEIASLTDHLLTECDQKDSFGKCQRCSEAIPKDVLLEHVKAKSCNAAKGEKVANHCPLCHENFTVA 841          
BLAST of Centrosomal protein 104 vs. Ensembl Xenopus
Match: slc11a1 (solute carrier family 11 member 1 [Source:Xenbase;Acc:XB-GENE-482302])

HSP 1 Score: 496.508 bits (1277), Expect = 4.921e-161
Identity = 319/891 (35.80%), Postives = 502/891 (56.34%), Query Frame = 3
Query:   42 MPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNAKFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIGDEL-------FSVNKDEIENFNG-------------PLQQDYISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQXXXXXXXXXXXXXXXASDNENYDRAKVKKQQIDQYRHRIYKELDALEFLNMPVNLQKPALKFEKPI--VEPELYSQRGYNQNNNALIAEEPRMYPNPEDRP---LPALKNQPI-------EVLPSQRNDFR---------------EPIP------EKSFI-----ASPEPALFTGDEIDSEEINAMTKSDLSEASEAIEVYGLPLVSKVYSKNWTHQENALLEIEKRLTEMPSDMDKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKXXXXXXXXXXGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYSIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDGINPFVNKNNKINDQESARQKELDNNQVEQKPKEPVRTKPVKQLNKKQSIHPNIQKEPQSSRTAQQKPSQQISAPAPAHA-SGNLAKLELQDDPTLDW---NTTCIFCGEKNESLKD-NMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPA-DQKNSIRCPLCHENITLG 2522
            MPHKL F V+ ++  ED   A E+  H PT  GW+S  FC YPQ+I+I +  RC+I+K+QLL+HQ +I++KIEF++ +   +      + +F RLGYVSLSDNEKT +KARELKSV+V+A+ +++KL+ H N+ N++N YNQV +IA+N+IGD +           +  I+ + G               + D IS  +DLAFD+  DPE AQIIR L++ K +AV  E++D A K++  +  LQ+VGE+LG+ E+EK+ A + E+YD AK KKQQ+++YR ++Y++L+  + L++ + +++ +     PI  V P         Q + AL   +P    + E +P    PA+  +P          + SQ+  FR                P+P      E SF       + EP L T     + E   +T+  L EA  AIEV+G  LV+  YSK W+++E+AL+ + K+L ++ S M KDD+K  +RA   L+++A K +VT V Q +  + K+++ + + +  + K E  + ++K +P++     D+ A+ R I+ N++ EM+ +  V+    I +  ++P  P + +R  Q +++LL  L     + +  FT+DN MK+AV AL++  +E+R+ A  +I+ LY+    +V+  Y+P +D   RKN+LYK LFE   KIDG         +  D E    +     + E++ KE      +K L ++ +    IQ E Q+ +          S P    + +G   K+ L       +   +  CIFCGE++ES  D  +DLHYWKNCP+L+RC +CKQ VEI+SLT H L EC+Q+  FG+C RC+EAI K  L +H+    CN A  +K +  CPLCHEN T+ 
Sbjct:    1 MPHKLGFVVVSSSGHEDGFSAKELMVHAPTVSGWRSPRFCQYPQEIIIQMVERCRIRKLQLLAHQYMISSKIEFYISESLPDYFVPYQSERFRRLGYVSLSDNEKTGYKARELKSVYVEAVGQYLKLIFHKNYSNRYNLYNQVALIAINIIGDPVDFNEESNMPSREKLIDQYLGNGSDDSALDASYTGRKLDAISPLDDLAFDMYQDPEVAQIIRKLDEKKQEAVRHERYDYAKKLKQAIADLQKVGERLGRYEVEKRCAVEKEDYDLAKQKKQQMEEYRQKVYQQLELHDLLDIAL-IRRGSETSLDPIESVSP---------QQHRALSPPQPEKERSTEKKPKKEQPAVTEKPSGHYFNLRHPILSQKCVFRSCIILLQVDALPYDERPLPAQRKNKEDSFSYLEPEVNEEPVLDTPRTRITGEPEPLTEKALREAGFAIEVFGEALVAGAYSKTWSYREDALIAVSKKLADIASGMSKDDLKNLLRAAMFLVRRAIKDKVTSVFQASLRLLKMIITDYIPKHKLGKGETTHCVEKCLPDLLVRTGDSTARHRLISSNFIQEMALFKEVKPLQIIPTHLVQPLKPTMPSRLAQSQVDLLENLLKELGVESSGFTVDNVMKFAVGALEYTISEVRDKAVQIILYLYKQHPSQVL-EYMPTEDSSARKNILYKTLFEGFAKIDG---------RPTDSELKVCRYKMAEEAERQKKE-----EIKALQEQLAALKEIQTEVQTGKVLS---CSLASWPLFNQSVAGGKVKVSLWLVCVASYVRLDHLCIFCGERDESFTDEGLDLHYWKNCPMLKRCEHCKQVVEIASLTDHLLTECDQKDSFGKCQRCSEAIPKDVLLEHVKAKSCNAAKGEKVANHCPLCHENFTVA 863          
BLAST of Centrosomal protein 104 vs. Ensembl Xenopus
Match: slc11a1 (solute carrier family 11 member 1 [Source:Xenbase;Acc:XB-GENE-482302])

HSP 1 Score: 492.656 bits (1267), Expect = 4.556e-160
Identity = 309/869 (35.56%), Postives = 490/869 (56.39%), Query Frame = 3
Query:   42 MPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNAKFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIG------------------DELFSVNKDEI---ENFNGPLQQDYISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQXXXXXXXXXXXXXXXASDNENYDRAKVKKQQIDQYRHRIYKELDALEFLNMPVNLQKPALKFEKPI--VEPELYSQRGYNQNNNALIAEEPRMYPNPEDRP---LPALKNQPIEV---------------------------------LPSQRNDFREPIPEKSFIASPEPALFTGDEIDSEEINAMTKSDLSEASEAIEVYGLPLVSKVYSKNWTHQENALLEIEKRLTEMPSDMDKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKXXXXXXXXXXGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYSIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDGINPFVNKNNKINDQESARQKELDNNQVEQKPKEPVRTKPVKQLNKKQSIHPNIQKEPQSSRTAQQKPSQQISAPAPAHASGN--LAKLELQDDPTLDWNTTCIFCGEKNESLKD-NMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCN 2462
            MPHKL F V+ ++  ED   A E+  H PT  GW+S  FC YPQ+I+I +  RC+I+K+QLL+HQ +I++KIEF++ +   +      + +F RLGYVSLSDNEKT +KARELKSV+V+A+ +++KL+ H N+ N++N YNQV +IA+N+IG                  D+      D+     ++ G L  D IS  +DLAFD+  DPE AQIIR L++ K +AV  E++D A K++  +  LQ+VGE+LG+ E+EK+ A + E+YD AK KKQQ+++YR ++Y++L+  + L++ + +++ +     PI  V P         Q + AL   +P    + E +P    PA+  +P +V                                 LP+QR +  +         + EP L T     + E   +T+  L EA  AIEV+G  LV+  YSK W+++E+AL+ + K+L ++ S M KDD+K  +RA   L+++A K +VT V Q +  + K+++ + + +  + K E  + ++K +P++     D+ A+ R I+ N++ EM+ +  V+    I +  ++P  P + +R  Q +++LL  L     + +  FT+DN MK+AV AL++  +E+R+ A  +I+ LY+    +V+  Y+P +D   RKN+LYK LFE   KIDG         +  D E   QK+    + E++ KE      +K L ++ +    IQ E Q+ ++A + P       +P  A  N  +A   +         + CIFCGE++ES  D  +DLHYWKNCP+L+RC +CKQ VEI+SLT H L EC+Q+  FG+C RC+EAI K  L +H+    CN
Sbjct:    1 MPHKLGFVVVSSSGHEDGFSAKELMVHAPTVSGWRSPRFCQYPQEIIIQMVERCRIRKLQLLAHQYMISSKIEFYISESLPDYFVPYQSERFRRLGYVSLSDNEKTGYKARELKSVYVEAVGQYLKLIFHKNYSNRYNLYNQVALIAINIIGDPVDFNEESNMPSREKLIDQYLGNGSDDSALDASYTGKL--DAISPLDDLAFDMYQDPEVAQIIRKLDEKKQEAVRHERYDYAKKLKQAIADLQKVGERLGRYEVEKRCAVEKEDYDLAKQKKQQMEEYRQKVYQQLELHDLLDIAL-IRRGSETSLDPIESVSP---------QQHRALSPPQPEKERSTEKKPKKEQPAVTEKPPKVLSPKPILESRRSPSPPPAASPALVDALPYDERPLPAQRKNKEDSFSYLEPEVNEEPVLDTPRTRITGEPEPLTEKALREAGFAIEVFGEALVAGAYSKTWSYREDALIAVSKKLADIASGMSKDDLKNLLRAAMFLVRRAIKDKVTSVFQASLRLLKMIITDYIPKHKLGKGETTHCVEKCLPDLLVRTGDSTARHRLISSNFIQEMALFKEVKPLQIIPTHLVQPLKPTMPSRLAQSQVDLLENLLKELGVESSGFTVDNVMKFAVGALEYTISEVRDKAVQIILYLYKQHPSQVL-EYMPTEDSSARKNILYKTLFEGFAKIDG---------RPTDSELKAQKKKMAEEAERQKKE-----EIKALQEQLAALKEIQTEVQTGKSA-RAPIADKRGTSPFFADSNDFMASAYI--------CSLCIFCGERDESFTDEGLDLHYWKNCPMLKRCEHCKQVVEIASLTDHLLTECDQKDSFGKCQRCSEAIPKDVLLEHVKAKSCN 833          
BLAST of Centrosomal protein 104 vs. Ensembl Mouse
Match: Cep104 (centrosomal protein 104 [Source:MGI Symbol;Acc:MGI:2687282])

HSP 1 Score: 485.337 bits (1248), Expect = 2.238e-156
Identity = 322/916 (35.15%), Postives = 497/916 (54.26%), Query Frame = 3
Query:   42 MPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNAKFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIGDELFSVNKDEIEN------------------------FNGPLQQDYISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQXXXXXXXXXXXXXXXASDNENYDRAKVKKQQIDQYRHRIYKELDALEFLNMPVNLQKPALKFEKPIVEP---ELYSQRGYNQNNNALIAEEPRMYPNPEDRPL-------------PALKNQP---IEVLPSQRNDFREPIPEKSFI-ASPEPALFTGDEIDSE--------EINAMTKSDLSEASEAIEVYGLPLVSKVYSKNWTHQENALLEIEKRLTEMPSDMDKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKXXXXXXXXXXGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYSIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDG----INPFVNKNNKINDQESARQKELDNNQVEQKPKEPVRTKPVKQLNKKQSIHPNIQKEPQSSRTAQQKPSQQISAPAPAHASGNLAKLELQDDPTLDWN----TTCIFCGEKNESL-KDNMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPAD-QKNSIRCPLCHENITLGQFVDSPEALWQYHLMDETNGCPQNPRR 2603
            MPHK+ F V+ ++  ED   A E+  H PT  GW+S  FC +PQ+IV+ +  RC+++K+QLL+HQ +I++K+EF++ +            +F RLGYVSL DNEKT  KARELKSV+VDA+ +F+KL+ H N  NK+N YNQV ++A+N+IGD     ++  I +                        F+G  + DYIS  +DLAFD+  DPE AQIIR L++ K +AV++E++D A K++  +  LQ+VGE+LG+ E+EK+ A + E+YD AK KKQQ+ +YR ++Y++L+    L     +Q+P     +P+  P   + +           L+AE+    P  +++P              PA  + P    EVLP        P+  K    AS E  +    E DS+        E   +T+  L EAS AI+  G  LV+  YSK W+ +E+ALL + K+L EMP    K+D+K  +RA+  L+++A K  V  V Q +  + K+++ + + +  + K +  + +++  P +     D+ A++R +  N++ EM+ +  V+    I S  ++P   N        +++LL  L       +  FT+DN MK+AV AL+H+  E+RE+A  +I+ +YR +   +   +LPPDD  TR+N+LYK +FE   KIDG        V    ++  +E+ +QK+ +   ++ +  E   T+   Q           +KE ++ +   Q P  +              K  L D P +  N      CIFCGE+NES  ++ +DLHYWK+C +L RC +C+Q VEISSLT+H L EC++   FG+CPRC+EAI K EL  HI    C+PA  +K +  CPLCHEN   G      E  W+ HLM    GC  N R+
Sbjct:    1 MPHKIGFVVVSSSGHEDGFSARELMIHAPTVSGWRSPKFCQFPQEIVLQMVERCRVRKLQLLAHQYMISSKVEFYISESLPEYLVPYQAERFRRLGYVSLCDNEKTGCKARELKSVYVDAVGQFLKLIFHQNHANKYNIYNQVALVAINIIGDPADLGDESNITSREKLIDHYLGHSPHNPEDPALDGTFSG--RSDYISPLDDLAFDMYQDPEVAQIIRRLDERKREAVKKERYDHAKKLKQAIADLQKVGERLGRYEVEKRCAVEKEDYDLAKEKKQQMARYRAQVYEQLELHGLLQGEPEMQRPFALPLQPLASPSSPQHWKAVSSLPRTEKLVAEDSFAGPVLQEKPSASSPQHSAVDPSPPAAGHAPRSHTEVLPYDERPL--PVTRKQLGEASAEAEV---KEADSDVRRRGVAGEPEPLTEKALREASAAIDTLGEALVAGAYSKMWSCREDALLALYKKLMEMPVGTQKEDLKNMLRASVFLIRRAIKDIVASVFQASLKLLKMIITQYIPKHKLGKLDTTHCVERAFPLLLARAGDSSARLRVMALNFIQEMALFKEVKSLQLIPSYLVQPLKANASVHLAMSQVDLLARLLRDLGTESSGFTVDNVMKFAVSALEHRVYEVRETAVRIILDMYR-QHPALTLEHLPPDDSATRRNLLYKAIFEGFAKIDGSVLPTEAEVRAQKRVATKEAEKQKKEEMKALQGQSGELRETQAGVQ-----------EKESEAVKLRNQDPQGR--------------KAVLPDTPEIPANHFLDNLCIFCGERNESFTEEGLDLHYWKHCLMLTRCDHCRQVVEISSLTEHLLTECDRRDGFGKCPRCSEAIPKEELPGHIKTKECSPAKPEKVANHCPLCHENFAPG------EEAWKVHLMGPA-GCTMNLRK 876          
BLAST of Centrosomal protein 104 vs. Ensembl Mouse
Match: Cep104 (centrosomal protein 104 [Source:MGI Symbol;Acc:MGI:2687282])

HSP 1 Score: 268.085 bits (684), Expect = 4.816e-79
Identity = 170/491 (34.62%), Postives = 267/491 (54.38%), Query Frame = 3
Query: 1161 MTKSDLSEASEAIEVYGLPLVSKVYSKNWTHQENALLEIEKRLTEMPSDMDKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKXXXXXXXXXXGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYSIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDG-INPF---VNKNNKINDQESARQKELDNNQVEQKPKEPVRTKPVKQLNKKQSIHPNIQKEPQSSRTAQQKPSQQISAPAPAHASGNLAKLELQDDPTLDWN----TTCIFCGEKNESL-KDNMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPAD-QKNSIRCPLCHENITLGQFVDSPEALWQYHLMDETNGCPQNPRR 2603
            +T+  L EAS AI+  G  LV+  YSK W+ +E+ALL + K+L EMP    K+D+K  +RA+  L+++A K  V  V Q +  + K+++ + + +  + K +  + +++  P +     D+ A++R +  N++ EM+ +  V+    I S  ++P   N        +++LL  L       +  FT+DN MK+AV AL+H+  E+RE+A  +I+ +YR +   +   +LPPDD  TR+N+LYK +FE   KIDG + P    V    ++  +E+ +QK+ +   ++ +  E   T+   Q           +KE ++ +   Q P  +              K  L D P +  N      CIFCGE+NES  ++ +DLHYWK+C +L RC +C+Q VEISSLT+H L EC++   FG+CPRC+EAI K EL  HI    C+PA  +K +  CPLCHEN   G      E  W+ HLM    GC  N R+
Sbjct:   26 LTEKALREASAAIDTLGEALVAGAYSKMWSCREDALLALYKKLMEMPVGTQKEDLKNMLRASVFLIRRAIKDIVASVFQASLKLLKMIITQYIPKHKLGKLDTTHCVERAFPLLLARAGDSSARLRVMALNFIQEMALFKEVKSLQLIPSYLVQPLKANASVHLAMSQVDLLARLLRDLGTESSGFTVDNVMKFAVSALEHRVYEVRETAVRIILDMYR-QHPALTLEHLPPDDSATRRNLLYKAIFEGFAKIDGSVLPTEAEVRAQKRVATKEAEKQKKEEMKALQGQSGELRETQAGVQ-----------EKESEAVKLRNQDPQGR--------------KAVLPDTPEIPANHFLDNLCIFCGERNESFTEEGLDLHYWKHCLMLTRCDHCRQVVEISSLTEHLLTECDRRDGFGKCPRCSEAIPKEELPGHIKTKECSPAKPEKVANHCPLCHENFAPG------EEAWKVHLMGPA-GCTMNLRK 483          
BLAST of Centrosomal protein 104 vs. UniProt/SwissProt
Match: sp|O60308|CE104_HUMAN (Centrosomal protein of 104 kDa OS=Homo sapiens OX=9606 GN=CEP104 PE=1 SV=1)

HSP 1 Score: 522.316 bits (1344), Expect = 1.256e-169
Identity = 340/928 (36.64%), Postives = 516/928 (55.60%), Query Frame = 3
Query:   42 MPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNA-KFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIGD------ELFSVNKDE-IENFNG------------PLQQDYISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQXXXXXXXXXXXXXXXASDNENYDRAKVKKQQIDQYRHRIYKELDA-----LEFLNMPVNLQKPALK------FEKPIVE-PELYSQRGYNQNNNALIAEEPRMY-------------------PNP---------EDRPLPALKNQPIEVL--PSQRNDFREPIPEKSFIASPEPALFTGDEIDSEEINAMTKSDLSEASEAIEVYGLPLVSKVYSKNWTHQENALLEIEKRLTEMPSDMDKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKXXXXXXXXXXGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYSIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDGINPFVNKNNKINDQE-SARQKELDNNQVEQKPKEPVRTKPVKQLNKKQSIHPNIQKEPQSSRTAQQKPSQ---QISAPAPAHASGNLAKLELQDDPTLDWNTTCIFCGEKNESL-KDNMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPAD-QKNSIRCPLCHENITLGQFVDSPEALWQYHLMDETNGCPQNPRRLVAIQR 2621
            MPHK+ F V+ ++  ED   A E+  H PT  GW+S  FC +PQ+IV+ +  RC+I+K+QLL+HQ +I++KIEF++ +      F+P  A +F RLGYVSL DNEKT  KARELKSV+VDA+ +F+KL+ H N +NK+N YNQV ++A+N+IGD      E  + ++++ I+++ G              + DYIS  +DLAFD+  DPE AQIIR L++ K +AV++E++D A K++  +  LQ+VGE+LG+ E+EK+ A + E+YD AK KKQQ++QYR  +Y++L+       E +  P +L    L        +KP+   P+L  +   NQ     + E+P  Y                   P+P         ++RPLPA++    E +  P   N           +  PEP               +T+  L EAS AI+V G  LV++ Y K W+++E+ALL + K+L EMP    K+D+K  +RA+  L+++A K  VT V Q +  + K+++ + + +  ++K E  + +++ IP +     D+ A++R    N++ EM+ +  V+    I S  ++P   N        ++ LL  L       +  FT+DN MK++V AL+H+  E+RE+A  +I+ +YR     ++  YLPPDD  TR+N+LYK +FE   KIDG         +  D E  AR+K       +QK       + +K L  + +    IQ E Q   +   KP     Q    APA A G      + D+  LD    CIFCGE++ES  ++ +DLHYWK+C +L RC +CKQ VEISSLT+H L EC+++  FG+C RC+EA+ K EL +HI    CNPA  +K + RCPLCHEN + G      E  W+ HLM    GC  N R+   +Q+
Sbjct:    1 MPHKIGFVVVSSSGHEDGFSARELMIHAPTVSGWRSPRFCQFPQEIVLQMVERCRIRKLQLLAHQYMISSKIEFYISESLPEY-FAPYQAERFRRLGYVSLCDNEKTGCKARELKSVYVDAVGQFLKLIFHQNHVNKYNIYNQVALVAINIIGDPADFSDESNTASREKLIDHYLGHNSEDPALEGTYARKSDYISPLDDLAFDMYQDPEVAQIIRKLDERKREAVQKERYDYAKKLKQAIADLQKVGERLGRYEVEKRCAVEKEDYDLAKEKKQQMEQYRAEVYEQLELHSLLDAELMRRPFDLPLQPLARSGSPCHQKPMPSLPQLEERGTENQFAEPFLQEKPSSYSLTISPQHSAVDPLLPATDPHPKINAESLPYDERPLPAIRKHYGEAVVEPEMSNADISDARRGGMLGEPEP---------------LTEKALREASSAIDVLGETLVAEAYCKTWSYREDALLALSKKLMEMPVGTPKEDLKNTLRASVFLVRRAIKDIVTSVFQASLKLLKMIITQYIPKHKLSKLETAHCVERTIPVLLTRTGDSSARLRVTAANFIQEMALFKEVKSLQIIPSYLVQPLKANSSVHLAMSQMGLLARLLKDLGTGSSGFTIDNVMKFSVSALEHRVYEVRETAVRIILDMYRQHQASIL-EYLPPDDSNTRRNILYKTIFEGFAKIDG---------RATDAEMRARRKAATEEAEKQK------KEEIKALQGQLAALKEIQAEVQEKESDAVKPKNQDIQGGKAAPAEALG------IPDEHYLD--NLCIFCGERSESFTEEGLDLHYWKHCLMLTRCDHCKQVVEISSLTEHLLTECDKKDGFGKCYRCSEAVFKEELPRHIKHKDCNPAKPEKLANRCPLCHENFSPG------EEAWKAHLMGPA-GCTMNLRKTHILQK 881          
BLAST of Centrosomal protein 104 vs. UniProt/SwissProt
Match: sp|D3Z8X7|CE104_RAT (Centrosomal protein of 104 kDa OS=Rattus norvegicus OX=10116 GN=Cep104 PE=2 SV=3)

HSP 1 Score: 488.419 bits (1256), Expect = 9.705e-157
Identity = 324/918 (35.29%), Postives = 499/918 (54.36%), Query Frame = 3
Query:   42 MPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNAKFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIGDEL-------FSVNKDEIENFNG---------------PLQQDYISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQXXXXXXXXXXXXXXXASDNENYDRAKVKKQQIDQYRHRIYKELDALEFLNMPVNLQKPALKFEKPIVEP----------------ELYSQR------------GYNQNNNALIAEEPRMYPNP---------EDRPLPALKNQPIEVLPSQRNDFREP---IPEKSFIASPEPALFTGDEIDSEEINAMTKSDLSEASEAIEVYGLPLVSKVYSKNWTHQENALLEIEKRLTEMPSDMDKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKXXXXXXXXXXGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYSIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDGINPFVNKNNKINDQESARQKELDNNQVEQKPKEPVRTKPVKQLNKKQSIHPNIQKEPQSSRTAQQKPSQQISAPAPAHASGNLAKLELQDDPTLDWNTTCIFCGEKNESL-KDNMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPA-DQKNSIRCPLCHENITLGQFVDSPEALWQYHLMDETNGCPQNPRR 2603
            MPHK+ F V+ ++  ED   A E+  H PT  GW+S  FC +PQ+IV+ +  RC+I+K+QLL+HQ +I++K+EF++ +            +F RLGYVSL DNEKT  KARELKSV+VDA+ +F+KL+ H    NK+N  NQV ++A+N+IGD          +  +  I+++ G                 + DYIS  +DLAFD+  DPE AQIIR L++ K +A ++E++D A K++  +  LQ+VGE+LG+ E+EK+ A + E+YD AK KKQQ+ +YR ++Y++L+    L     +Q+P     +P+  P                EL ++               +  ++A+    P   P P         ++RPLP  + Q  E  PS   + RE    +  +   A PEP               +T+  L EAS AI+  G  LV+  YSK W+ +E+ALL + KRL EMP    K+D+K  +RA+  L+++A K  VT V Q +  + K+++ + + +  + K +  Y +++ IP +     D+ A++R +  N++ EM+ +  VR    I S  ++P   N        +++LL  L          FT+DN MK+AV AL+H+  E+RE+A  +I+ +YR +   +   +LPPDD  TR+N+LYK +FE   KIDG         +  + E   QK +   + E++ KE  +         +++     +KE ++ +   Q P  + +AP            E+ D+  LD    CIFCGE+NES  ++ +DLHYWK+C +L RC +C+Q VEISSLT+H L EC++   FG+CPRC+EA+ K EL +HI    CNPA  +K + RCPLCHEN   G      E  W+ HLM  + GC  N R+
Sbjct:    1 MPHKIGFVVVSSSGHEDGFSARELMIHAPTVSGWRSPKFCQFPQEIVLQMVERCRIRKLQLLAHQYMISSKVEFYISESLPEYLVPYQAERFRRLGYVSLCDNEKTGCKARELKSVYVDAVGQFLKLIFHQT-TNKYN-VNQVALVAINIIGDPADLGDESNTTCREKLIDHYLGHSPHNPEDPALDGTFAGRSDYISPLDDLAFDMYQDPEVAQIIRRLDERKREAAKKERYDHAKKLKQAIADLQKVGERLGRYEVEKRRAVEKEDYDLAKEKKQQMARYRAQVYEQLELHGLLQGEPEMQRPFALPLQPLASPSSPQHWKAVSSLPRTEELAAEDTCAGPILQEKPLASSPRHSAVDRSPPAAGPAPRSHVEALPYDERPLPVTRKQLEE--PSAEPEVREADSDVRRRGVSAEPEP---------------LTEKALREASSAIDTLGEALVAGAYSKMWSCREDALLALYKRLMEMPVGTQKEDLKNMLRASVFLIRRAIKDIVTSVFQASLKLLKMIITQYIPKHKLGKLDTTYCVERAIPLLLARTGDSSARLRVMALNFIQEMALFKEVRSLQLIPSYLVQPLKTNASVHLAMSQVDLLARLLRDLGTEGSGFTVDNVMKFAVSALEHRVYEVRETAVRIILDMYR-QHPALTLEHLPPDDSTTRRNLLYKAIFEGFAKIDG---------RPTEAEGKTQKRVVTKEAEKQKKEETKALQGLSAAPRETQAGVQEKENEAVKLKNQDPQGRKAAPPDTP--------EIPDNHYLD--NLCIFCGERNESFTEEGLDLHYWKHCLMLTRCDHCRQVVEISSLTEHLLTECDKRDGFGKCPRCSEAVPKEELPRHIKTKECNPAKSEKVANRCPLCHENFAPG------EEAWKVHLMG-SAGCTMNLRK 872          
BLAST of Centrosomal protein 104 vs. UniProt/SwissProt
Match: sp|Q80V31|CE104_MOUSE (Centrosomal protein of 104 kDa OS=Mus musculus OX=10090 GN=Cep104 PE=1 SV=1)

HSP 1 Score: 485.337 bits (1248), Expect = 1.565e-155
Identity = 322/916 (35.15%), Postives = 497/916 (54.26%), Query Frame = 3
Query:   42 MPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNAKFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIGDELFSVNKDEIEN------------------------FNGPLQQDYISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQXXXXXXXXXXXXXXXASDNENYDRAKVKKQQIDQYRHRIYKELDALEFLNMPVNLQKPALKFEKPIVEP---ELYSQRGYNQNNNALIAEEPRMYPNPEDRPL-------------PALKNQP---IEVLPSQRNDFREPIPEKSFI-ASPEPALFTGDEIDSE--------EINAMTKSDLSEASEAIEVYGLPLVSKVYSKNWTHQENALLEIEKRLTEMPSDMDKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKXXXXXXXXXXGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYSIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDG----INPFVNKNNKINDQESARQKELDNNQVEQKPKEPVRTKPVKQLNKKQSIHPNIQKEPQSSRTAQQKPSQQISAPAPAHASGNLAKLELQDDPTLDWN----TTCIFCGEKNESL-KDNMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPAD-QKNSIRCPLCHENITLGQFVDSPEALWQYHLMDETNGCPQNPRR 2603
            MPHK+ F V+ ++  ED   A E+  H PT  GW+S  FC +PQ+IV+ +  RC+++K+QLL+HQ +I++K+EF++ +            +F RLGYVSL DNEKT  KARELKSV+VDA+ +F+KL+ H N  NK+N YNQV ++A+N+IGD     ++  I +                        F+G  + DYIS  +DLAFD+  DPE AQIIR L++ K +AV++E++D A K++  +  LQ+VGE+LG+ E+EK+ A + E+YD AK KKQQ+ +YR ++Y++L+    L     +Q+P     +P+  P   + +           L+AE+    P  +++P              PA  + P    EVLP        P+  K    AS E  +    E DS+        E   +T+  L EAS AI+  G  LV+  YSK W+ +E+ALL + K+L EMP    K+D+K  +RA+  L+++A K  V  V Q +  + K+++ + + +  + K +  + +++  P +     D+ A++R +  N++ EM+ +  V+    I S  ++P   N        +++LL  L       +  FT+DN MK+AV AL+H+  E+RE+A  +I+ +YR +   +   +LPPDD  TR+N+LYK +FE   KIDG        V    ++  +E+ +QK+ +   ++ +  E   T+   Q           +KE ++ +   Q P  +              K  L D P +  N      CIFCGE+NES  ++ +DLHYWK+C +L RC +C+Q VEISSLT+H L EC++   FG+CPRC+EAI K EL  HI    C+PA  +K +  CPLCHEN   G      E  W+ HLM    GC  N R+
Sbjct:    1 MPHKIGFVVVSSSGHEDGFSARELMIHAPTVSGWRSPKFCQFPQEIVLQMVERCRVRKLQLLAHQYMISSKVEFYISESLPEYLVPYQAERFRRLGYVSLCDNEKTGCKARELKSVYVDAVGQFLKLIFHQNHANKYNIYNQVALVAINIIGDPADLGDESNITSREKLIDHYLGHSPHNPEDPALDGTFSG--RSDYISPLDDLAFDMYQDPEVAQIIRRLDERKREAVKKERYDHAKKLKQAIADLQKVGERLGRYEVEKRCAVEKEDYDLAKEKKQQMARYRAQVYEQLELHGLLQGEPEMQRPFALPLQPLASPSSPQHWKAVSSLPRTEKLVAEDSFAGPVLQEKPSASSPQHSAVDPSPPAAGHAPRSHTEVLPYDERPL--PVTRKQLGEASAEAEV---KEADSDVRRRGVAGEPEPLTEKALREASAAIDTLGEALVAGAYSKMWSCREDALLALYKKLMEMPVGTQKEDLKNMLRASVFLIRRAIKDIVASVFQASLKLLKMIITQYIPKHKLGKLDTTHCVERAFPLLLARAGDSSARLRVMALNFIQEMALFKEVKSLQLIPSYLVQPLKANASVHLAMSQVDLLARLLRDLGTESSGFTVDNVMKFAVSALEHRVYEVRETAVRIILDMYR-QHPALTLEHLPPDDSATRRNLLYKAIFEGFAKIDGSVLPTEAEVRAQKRVATKEAEKQKKEEMKALQGQSGELRETQAGVQ-----------EKESEAVKLRNQDPQGR--------------KAVLPDTPEIPANHFLDNLCIFCGERNESFTEEGLDLHYWKHCLMLTRCDHCRQVVEISSLTEHLLTECDRRDGFGKCPRCSEAIPKEELPGHIKTKECSPAKPEKVANHCPLCHENFAPG------EEAWKVHLMGPA-GCTMNLRK 876          
BLAST of Centrosomal protein 104 vs. TrEMBL
Match: A0A1I8IIY9 (UVR domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022803g1 PE=4 SV=1)

HSP 1 Score: 623.239 bits (1606), Expect = 0.000e+0
Identity = 370/897 (41.25%), Postives = 539/897 (60.09%), Query Frame = 3
Query:   42 MPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNAKFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIGDELFS-------VNKDEIENFNGPLQQDYISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQXXXXXXXXXXXXXXXASDNENYDRAKVKKQQIDQYRHRIYKELDALEFLNMPVNLQKPALKF------------EKPIVEPELYSQRGYNQNNNALIAEEPRMYPNPEDRPLPALKNQPIEVLPSQRNDFREPIPEKSFIASPEPALFTGDEIDSEEINAMTKSDLSEASEAIEVYGLPLVSKVYSKNWTHQENALLEIEKRLTEMPSDMDKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKXXXXXXXXXXGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYSIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDGINPFVNKNNKINDQESARQKELDNNQVEQKPKEPVRTKPVKQLNKKQSIHPNIQKEPQSSRTAQQKPSQQISAPAPAHASGNLAKLE-----------LQDDP----TLDWNTTCIFCGEK--NESLKDNMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPADQKNSIRCPLCHENITLGQFVDSPEALWQYHLMDETNGCPQNPRRLVAIQRQ 2624
            MP KLP RV+H + Q++ + A E++ H+PT++GW S+ FCLYPQD+V+ LE R +I+K+Q+LSHQ LIA+KIEFFVGD P+ V  +  NA+++RLGYV+LSDNEKT F+ARELKSVHVDA+  ++KLV+H N++NK N YNQVG++AVNLIGD L+S        +K   +   GP   DYIS  +DLAFD+  D E A +IR LE  K  AV  EQF+ A ++RD V  LQ VGEKLGKLE+EK+ A +NE+Y+RA +KK Q+D+YR +IY+ELD    L          L                P++EP + ++R  +    +          + +DRPLPALK+Q       Q      P+PE    A        G  I  E  N +T+ D+ EAS  I+++GLPLV+K +SK W+H+E+ALL+  K++ EM S  D+ D +   RA   L ++  + +V  V + A ++NKL+L +  +R  I + E+ Y  D+++P + +   D   ++R+ ++ YL+EMSQW H+R    +  E +KPF P+   R G  ++++   LY  H L++   TLD  M +AV AL H+  ++RESAE+LIV LY+ +DK VVRS+LPPDD +TR+N LY++LFE  D++DG  P   +  +  + +  + +EL   Q E      +R    +Q   K+    +    P SSR A  KP+   + PA A       + +           ++D+P     +D +  CIFC EK    S +  M++H+WK+CP+L+RC  C+Q VEI+ L++H L ECE  ++F +CP CTEAI   E +QH+ D LCN A +  S  CPLCHEN   G      +  W+ HL   ++GC QNPRRL+A+ R+
Sbjct:    1 MPSKLPIRVVHVSGQDEGYPAIELNRHSPTTRGWVSSRFCLYPQDLVVYLEQRSRIRKVQILSHQYLIASKIEFFVGDVPDGVSHNLQNARYSRLGYVALSDNEKTGFRARELKSVHVDAVGVYLKLVIHKNYVNKHNLYNQVGLVAVNLIGDPLYSPMDIVSRPDKAPDDRVFGP---DYISPLDDLAFDMYQDREIADVIRKLEARKHDAVLSEQFELAKRLRDAVLQLQRVGEKLGKLEVEKRQAVENEDYERANLKKIQMDEYRLQIYRELDVAGLLAGRAPFDSAPLSMPPAAAARRSSPPPPPLLEP-IGARRSPSPPPQSSYRPAVAYSTDYDDRPLPALKHQ-------QTGGSHTPLPEDDDGAG-------GAGITGEPEN-LTEKDMREASAVIDMFGLPLVTKAFSKTWSHREDALLDAYKQVNEM-SAQDERDPRQVFRAGVYLCQRGVQDKVFSVFRAALSLNKLLLTDFTQRHSIQRHEIQYACDRVLPGLLQKTGDTAPRMRDTSKQYLVEMSQWAHLRPLQAVPHECLKPFKPSAHERLGVGRVDVAAALYRQHGLSDG-VTLDGLMTFAVKALDHRHGDVRESAESLIVELYKQQDKAVVRSHLPPDDERTRRNTLYRKLFEAFDRVDGKQPRAAQQQQQEEAQQRQIEELKRQQKE------LRELAAQQQQAKEKPKQD-SAAPPSSRKA--KPAGGKAKPANASEQQPPQEQQEQPQQQETPRNIEDEPVPKLAVDDDEACIFCDEKVQGGSTEQGMEVHFWKSCPMLKRCTSCRQVVEIAMLSEHLLNECEHSAEFRKCPYCTEAIPVAEHEQHVRDNLCNHAVEGQS-HCPLCHENFPTG------DDGWKEHLTG-SDGCKQNPRRLIALNRK 859          
BLAST of Centrosomal protein 104 vs. TrEMBL
Match: A0A1I8GJZ3 (UVR domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022803g3 PE=4 SV=1)

HSP 1 Score: 620.542 bits (1599), Expect = 0.000e+0
Identity = 370/897 (41.25%), Postives = 538/897 (59.98%), Query Frame = 3
Query:   42 MPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNAKFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIGDELFS-------VNKDEIENFNGPLQQDYISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQXXXXXXXXXXXXXXXASDNENYDRAKVKKQQIDQYRHRIYKELDALEFLNMPVNLQKPALKF------------EKPIVEPELYSQRGYNQNNNALIAEEPRMYPNPEDRPLPALKNQPIEVLPSQRNDFREPIPEKSFIASPEPALFTGDEIDSEEINAMTKSDLSEASEAIEVYGLPLVSKVYSKNWTHQENALLEIEKRLTEMPSDMDKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKXXXXXXXXXXGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYSIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDGINPFVNKNNKINDQESARQKELDNNQVEQKPKEPVRTKPVKQLNKKQSIHPNIQKEPQSSRTAQQKPSQQISAPAPAHASGNLAKLE-----------LQDDP----TLDWNTTCIFCGEK--NESLKDNMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPADQKNSIRCPLCHENITLGQFVDSPEALWQYHLMDETNGCPQNPRRLVAIQRQ 2624
            MP KLP RV+H + Q++ + A E++ H+PT++GW S+ FCLYPQD+V+ LE R +I+K+Q+LSHQ LIA+KIEFFVGD P+ V  +  NA+++RLGYV+LSDNEKT F+ARELKSVHVDA+  ++KLV+H N++NK N YNQVG++AVNLIGD L+S        +K   +   GP   DYIS  +DLAFD+  D E A +IR LE  K  AV  EQF+ A ++RD V  LQ VGEKLGKLE+EK+ A +NE+Y+RA +KK Q+D+YR +IY+ELD    L          L                P++EP + ++R  +    +          + +DRPLPALK+Q       Q      P+PE    A        G  I  E  N +T+ D+ EAS  I+++GLPLV+K +SK W+H+E+ALL+  K++ EM S  D+ D +   RA   L ++  + +V  V + A ++NKL+L +  +R  I + E+ Y  D+ +P + +   D   ++R+ ++ YL+EMSQW H+R    +  E +KPF P+   R G  ++++   LY  H L++   TLD  M +AV AL H+  ++RESAE+LIV LY+ +DK VVRS+LPPDD +TR+N LY++LFE  D++DG  P   +  +  + +  + +EL   Q E      +R    +Q   K+    +    P SSR A  KP+   + PA A       + +           ++D+P     +D +  CIFC EK    S +  M++H+WK+CP+L+RC  C+Q VEI+ L++H L ECE  ++F +CP CTEAI   E +QH+ D LCN A +  S  CPLCHEN   G      +  W+ HL   ++GC QNPRRL+A+ R+
Sbjct:    1 MPSKLPIRVVHVSGQDEGYPAIELNRHSPTTRGWVSSRFCLYPQDLVVYLEQRSRIRKVQILSHQYLIASKIEFFVGDVPDGVSHNLQNARYSRLGYVALSDNEKTGFRARELKSVHVDAVGVYLKLVIHKNYVNKHNLYNQVGLVAVNLIGDPLYSPMDIVSRPDKAPDDRVFGP---DYISPLDDLAFDMYQDREIADVIRKLEARKHDAVLAEQFELAKRLRDAVLQLQRVGEKLGKLEVEKRQAVENEDYERANLKKIQMDEYRLQIYRELDVAGLLAGRAPFDSAPLSMPPAAAARRSSPPPPPLLEP-IGARRSPSPPPQSSYRPAVAYSTDYDDRPLPALKHQ-------QTGGSHTPLPEDDDGAG-------GAGITGEPEN-LTEKDMREASAVIDMFGLPLVTKAFSKTWSHREDALLDAYKQVNEM-SAQDERDPRQVFRAGVYLCQRGVQDKVFSVFRAALSLNKLLLTDFTQRHSIQRHEIQYACDRGLPGLLQKTGDTAPRMRDTSKQYLVEMSQWAHLRPLQAVPHECLKPFKPSAHERLGVGRVDVAAALYRQHGLSDG-VTLDGLMTFAVKALDHRHGDVRESAESLIVELYKQQDKAVVRSHLPPDDERTRRNTLYRKLFEAFDRVDGKQPRAAQQQQQEEAQQRQIEELKRQQKE------LRELAAQQQQAKEKPKQD-SAAPPSSRKA--KPAGGKAKPANASEQQPPQEQQEQPQQQETPRNIEDEPVPKLAVDDDEACIFCDEKVQGGSTEQGMEVHFWKSCPMLKRCTSCRQVVEIAMLSEHLLNECEHSAEFRKCPYCTEAIPVAEHEQHVRDNLCNHAVEGQS-HCPLCHENFPTG------DDGWKEHLTG-SDGCKQNPRRLIALNRK 859          
BLAST of Centrosomal protein 104 vs. TrEMBL
Match: A0A210QD89 (UVR domain-containing protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT21203 PE=4 SV=1)

HSP 1 Score: 602.053 bits (1551), Expect = 0.000e+0
Identity = 353/888 (39.75%), Postives = 539/888 (60.70%), Query Frame = 3
Query:   42 MPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNAKFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIGDELFSVNKDEIENFN------GPLQQ----------DYISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQXXXXXXXXXXXXXXXASDNENYDRAKVKKQQIDQYRHRIYKELDALEFLNMPVNLQKPALKFEKPIVEPELYSQRGYNQNNNALIAEEPRMYPNPEDRPLPALKNQPIEVLPSQRNDFREPIPEKSFIASPEPALFTGDEIDSEEINAMTKSDLSEASEAIEVYGLPLVSKVYSKNWTHQENALLEIEKRLTEMPSDMDKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKXXXXXXXXXXGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELY-SIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNE--DKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDGINPFVNKNNKINDQESARQKELD--NNQVEQKPKEPVRTKPVKQLNKKQSIHPNIQKEPQSSRTAQQKPSQQISAPAPAHASGNLAKLELQDDPTLDWN--TTCIFCGEKNESL-KDNMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPADQKNSIRCPLCHENITLGQFVDSPEALWQYHLMDETNGCPQNPRRLVAIQRQHQQ 2633
            MP KLPFRV+H + Q+D +KA E++ H+P ++GWQ++ +CLYPQD+++ L+ R +++KIQ+LSHQ L+ATK+EF VGD P ++  SP NA++TRLGYVSLSDNEKT FK+RELKSVHVDAI  ++K++VH N INK+N YNQVG+IA+N+IGD + S   D  +++N      G L+           DYIS  +DLAFD+  DPE A +IR LEK K +AV +E+FD A K++  +  LQ+VGEKLGK E+EK+ A +NE+YD+AK+KK Q ++YR +IY +L+  + L    +     +  E P+  P        +             Y   ++RPLPA+K  P             P+ E+      E  + TG    + E   +++ DL EAS A++V+G PLV+K YSK W+++E+ALL + K+++EM +   KD+VK  ++    L K+A + +V  V +   ++ K++L E   +  + K E  + ++ ++PE+F    D  ++ R+  +N++ EM+ +  VR    +  E +KP    +  RP Q +LE++  LY S+    +   T+DN M + V AL H S ++R+ +E +I  LY+    D++ ++ +LPPDD +TRKN +Y++LFE  DK+DG     +   +  ++ES +Q+E++   NQ++Q     +R+        KQ +  N+ K    S+   +KP  + S P P             DD T  +N    CIFC E+N S  ++ +DLHYWKNCP+L+RC  CKQ VEI+S T+H + ECE +  + +CPRCTEAI K+E  QH++D  CNP++ + +  CPLCH+NI  G      E  W+ HLM + +GC QNPRRL+A+ +Q  Q
Sbjct:    1 MPRKLPFRVVHVSGQDDGYKAIELNVHSPLTRGWQASRYCLYPQDLILRLDARSRLRKIQVLSHQFLVATKLEFMVGDVPEDMDLSPDNARYTRLGYVSLSDNEKTAFKSRELKSVHVDAIGHYLKILVHKNHINKYNVYNQVGVIALNVIGD-IISRPSDLTDDYNTDPDKAGRLEYQDEEDLTSRPDYISPLDDLAFDMYQDPEIAALIRKLEKKKQEAVMQERFDYAKKLKTAILDLQKVGEKLGKFEVEKRQAVENEDYDKAKLKKVQCEEYRLQIYHDLNLGDLLETGGSRHPQHIDLE-PVRNPTPPRLTHLSPRTPPRTPPPRTPY---DERPLPAMKRPP-------------PVTEEE-----EQVVDTGGGGITGEPEPLSEKDLREASAAVDVFGEPLVAKAYSKTWSYREDALLAVYKQMSEMSTSTPKDEVKTALKGAVYLCKRAIRDKVYAVFKAGLHLLKMILTEYCPKHKLGKSEFVHTVEIVMPELFNKSADTASRNRDDAKNFIKEMANFPEVRPTNVVPHECLKPIKMTLAPRPAQSRLEIVEMLYKSLGVKGSTGMTIDNIMNFCVVALGHTSGDVRDVSERIIRTLYKENPGDRQTIKDHLPPDDERTRKNTMYRQLFEYFDKVDGKPSKSDMKRQKAEEESKKQEEIEALQNQLQQ-----LRSMAA----GKQPVDENVLK--TESKKPGKKPLNK-SKPKPK-----------DDDDTSMYNMDNICIFCEERNSSFTEEGLDLHYWKNCPMLKRCTNCKQVVEIASYTEHLVSECEAKGNYAKCPRCTEAIPKSEHPQHVADKSCNPSESEKN-HCPLCHQNIYAG------EDGWKKHLMGK-DGCKQNPRRLLALNKQPSQ 834          
BLAST of Centrosomal protein 104 vs. TrEMBL
Match: A0A2C9LW30 (TOG domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106057410 PE=4 SV=1)

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 364/939 (38.76%), Postives = 542/939 (57.72%), Query Frame = 3
Query:   36 TSMPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNAKFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIGDEL----------FSVNKDEIEN-------FNGPLQQDYISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQXXXXXXXXXXXXXXXASDNENYDRAKVKKQQIDQYRHRIYK-------------------ELDALEFLNMPVNLQKPALKFEKPIVEPELYSQRGYNQNNNAL----IAEEPRMYPNPEDRPLPALKN------------------QPIEVLPSQRNDFREPIPEKSFIASPEPALFTGDE----------------IDSEEINAMTKSDLSEASEAIEVYGLPLVSKVYSKNWTHQENALLEIEKRLTEMPSDMDKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKXXXXXXXXXXGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYSIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDGINPFVNKNNKINDQESARQKELDNNQVE-QKPKEPVRTKPVKQLNKKQSIHPNIQKEPQSSRTAQQKPSQQISAPAPAHASGNLAKLELQDDPTL-DWNTTCIFCGEKNESL-KDNMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPADQKNSIRCPLCHENITLGQFVDSPEALWQYHLMDETNGCPQNPRRLVAIQR 2621
            T MPHKL F+VIHA+ Q+D ++ASE+++H+P +KGWQSA FCLYPQD+VI LE R +++KIQ+LSHQ LI TKIEFFVGD P+       +A++ RLGYVSLSDNEKT +KARELKSVHVDA+  F+KL +H N +NK N YNQVGIIA+N+IGDEL            ++   IE        FN P   DYIS  +DLAFD+  DPE AQIIR LE+ K +AV +E++D A +++  +  LQ+VGEKLGK+E+EK+ A +NE+YD+A++KK Q+D+YR ++YK                   +L+ +   + P    +        I  P  Y +    ++++ L        P  YP  +D PLP  K+                  +P E   S+ N  R P   +     P P L +  E                 +++E   M++ DL EAS AI+++GL LVSK YSK W+++E+AL  +  ++ +MP+  +K++ K+ +RA   L+K+    +V  V + A ++ +++L E V +  + KP++   ++K +P +F    D   + R+  ++++ EM+ +  V+   T+  E +KPF   +  R  Q + E++  LY    L     T+DN MK+ V  L H + E+R+  E LI  +Y+N     ++ YLPPDD KTRKN L+++LFE  D++DG  P  +   +  ++E  +Q E+D  Q + Q  ++    K ++       I  ++  +   S+ A   P ++ +  A     GN    +  DD ++   +  CIFCGE+NES  ++ +D+HYWKNCP+L+RC  CKQ VEI++ T H L ECE +S F +CPRC+EAI K E DQH++D  CNP  +     CPLCHENI+ G      E  W+ HLM  T GC QNPRRL+A+ +
Sbjct:   11 TVMPHKLQFKVIHASGQDDIYRASELNHHSPLTKGWQSARFCLYPQDMVIQLETRSRLRKIQILSHQFLIPTKIEFFVGDVPDGAPLLLESARYARLGYVSLSDNEKTGYKARELKSVHVDAVGHFLKLNIHKNHVNKHNLYNQVGIIAINVIGDELRRPYDITDPDLLLDDPRIERDPALEGLFNKP---DYISPLDDLAFDMYQDPEIAQIIRRLERKKQEAVLQERYDYAKRLKQAITELQKVGEKLGKMEVEKRQAVENEDYDKARLKKVQMDEYRLQVYKDLNLNDLLELTGSRHPQHIDLEPVRITSPPTPPPRLEELPPPTIRTPPHYEEYPLPRSDSVLEVVSTKTIPSYYPF-DDMPLPNQKSKSVIEPITVPAEETSKSPRPPETNRSKNNSPRTPHDSRRL---PPPKLKSIKEDEEKALTLEEELPPEPENNQEAEPMSEVDLREASTAIDIFGLSLVSKAYSKTWSYREDALTAVHHQMQQMPTG-NKEEAKSMLRAAIFLVKRGIDDKVYAVFRAALHLYRMLLTEFVPKHKLGKPDITSAVEKTLPNLFHKAGDTAVRNRDDAKSFIQEMASFPEVKATQTLAHECVKPFKLTLGPRHAQSRCEIVESLYQNFGLKGG-LTIDNIMKFNVEGLNHNAGEVRDVIERLIKTMYKNHGAP-IKDYLPPDDEKTRKNTLWRQLFEYFDQVDGKPPRTDAKKQKAEEEQKKQAEIDALQKQLQALRDMNAGKALRSDRSNGPIDASVLSKNDPSKKAA--PQKKKTEAAKVKPKGNKPTTKDDDDVSMFTVDNICIFCGERNESFTEEGLDIHYWKNCPMLKRCYNCKQVVEIATYTDHVLTECEAKSNFSKCPRCSEAIPKPEYDQHVADKACNP-HKTGQNHCPLCHENISSG------EDGWKEHLMGRT-GCKQNPRRLLALNK 929          
BLAST of Centrosomal protein 104 vs. TrEMBL
Match: R7TP87 (TOG domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_170133 PE=4 SV=1)

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 366/899 (40.71%), Postives = 530/899 (58.95%), Query Frame = 3
Query:   42 MPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNAKFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIGDELF---SVNKDEIE------NFNGPL---------QQDYISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQXXXXXXXXXXXXXXXASDNENYDRAKVKKQQIDQYRHRIYKELDALEFLNMPVNLQKPALKFEKPIVE-PELYSQRGYNQNNNALIAE------------EPRMYPNP----EDRPLPALK---NQPIEVLPSQRNDFREPIPEKSFIASPEPALFTGDEIDSEEINAMTKSDLSEASEAIEVYGLPLVSKVYSKNWTHQENALLEIEKRLTEMPSDMDKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKXXXXXXXXXXGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYSIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDGINPFVNKNNKINDQESARQKELDNNQVEQKPKEPVRTKPVKQLNKKQSIHPNIQKEPQSSRTAQQKPSQQISAPAPAHASGNLAKLELQDDPTLDWNTTCIFCGEKNESL-KDNMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPADQKNSIRCPLCHENITLGQFVDSPEALWQYHLMDETNGCPQNPRRLVAIQR 2621
            MP K  FRVIHA+ Q+D+HKA E++NH+P +KGW S+ FCLYPQD+VI L  R +++K+Q+LSHQ LIATKIEF+VGD P+    S  NA++TRLGYV+LSDNEKT FKARELKSVHVDA+  F+KLV+H N +N+ N YNQVG++A+N+IGD++     V + EI       N   P+         + DYIS  +DLAFD+  DPE AQIIR LEK K  AV +E++D A K++  ++ LQ+VGEKLGK E+EK+ A +NE+YD+AK+KK Q+D+YR ++YK+L+  + L+  V      L     +VE PE YS   Y Q  +  +AE            +P   P+P    ++RPLPA+K    QP++  PS   +        +    PEP               M + D  EA+  I+ +GLPL SK YSK W+ +E+ALLE+ K +T   +  +KD+ +  +RA   L  +A K +V  V     N+ K++L + +    + K +  Y ++K +P + +   D   + RE  +N+++E S +  V+    +  E ++P   ++  R    + E+L  LY  H + N   T++N M Y   ALQH + E+RE AE +I++LY++     V+ +LPPD  KTR+NVLYK+LFE  D+IDG      K +K +DQ+    K       E+K K     +  KQL + + I     KE +S    + KPS+  + P              ++D     + TCIFCGEKN    ++ +DLHYWKNCP+L+RC +CKQ VEI+ LT H + ECE ++ FG+CPRC EA+ K ELDQH+++  C  A+   +  CPLCH N+  G+  DS    W+ HLM +  GC  NPRRL ++ +
Sbjct:    1 MPVKQTFRVIHASGQDDHHKAVELNNHSPVTKGWHSSRFCLYPQDLVIQLNKRSRLRKLQILSHQYLIATKIEFYVGDVPDGTTVSLQNARYTRLGYVALSDNEKTGFKARELKSVHVDAVGHFIKLVIHKNHVNRHNLYNQVGLVAINVIGDDVLDHPDVRQAEIAFLVFMFNERDPMDPSLAGLYNRPDYISPLDDLAFDMYQDPEIAQIIRKLEKKKQDAVLDEKYDYAKKLKSAIQDLQKVGEKLGKYEVEKRQAVENEDYDKAKLKKVQMDEYRLQVYKDLELNDLLDQDV------LHASADVVEIPEFYSD-PYMQKTSPRMAEIVPSPQPLPHSPDPYTTPSPRTPYDERPLPAIKSLQGQPVQP-PSMLTNVLCRRLRSNVTGEPEP---------------MIEKDQREAAIVIDTFGLPLASKSYSKTWSFREDALLEVYKEMTS--ASTNKDEARNMMRAAVFLSNRAIKDKVLAVYTAGLNLLKMILTQFIPDQRLQKQDTAYAVEKTMPALLQRTGDTAIRCREAAKNFILEESGFSEVKPLHVVPHECVRPIKLSLAPRLALSRTEVLELLYKTHGVENSGLTVENMMNYCTQALQHNAGEVREKAEKVIILLYKDVGSP-VKDFLPPDVEKTRRNVLYKQLFEAFDRIDG------KPSK-DDQKVCTAK---TKMAEEKKKAAEIDQLQKQLQQLKDITAGKAKEKKS----RAKPSKHDNKP--------------KEDADFQIDHTCIFCGEKNSEFSEEGLDLHYWKNCPMLKRCSFCKQVVEIAGLTDHLVSECENKANFGKCPRCKEAVPKAELDQHLAEKSCTEAEAGKN-HCPLCHLNLPSGE--DS----WKEHLMGK-EGCKANPRRLQSLNK 837          
BLAST of Centrosomal protein 104 vs. Ensembl Cavefish
Match: cep104 (centrosomal protein 104 [Source:ZFIN;Acc:ZDB-GENE-060503-195])

HSP 1 Score: 408.683 bits (1049), Expect = 2.291e-128
Identity = 298/868 (34.33%), Postives = 453/868 (52.19%), Query Frame = 3
Query:   42 MPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGD-CPNNVQFSPSNA-KFTRLG--YVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIGDEL-FS-----VNKDE-IENF------NGPLQQDY-------ISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQXXXXXXXXXXXXXXXASDNENYDRAKVKKQQIDQYRHRIYKELDALEFLNMPVNLQKPALKFEKPIVEPELYSQRGYNQNNNALIAEEPR-----MYPNPEDRPLPALKNQPIEVLPSQRNDFREPIPEKSFIASPEPALFTGDEIDSEEINAMTKSDLSEASEAIEVYGLPLVSKVYSKNWTHQENALLEIEKRLTEMPSDMDKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKXXXXXXXXXXGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYSIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDGINPFVNKNNKINDQESARQKELDNNQVEQKPKEPVRTKPVKQLNKKQSIHPNIQKEPQSSRTAQQKPSQQISAPAPAHASGN-----LAKLELQDDPTLDWNTT--CIFCGEKNESL-KDNMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPADQKNSI-RCPLCHENITLGQFV 2531
            MP K+ F V+  +  E+ + A E+  H PT  GW+SA FC +PQ+I + +  RC +KK+QLL+HQ LI+ K+EF +GD  P     SP N+ +  RLG  YVSLS+NEKT  +ARELKSVHVDA+  ++KL  H N  N++N YNQV ++A+N++GD + FS      ++D+ IE +      +  L   Y       IS  +DLAFD+  DPE A IIR L+  K   V  E++D A K++  +  LQ+VGE+LG+ ++EK  A + E+YD AK KK+Q++ YR R+Y++L   + L++      P    E+P+                      PR      Y + ++RPLPAL+          R    +  PE S   SP+    +G      E   +++    EAS  +E+YG  +VS  YSK W+ +E+ALL + KRL E+P  + K ++++ +RA   L ++A   +V+ V + +  + +    +         P  H          FK V  +           L E++ +  VR    + SE +KP   ++ +R    +L+LL +L       +  FTL+N M++ V AL+H +A +RE A  L+ ++YRN    V+  YLPPDD   RK ++YK LF    KIDG         K+ D + AR+K                   ++ L ++ ++   I     +     Q     I +  P  A  N        L +Q   TL  NT   CIFCGE++++  ++ +DLHYWK CP+L RC +C+Q VEISSLT+H L ECE+ + F QC RC+EA+++  L +H  +  C+P     S   CPLCH+N   G+ V
Sbjct:    1 MPRKIGFTVVSWSGHEENYSAKELMIHAPTVSGWRSARFCPFPQEITLQMVERCHVKKLQLLAHQYLISAKVEFHIGDRLPEPA--SPQNSQQLRRLGSEYVSLSNNEKTGLRARELKSVHVDAVGTYLKLTFHRNHANQYNLYNQVALVAINILGDSVDFSDVSPISSRDQLIEQYLSSTQHSSALDSSYTGSKYESISPLDDLAFDMYQDPEVAHIIRLLDDKKQDMVRLERYDLAKKLKQAIADLQKVGERLGRYDVEKHSAIEREDYDTAKEKKEQMEAYRLRVYQQLQLHDLLDITQRRPLP----ERPLA---------------------PRRISIPYYLSYDERPLPALR----------RRSGDQTQPELSPTLSPQSPRASG------EPEPLSEKTQREASLPLEIYGDAVVSGAYSKTWSCREDALLAVCKRLAEVPPGLSKAELRSLMRAAIFLCRRALSDKVSSVTKHSKTLYQQTTAKHQLN---TLPTNHS---------FKTVSLS-----------LQEIAVYKEVRLVQLVPSELVKPIKLSLPSRLALSRLQLLEKLLEQLGFKDSGFTLENVMRFLVGALEHSAASVRELAVRLVQMMYRNHGAAVL-IYLPPDDASERKTLIYKNLFLSFAKIDG---------KLPDPQGAREK-----------------AEIRSLQEQLAVLKEISVSSSARYDVIQITDYIIISIYPLTAGKNSPDTLSPALYIQRYITLK-NTIHLCIFCGERDQAFTEEGLDLHYWKYCPMLCRCLHCRQVVEISSLTEHLLSECERRADFIQCFRCSEAVVRDRLTEHAQN--CSPLPVSGSCNHCPLCHQNAAPGEEV 772          
BLAST of Centrosomal protein 104 vs. Ensembl Sea Lamprey
Match: cep104 (centrosomal protein 104 [Source:ZFIN;Acc:ZDB-GENE-060503-195])

HSP 1 Score: 478.404 bits (1230), Expect = 1.302e-154
Identity = 304/918 (33.12%), Postives = 497/918 (54.14%), Query Frame = 3
Query:   42 MPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNAKFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIGDELFSVNKDEIENFNGP---LQQDYISH-------------------TEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQXXXXXXXXXXXXXXXASDNENYDRAKVKKQQIDQYRHRIYKELDALEFLNMPVNLQKPA------LKFEKPI----VEPELYSQRGY-------NQNNNALIAEEPRMY---------------PNPEDRPLPALKNQPIEVLPSQRNDFREPIPEKSFIASPEPALFTGDEIDSEEINAMTKSDLSEASEAIEVYGLPLVSKVYSKNWTHQENALLEIEKRLTEMPSDMDKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKXXXXXXXXXXGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYSIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDG--INPFVNKNNKINDQESARQKELDNNQVEQKPKEPVRTKPVKQLNKKQSIHPNIQKEPQSSRTAQQKPSQQISAPAPAHASGNLAKLELQDDPTLDWNTTCIFCGEKNESLKD-NMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPAD-QKNSIRCPLCHENITLGQFVDSPEALWQYHLMDETNGCPQNPRRLVAIQR 2621
            MP +L F V+ A+  E+ + A E+++H PT +GW+S  + LYPQ++V+ LE  C ++K+Q+LSHQ LI++K+E ++G+  +        + +TRLGYV+LSDNEKT F+ARELKSVHVDA  R++KL++H N +NK+N +NQVG++A+N++GD +   +KD      G    L   Y+ H                    +DLAF + VDPE A +IR L+  K  AV EE+F  A  ++  +  L +VGE+LG+ E+EK+ A + E+YD A+ KKQQ+++YR R+Y+EL     L      Q         L+   P      +     +RG         ++ +   +E  RMY               P+ +DRP+P +  Q  +      +  ++ +  +    +PEP               +++  L EA   I+V+G  LV+  YSK W+++E+ALL I +++ E+   M ++D++A +RA   L+++A + +VT V   +  V K+++ + V +  + + ++ + ++  +P +     D   + R    +++ E++    VR    +    ++ F  +  +R    +LELLL L     L  H  T  N MK A   L H  A++RE+A  L++ LY    +E VR+ LPPDD  TR+N+LY+ LF+ +D+IDG   +  V    K   +E+ R+K+ +   ++Q+       +   QL KK+++    Q+ P  +      PS     PAP     N ++           ++ C+FCGE+++S  D  +D+HYW++CP+L+RC +CKQ VEIS LT H L ECE+   +G+CPRC EA+ KT+L +HI    C PA  ++ + RCPLCH +   G      E  W+ HL+ +  GC +NPR+   +QR
Sbjct:    1 MPRRLGFTVVDASGHEEGYSAVELTSHGPTVQGWRSPRYSLYPQELVLCLEGSCHVQKLQVLSHQFLISSKLEIYIGESQHQ------GSAYTRLGYVALSDNEKTGFRARELKSVHVDATGRYLKLIIHKNHVNKYNIHNQVGLVAINILGDAVD--DKDSGSYSPGAADRLISQYLKHHPDDPALSSTTQRQEEFDPLDDLAFGMYVDPEVAGMIRTLDARKRAAVREEKFHVAKTLKQAIADLHKVGERLGRYEVEKRCAVEQEDYDLAEKKKQQMEEYRQRVYQELRLHNLLQTTGGPQGHGKWSAELLQITSPGNTARTKGAALQERGTPKGMLAAGEDVHTHRSESERMYSTQVDSDFQPTRQNPPSHDDRPIPTVVRQQHKAQDDAGD--KDSLLAQRGSGTPEP---------------LSEMALREAGPVIDVFGEGLVAGAYSKTWSYREDALLAIYRQMAELKEGMAREDIRAMLRAAIFLVRRALRDQVTSVFSASLKVLKMLVTQFVPQHRLGRVDLSHCVEGTLPGLMARTGDTTTRHRNAAMSFIQELALLQAVRALQLVPPVLLQSFGAHAASRLAISQLELLLRLLPELGLDGHGLTPTNVMKVAQCGLDHTGADVRETAVRLVLALY-GMKREAVRALLPPDDGNTRRNLLYRGLFDAMDRIDGKPTHAEVQVRRKAAAEEAERRKQAEIQVLQQQLSALHEIQAQVQLRKKKAVQQRSQQLPPKA------PSLWKIPPAPCR---NFSR-----------SSICVFCGERSDSFTDEGLDVHYWRHCPMLQRCEHCKQVVEISGLTAHRLGECERGDGYGKCPRCAEAVPKTKLSEHIQAKSCAPAKPERVANRCPLCHTDFPPG------EEAWKPHLVSK-EGCTKNPRKEQYLQR 865          
BLAST of Centrosomal protein 104 vs. Ensembl Nematostella
Match: EDO38444 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCR2])

HSP 1 Score: 170.629 bits (431), Expect = 7.537e-45
Identity = 112/371 (30.19%), Postives = 185/371 (49.87%), Query Frame = 3
Query: 1458 KPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPF-SPNILARPGQIKLEL---LLELYSIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDGINPFVNKNNKINDQESARQKELDNNQVEQKPKEPVRTKPVKQLNKKQSIHPNIQKEPQSSRTAQQKPSQQISAPAPAHASGNLAKLELQDDPTLDWNTTCIFCGEKNESLKDNM-DLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPADQKNSIRCPLCHENITLGQFVDSPEALWQ 2555
            K E+ + ++K +P +     +   + R+     ++EM+ +  V+    I     +P  S     R  + +LE+   LL +  +        +L+  M  AV AL H + E+R++A  LI  LY+   K+ V+ +LP D+  TRKN LY+ +F+  D IDG              ES R+ +    ++E++  E  +   ++ L  +      +  E +S  T++ K  ++  A                ++P LD +  CIFCGE+NES  ++M DLHYWK+CP+L RC +C Q VE+S    H L EC+ + +  QCPRC E +LK +LD H+  A C  A  K++  CPLC   I   + +++ +A  Q
Sbjct:  185 KAEISHVVEKTVPALLVKSGETTPRTRDAAIEMILEMAAYKDVKGLGVIADLVTQPTKSKQAPWRLLKSRLEIIDKLLPVLDVESGQAGCLSLEAVMHVAVPALDHNNGEVRDAAVKLIFELYKKV-KDPVKGFLPNDEPATRKNPLYRSIFDGFDHIDG-----------KPTESERRAQA---KIERQNAEKHKQAEIEALQAQLQALREMAGEDKSQATSKDKSDKKKKA----------------EEPALDMDKMCIFCGEQNESFTEDMLDLHYWKSCPMLNRCEHCSQVVEVSGFNDHLLTECDAKDRNAQCPRCKEVMLKVDLDDHLVQAGCT-ARGKDAAICPLCKTKIGSEEEIEALQAQLQ 523          
BLAST of Centrosomal protein 104 vs. Ensembl Nematostella
Match: EDO36321 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ17])

HSP 1 Score: 125.946 bits (315), Expect = 4.182e-33
Identity = 68/151 (45.03%), Postives = 102/151 (67.55%), Query Frame = 3
Query:  297 SPSNAKFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIGD--ELFSVNKDEIE----NFNG-PL-----QQDYISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYL 713
            SP+ + +    YV LSDNE TQFKARELKS+H+DA  +F+KL+VH N++N++N YNQVG++AVN+I D  E+   +  + +     F+G P+     + +Y+S  +DLAFD+  DPETA +IR LE  K +AV +E++D A K++  +  L
Sbjct:   28 SPTTSGWQSSRYVGLSDNESTQFKARELKSIHLDAEGQFIKLLVHKNYVNRYNLYNQVGLVAVNVIADVPEIVPADPHDPDPVKSQFSGDPIWGKINRPEYVSPLDDLAFDMYQDPETANLIRKLEAKKKEAVRQERYDFAKKLKVVISEL 178          
BLAST of Centrosomal protein 104 vs. Ensembl Nematostella
Match: EDO38442 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCR0])

HSP 1 Score: 65.855 bits (159), Expect = 1.119e-11
Identity = 27/44 (61.36%), Postives = 39/44 (88.64%), Query Frame = 3
Query:  369 ARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIGD 500
            ARELKS+H+DA  +F+KL+VH N++N++N YNQVG++AVN+I D
Sbjct:    1 ARELKSIHLDAEGQFIKLLVHKNYVNRYNLYNQVGLVAVNVIAD 44          
BLAST of Centrosomal protein 104 vs. Ensembl Medaka
Match: cep104 (centrosomal protein 104 [Source:NCBI gene;Acc:101170643])

HSP 1 Score: 436.417 bits (1121), Expect = 2.672e-138
Identity = 296/895 (33.07%), Postives = 469/895 (52.40%), Query Frame = 3
Query:   42 MPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNAKFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIGDELFSVN--KDEIENFNGPLQQ------------DYISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQXXXXXXXXXXXXXXXASDNENYDRAKVKKQQIDQYRHRIYKELDALEFLNMPVNLQKPALKFEK---PIVEPELYSQRGYNQNNNALIAEEPRMYPNPEDRPLPALKNQPIEVLPS-------QRNDFREPIPEKSFIASPEPALFTGDEIDSEEINAMTKSDLSEASEAIEVYGLPLVSKVYSKNWTHQENALLEIEKRLTEMPSDMDKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKXXXXXXXXXXGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYSIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDG--INPFVNKNNKINDQESARQ--------KELDNNQVEQKPKEPVRTKPVKQLNKKQSIHPNIQKEPQSSRTAQQKPSQQISAPAPAHASGNLAKLELQDDPTLDWNTTCIFCGEKNESL-KDNMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPADQKNSIRCPLCHENITLGQFVDSPEALWQYHLMDETNGCPQNPRRLVAIQR 2621
            M  K+ F VI ++S ED+  A E+  H PT +GW+S+  C +PQ I++ LE R +++K+QLL+HQ LI TK+EF VGD     +   S  +  RLGYVSLSDNEKT F+ARELKSVHVDA+  F+K+ ++ N +N+ NHY+QV ++A+N++G+ + +V     E  N   PLQQ            + +S  +DLAFD+  DP+ A IIR L++ K   V++E F++A  ++  +  LQ+VGE+L + ++EK+ A + E YD AK KK+ +++ R  IY++L+  + L++ V    P L          EP++ +    N+       E P  +   ED+P P  K    +VL         QR D+     + + + + +     G  ++      +T+    EA  A++VYG  LV++ YS++W  +E+ALL +  +L E  S   K+++   IRA   L ++A   +V  V   +  + +L+L++++  +G+ + E  + L +  P + +   D   + R     ++ E++    VR    I +E +KPF+ N+  R  Q +LELL +L +   L    F  +  +++   AL+H + E+RE A  +I+ LY+     V+   LPP D  T KN LYK LF+   +IDG  +     K   +   E AR         KE+     E  P++P               H   Q+ P++++    K              G       Q  P    +  CIFCGEK+ES  +D +DLHYW++CP+L RC  C Q VEIS L++H L ECE  S+F +CPRC +A+   +L++H+  + C  + + +   CPLC  N   G      E  W+ HLM    GC QN RR    Q+
Sbjct:    1 MQRKIKFSVISSSSHEDHFSAEELMVHAPTVRGWRSSRLCSFPQYILLQLEGRSRVRKLQLLAHQYLIPTKVEFHVGDV--GPEDGSSELQLRRLGYVSLSDNEKTGFQARELKSVHVDAVGTFLKVSLYRNHVNRLNHYSQVSLVAINILGESVGAVGWMSREPPNDRPPLQQEAAWEKTLKGACEAMSPLDDLAFDMYQDPKVAHIIRILDQKKKDMVQQENFEQAKTLKQAIADLQKVGERLARYDVEKRRAIEEEEYDLAKKKKELMEELRRNIYRQLEEHDLLDIAVVTPPPPLLGSPGCHGATEPDVSADAFRNEARGDEKMEPPDEHHRREDKPPPTAKPPRTDVLGDERPLLTLQRKDWASGSLQSAALQAEKTPAGRGTSLEP-----LTEGAQREAGPAVDVYGESLVAEAYSRSWCGREHALLAVHDKLLEASSAAPKEELSHMIRAAGPLARRALLDKVPPVFYASLKLLRLILVQIIPCVGLGRAEAAHCLQQTFPHLLRRTGDRAGRPRAAAVAFIQEIAVLKEVRSLQMIPAELLKPFTSNVPPRLAQSRLELLEKLLAE--LGAESFAPEAVVRFCRVALEHGAKEVRELAVRIILSLYQQHRGHVL-DLLPPRDAATPKNFLYKTLFDGFSRIDGRLMEAQDLKQGGVLPGEEARSLQEQLAVLKEITEWGGEGAPEDP---------------HRPTQEPPKAAKAGLTK------------GDGKRGGANAQ-QPAEHLDHLCIFCGEKDESFTEDGLDLHYWRHCPMLHRCHECGQVVEISGLSRHLLDECESRSRFRRCPRCCQALPAEDLNRHLQGSSCRSSGEGSC--CPLCRCNFLPG------EEAWRAHLMGR-KGCKQNARRTAVFQK 848          
BLAST of Centrosomal protein 104 vs. Ensembl Medaka
Match: cep104 (centrosomal protein 104 [Source:NCBI gene;Acc:101170643])

HSP 1 Score: 436.032 bits (1120), Expect = 4.843e-138
Identity = 296/896 (33.04%), Postives = 469/896 (52.34%), Query Frame = 3
Query:   42 MPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNAKFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIGDELFSVN---KDEIENFNGPLQQ------------DYISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQXXXXXXXXXXXXXXXASDNENYDRAKVKKQQIDQYRHRIYKELDALEFLNMPVNLQKPALKFEK---PIVEPELYSQRGYNQNNNALIAEEPRMYPNPEDRPLPALKNQPIEVLPS-------QRNDFREPIPEKSFIASPEPALFTGDEIDSEEINAMTKSDLSEASEAIEVYGLPLVSKVYSKNWTHQENALLEIEKRLTEMPSDMDKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKXXXXXXXXXXGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYSIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDG--INPFVNKNNKINDQESARQ--------KELDNNQVEQKPKEPVRTKPVKQLNKKQSIHPNIQKEPQSSRTAQQKPSQQISAPAPAHASGNLAKLELQDDPTLDWNTTCIFCGEKNESL-KDNMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPADQKNSIRCPLCHENITLGQFVDSPEALWQYHLMDETNGCPQNPRRLVAIQR 2621
            M  K+ F VI ++S ED+  A E+  H PT +GW+S+  C +PQ I++ LE R +++K+QLL+HQ LI TK+EF VGD     +   S  +  RLGYVSLSDNEKT F+ARELKSVHVDA+  F+K+ ++ N +N+ NHY+QV ++A+N++G+ + +V      E  N   PLQQ            + +S  +DLAFD+  DP+ A IIR L++ K   V++E F++A  ++  +  LQ+VGE+L + ++EK+ A + E YD AK KK+ +++ R  IY++L+  + L++ V    P L          EP++ +    N+       E P  +   ED+P P  K    +VL         QR D+     + + + + +     G  ++      +T+    EA  A++VYG  LV++ YS++W  +E+ALL +  +L E  S   K+++   IRA   L ++A   +V  V   +  + +L+L++++  +G+ + E  + L +  P + +   D   + R     ++ E++    VR    I +E +KPF+ N+  R  Q +LELL +L +   L    F  +  +++   AL+H + E+RE A  +I+ LY+     V+   LPP D  T KN LYK LF+   +IDG  +     K   +   E AR         KE+     E  P++P               H   Q+ P++++    K              G       Q  P    +  CIFCGEK+ES  +D +DLHYW++CP+L RC  C Q VEIS L++H L ECE  S+F +CPRC +A+   +L++H+  + C  + + +   CPLC  N   G      E  W+ HLM    GC QN RR    Q+
Sbjct:    1 MQRKIKFSVISSSSHEDHFSAEELMVHAPTVRGWRSSRLCSFPQYILLQLEGRSRVRKLQLLAHQYLIPTKVEFHVGDV--GPEDGSSELQLRRLGYVSLSDNEKTGFQARELKSVHVDAVGTFLKVSLYRNHVNRLNHYSQVSLVAINILGESVGAVGWMQSREPPNDRPPLQQEAAWEKTLKGACEAMSPLDDLAFDMYQDPKVAHIIRILDQKKKDMVQQENFEQAKTLKQAIADLQKVGERLARYDVEKRRAIEEEEYDLAKKKKELMEELRRNIYRQLEEHDLLDIAVVTPPPPLLGSPGCHGATEPDVSADAFRNEARGDEKMEPPDEHHRREDKPPPTAKPPRTDVLGDERPLLTLQRKDWASGSLQSAALQAEKTPAGRGTSLEP-----LTEGAQREAGPAVDVYGESLVAEAYSRSWCGREHALLAVHDKLLEASSAAPKEELSHMIRAAGPLARRALLDKVPPVFYASLKLLRLILVQIIPCVGLGRAEAAHCLQQTFPHLLRRTGDRAGRPRAAAVAFIQEIAVLKEVRSLQMIPAELLKPFTSNVPPRLAQSRLELLEKLLAE--LGAESFAPEAVVRFCRVALEHGAKEVRELAVRIILSLYQQHRGHVL-DLLPPRDAATPKNFLYKTLFDGFSRIDGRLMEAQDLKQGGVLPGEEARSLQEQLAVLKEITEWGGEGAPEDP---------------HRPTQEPPKAAKAGLTK------------GDGKRGGANAQ-QPAEHLDHLCIFCGEKDESFTEDGLDLHYWRHCPMLHRCHECGQVVEISGLSRHLLDECESRSRFRRCPRCCQALPAEDLNRHLQGSSCRSSGEGSC--CPLCRCNFLPG------EEAWRAHLMGR-KGCKQNARRTAVFQK 849          
BLAST of Centrosomal protein 104 vs. Ensembl Medaka
Match: cep104 (centrosomal protein 104 [Source:NCBI gene;Acc:101170643])

HSP 1 Score: 436.417 bits (1121), Expect = 4.917e-138
Identity = 296/897 (33.00%), Postives = 469/897 (52.29%), Query Frame = 3
Query:   39 SMPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNAKFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIGDELFSVN---KDEIENFNGPLQQ------------DYISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQXXXXXXXXXXXXXXXASDNENYDRAKVKKQQIDQYRHRIYKELDALEFLNMPVNLQKPALKFEK---PIVEPELYSQRGYNQNNNALIAEEPRMYPNPEDRPLPALKNQPIEVLPS-------QRNDFREPIPEKSFIASPEPALFTGDEIDSEEINAMTKSDLSEASEAIEVYGLPLVSKVYSKNWTHQENALLEIEKRLTEMPSDMDKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKXXXXXXXXXXGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYSIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDG--INPFVNKNNKINDQESARQ--------KELDNNQVEQKPKEPVRTKPVKQLNKKQSIHPNIQKEPQSSRTAQQKPSQQISAPAPAHASGNLAKLELQDDPTLDWNTTCIFCGEKNESL-KDNMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPADQKNSIRCPLCHENITLGQFVDSPEALWQYHLMDETNGCPQNPRRLVAIQR 2621
             M  K+ F VI ++S ED+  A E+  H PT +GW+S+  C +PQ I++ LE R +++K+QLL+HQ LI TK+EF VGD     +   S  +  RLGYVSLSDNEKT F+ARELKSVHVDA+  F+K+ ++ N +N+ NHY+QV ++A+N++G+ + +V      E  N   PLQQ            + +S  +DLAFD+  DP+ A IIR L++ K   V++E F++A  ++  +  LQ+VGE+L + ++EK+ A + E YD AK KK+ +++ R  IY++L+  + L++ V    P L          EP++ +    N+       E P  +   ED+P P  K    +VL         QR D+     + + + + +     G  ++      +T+    EA  A++VYG  LV++ YS++W  +E+ALL +  +L E  S   K+++   IRA   L ++A   +V  V   +  + +L+L++++  +G+ + E  + L +  P + +   D   + R     ++ E++    VR    I +E +KPF+ N+  R  Q +LELL +L +   L    F  +  +++   AL+H + E+RE A  +I+ LY+     V+   LPP D  T KN LYK LF+   +IDG  +     K   +   E AR         KE+     E  P++P               H   Q+ P++++    K              G       Q  P    +  CIFCGEK+ES  +D +DLHYW++CP+L RC  C Q VEIS L++H L ECE  S+F +CPRC +A+   +L++H+  + C  + + +   CPLC  N   G      E  W+ HLM    GC QN RR    Q+
Sbjct:   20 GMQRKIKFSVISSSSHEDHFSAEELMVHAPTVRGWRSSRLCSFPQYILLQLEGRSRVRKLQLLAHQYLIPTKVEFHVGDV--GPEDGSSELQLRRLGYVSLSDNEKTGFQARELKSVHVDAVGTFLKVSLYRNHVNRLNHYSQVSLVAINILGESVGAVGWMQSREPPNDRPPLQQEAAWEKTLKGACEAMSPLDDLAFDMYQDPKVAHIIRILDQKKKDMVQQENFEQAKTLKQAIADLQKVGERLARYDVEKRRAIEEEEYDLAKKKKELMEELRRNIYRQLEEHDLLDIAVVTPPPPLLGSPGCHGATEPDVSADAFRNEARGDEKMEPPDEHHRREDKPPPTAKPPRTDVLGDERPLLTLQRKDWASGSLQSAALQAEKTPAGRGTSLEP-----LTEGAQREAGPAVDVYGESLVAEAYSRSWCGREHALLAVHDKLLEASSAAPKEELSHMIRAAGPLARRALLDKVPPVFYASLKLLRLILVQIIPCVGLGRAEAAHCLQQTFPHLLRRTGDRAGRPRAAAVAFIQEIAVLKEVRSLQMIPAELLKPFTSNVPPRLAQSRLELLEKLLAE--LGAESFAPEAVVRFCRVALEHGAKEVRELAVRIILSLYQQHRGHVL-DLLPPRDAATPKNFLYKTLFDGFSRIDGRLMEAQDLKQGGVLPGEEARSLQEQLAVLKEITEWGGEGAPEDP---------------HRPTQEPPKAAKAGLTK------------GDGKRGGANAQ-QPAEHLDHLCIFCGEKDESFTEDGLDLHYWRHCPMLHRCHECGQVVEISGLSRHLLDECESRSRFRRCPRCCQALPAEDLNRHLQGSSCRSSGEGSC--CPLCRCNFLPG------EEAWRAHLMGR-KGCKQNARRTAVFQK 869          
BLAST of Centrosomal protein 104 vs. Ensembl Medaka
Match: cep104 (centrosomal protein 104 [Source:NCBI gene;Acc:101170643])

HSP 1 Score: 419.853 bits (1078), Expect = 6.199e-132
Identity = 284/864 (32.87%), Postives = 456/864 (52.78%), Query Frame = 3
Query:   42 MPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNAKFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIGDELFSVN---KDEIENFNGPLQQ------------DYISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQXXXXXXXXXXXXXXXASDNENYDRAKVKKQQIDQYRHRIYKELDALEFLNMPVNLQKPALKFEK---PIVEPELYSQRGYNQNNNALIAEEPRMYPNPEDRPLPALKNQPIEVLPS-------QRNDFREPIPEKSFIASPEPALFTGDEIDSEEINAMTKSDLSEASEAIEVYGLPLVSKVYSKNWTHQENALLEIEKRLTEMPSDMDKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKXXXXXXXXXXGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYSIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDG--INPFVNKNNKINDQESARQ--------KELDNNQVEQKPKEPVRTKPVKQLNKKQSIHPNIQKEPQSSRTAQQKPSQQISAPAPAHASGNLAKLELQDDPTLDWNTTCIFCGEKNESL-KDNMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPADQKNSIRCPLCHENITLGQ 2525
            M  K+ F VI ++S ED+  A E+  H PT +GW+S+  C +PQ I++ LE R +++K+QLL+HQ LI TK+EF VGD     +   S  +  RLGYVSLSDNEKT F+ARELKSVHVDA+  F+K+ ++ N +N+ NHY+QV ++A+N++G+ + +V      E  N   PLQQ            + +S  +DLAFD+  DP+ A IIR L++ K   V++E F++A  ++  +  LQ+VGE+L + ++EK+ A + E YD AK KK+ +++ R  IY++L+  + L++ V    P L          EP++ +    N+       E P  +   ED+P P  K    +VL         QR D+     + + + + +     G  ++      +T+    EA  A++VYG  LV++ YS++W  +E+ALL +  +L E  S   K+++   IRA   L ++A   +V  V   +  + +L+L++++  +G+ + E  + L +  P + +   D   + R     ++ E++    VR    I +E +KPF+ N+  R  Q +LELL +L +   L    F  +  +++   AL+H + E+RE A  +I+ LY+     V+   LPP D  T KN LYK LF+   +IDG  +     K   +   E AR         KE+     E  P++P               H   Q+ P++++    K              G       Q  P    +  CIFCGEK+ES  +D +DLHYW++CP+L RC  C Q VEIS L++H L ECE  S+F +CPRC +A+   +L++H+  + C  + + +   CPLC  N   G+
Sbjct:    1 MQRKIKFSVISSSSHEDHFSAEELMVHAPTVRGWRSSRLCSFPQYILLQLEGRSRVRKLQLLAHQYLIPTKVEFHVGDV--GPEDGSSELQLRRLGYVSLSDNEKTGFQARELKSVHVDAVGTFLKVSLYRNHVNRLNHYSQVSLVAINILGESVGAVGWMQSREPPNDRPPLQQEAAWEKTLKGACEAMSPLDDLAFDMYQDPKVAHIIRILDQKKKDMVQQENFEQAKTLKQAIADLQKVGERLARYDVEKRRAIEEEEYDLAKKKKELMEELRRNIYRQLEEHDLLDIAVVTPPPPLLGSPGCHGATEPDVSADAFRNEARGDEKMEPPDEHHRREDKPPPTAKPPRTDVLGDERPLLTLQRKDWASGSLQSAALQAEKTPAGRGTSLEP-----LTEGAQREAGPAVDVYGESLVAEAYSRSWCGREHALLAVHDKLLEASSAAPKEELSHMIRAAGPLARRALLDKVPPVFYASLKLLRLILVQIIPCVGLGRAEAAHCLQQTFPHLLRRTGDRAGRPRAAAVAFIQEIAVLKEVRSLQMIPAELLKPFTSNVPPRLAQSRLELLEKLLAE--LGAESFAPEAVVRFCRVALEHGAKEVRELAVRIILSLYQQHRGHVL-DLLPPRDAATPKNFLYKTLFDGFSRIDGRLMEAQDLKQGGVLPGEEARSLQEQLAVLKEITEWGGEGAPEDP---------------HRPTQEPPKAAKAGLTK------------GDGKRGGANAQ-QPAEHLDHLCIFCGEKDESFTEDGLDLHYWRHCPMLHRCHECGQVVEISGLSRHLLDECESRSRFRRCPRCCQALPAEDLNRHLQGSSCRSSGEGSC--CPLCRCNFLPGE 824          
BLAST of Centrosomal protein 104 vs. Ensembl Medaka
Match: cep104 (centrosomal protein 104 [Source:NCBI gene;Acc:101170643])

HSP 1 Score: 415.231 bits (1066), Expect = 5.818e-130
Identity = 291/921 (31.60%), Postives = 463/921 (50.27%), Query Frame = 3
Query:   39 SMPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANF----------------------------------CLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNAKFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIGDELFSVN---KDEIENFNGPLQQ------------DYISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQXXXXXXXXXXXXXXXASDNENYDRAKVKKQQIDQYRHRIYKELDALEFLNMPVNLQKPALKFEK---PIVEPELYSQRGYNQNNNALIAEEPRMYPNPEDRPLPALKNQPIEVLPS-------QRNDFREPIPEKSFIASPEPALFTGDEIDSEEINAMTKSDLSEASEAIEVYGLPLVSKVYSKNWTHQENALLEIEKRLTEMPSDMDKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKXXXXXXXXXXGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYSIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDGINPFVNKNNKINDQESARQKELDNNQVEQKPKEPVRTKPVKQLNKKQSIHPNIQKEPQSSRTAQQKPSQQISAPAPAHASGNLAKLELQDDPTLDWNTTCIFCGEKNESL-KDNMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPADQKNSIRCPLCHENITLGQFVDSPEALWQYHLMDETNGCPQNPRRLVAIQR 2621
             M  K+ F VI ++S ED+  A E+  H PT +GW+S+ +                                  C +PQ I++ LE R +++K+QLL+HQ LI TK+EF VGD     +   S  +  RLGYVSLSDNEKT F+ARELKSVHVDA+  F+K+ ++ N +N+ NHY+QV ++A+N++G+ + +V      E  N   PLQQ            + +S  +DLAFD+  DP+ A IIR L++ K   V++E F++A  ++  +  LQ+VGE+L + ++EK+ A + E YD AK KK+ +++ R  IY++L+  + L++ V    P L          EP++ +    N+       E P  +   ED+P P  K    +VL         QR D+     + + + + +     G  ++      +T+    EA  A++VYG  LV++ YS++W  +E+ALL +  +L E  S   K+++   IRA   L ++A   +V  V   +  + +L+L++++  +G+ + E  + L +  P + +   D   + R     ++ E++    VR    I +E +KPF+ N+  R  Q +LELL +L +     +  F  +  +++   AL+H + E+RE A  +I+ LY+     V+   LPP D  T KN LYK LF+   +IDG                 R  E      E  P++P               H   Q+ P++++    K              G       Q  P    +  CIFCGEK+ES  +D +DLHYW++CP+L RC  C Q VEIS L++H L ECE  S+F +CPRC +A+   +L++H+  + C  + + +   CPLC  N   G      E  W+ HLM    GC QN RR    Q+
Sbjct:   20 GMQRKIKFSVISSSSHEDHFSAEELMVHAPTVRGWRSSRYSLTSDLYHKSCPFGSNLSLFCWNQVKVSPMFCRLCSFPQYILLQLEGRSRVRKLQLLAHQYLIPTKVEFHVGDV--GPEDGSSELQLRRLGYVSLSDNEKTGFQARELKSVHVDAVGTFLKVSLYRNHVNRLNHYSQVSLVAINILGESVGAVGWMQSREPPNDRPPLQQEAAWEKTLKGACEAMSPLDDLAFDMYQDPKVAHIIRILDQKKKDMVQQENFEQAKTLKQAIADLQKVGERLARYDVEKRRAIEEEEYDLAKKKKELMEELRRNIYRQLEEHDLLDIAVVTPPPPLLGSPGCHGATEPDVSADAFRNEARGDEKMEPPDEHHRREDKPPPTAKPPRTDVLGDERPLLTLQRKDWASGSLQSAALQAEKTPAGRGTSLEP-----LTEGAQREAGPAVDVYGESLVAEAYSRSWCGREHALLAVHDKLLEASSAAPKEELSHMIRAAGPLARRALLDKVPPVFYASLKLLRLILVQIIPCVGLGRAEAAHCLQQTFPHLLRRTGDRAGRPRAAAVAFIQEIAVLKEVRSLQMIPAELLKPFTSNVPPRLAQSRLELLEKLLAELGAES--FAPEAVVRFCRVALEHGAKEVRELAVRIILSLYQQHRGHVL-DLLPPRDAATPKNFLYKTLFDGFSRIDG-----------------RLMEAQEWGGEGAPEDP---------------HRPTQEPPKAAKAGLTK------------GDGKRGGANAQ-QPAEHLDHLCIFCGEKDESFTEDGLDLHYWRHCPMLHRCHECGQVVEISGLSRHLLDECESRSRFRRCPRCCQALPAEDLNRHLQGSSCRSSGEGSC--CPLCRCNFLPG------EEAWRAHLMGR-KGCKQNARRTAVFQK 876          
BLAST of Centrosomal protein 104 vs. Planmine SMEST
Match: SMESG000023549.1 (SMESG000023549.1)

HSP 1 Score: 1731.46 bits (4483), Expect = 0.000e+0
Identity = 886/893 (99.22%), Postives = 890/893 (99.66%), Query Frame = 3
Query:   42 MPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNAKFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIGDELFSVNKDEIENFNGPLQQDYISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQXXXXXXXXXXXXXXXASDNENYDRAKVKKQQIDQYRHRIYKELDALEFLNMPVNLQKPALKFEKPIVEPELYSQRGYNQNNNALIAEEPRMYPNPEDRPLPALKNQPIEVLPSQRNDFREPIPEKSFIASPEPALFTGDEIDSEEINAMTKSDLSEASEAIEVYGLPLVSKVYSKNWTHQENALLEIEKRLTEMPSDMDKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKXXXXXXXXXXGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYSIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDGINPFVNKNNKINDQESARQKELDNNQVEQKPKEPVRTKPVKQLNKKQSIHPNIQKEPQSSRTAQQKPSQQISAPAPAHASGNLAKLELQDDPTLDWNTTCIFCGEKNESLKDNMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPADQKNSIRCPLCHENITLGQFVDSPEALWQYHLMDETNGCPQNPRRLVAIQRQHQQXXXXXXXXXXXXXXXXXXRKSQLPRAKGK 2720
            MPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNAKFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIGDELFSVNKDEIENFNGPLQQDYISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQEVGEKLGKLEIEKKIASDNENYDRAKVKKQQIDQYRHRIYKELDALEFLNMPVNLQKPALKFEKPIVEPELYSQRGYNQNNNALIAEEPRMYPNPEDRPLPALKNQPIEVLPSQRNDFREPIPEKSFIASP+PALFTGDEIDSEEINAMTKSDLSEASEAIEVYGLPLVSKVYSKNWTHQENALLEIEKRLTEMPSD+DKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKL+LLELVERLGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYSIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDGINPFVNKNNKINDQESARQKELDNNQVEQKPKEPVRTKPVKQLNKK +IHPNIQKEPQSSRTAQQKPSQQISAPAPAHA  NLAKLELQDDPTLDWNTTCIFCGEKNESLKDNMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPADQKNSIRCPLCHENITLGQFVDSPEALWQYHLMDETNGCPQNPRRLVAIQRQHQQNETNNKNNNIGARQNNNNRKSQLPRAKGK
Sbjct:    1 MPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANFCLYPQDIVISLEHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNAKFTRLGYVSLSDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNLIGDELFSVNKDEIENFNGPLQQDYISHTEDLAFDISVDPETAQIIRNLEKLKVQAVEEEQFDKASKIRDTVKYLQEVGEKLGKLEIEKKIASDNENYDRAKVKKQQIDQYRHRIYKELDALEFLNMPVNLQKPALKFEKPIVEPELYSQRGYNQNNNALIAEEPRMYPNPEDRPLPALKNQPIEVLPSQRNDFREPIPEKSFIASPDPALFTGDEIDSEEINAMTKSDLSEASEAIEVYGLPLVSKVYSKNWTHQENALLEIEKRLTEMPSDIDKDDVKAEIRATACLLKKAFKSRVTKVVQVACNVNKLILLELVERLGIAKPEVHYYLDKIIPEIFKCVEDNKAQIREITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYSIHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVRSYLPPDDMKTRKNVLYKRLFEKLDKIDGINPFVNKNNKINDQESARQKELDNNQVEQKPKEPVRTKPVKQLNKKPNIHPNIQKEPQSSRTAQQKPSQQISAPAPAHAPSNLAKLELQDDPTLDWNTTCIFCGEKNESLKDNMDLHYWKNCPILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQHISDALCNPADQKNSIRCPLCHENITLGQFVDSPEALWQYHLMDETNGCPQNPRRLVAIQRQHQQNETNNKNNNIGARQNNNNRKSQLPRAKGK 893          
The following BLAST results are available for this feature:
BLAST of Centrosomal protein 104 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CEP1042.616e-17036.64centrosomal protein 104 [Source:HGNC Symbol;Acc:HG... [more]
CEP1049.897e-4851.95centrosomal protein 104 [Source:HGNC Symbol;Acc:HG... [more]
CEP1047.941e-3844.86centrosomal protein 104 [Source:HGNC Symbol;Acc:HG... [more]
CEP1044.710e-3547.74centrosomal protein 104 [Source:HGNC Symbol;Acc:HG... [more]
CEP1043.498e-3142.77centrosomal protein 104 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Centrosomal protein 104 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
T06D8.29.687e-826.80pep chromosome:WBcel235:II:11226679:11232835:1 gen... [more]
back to top
BLAST of Centrosomal protein 104 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG101371.606e-3533.22gene:FBgn0032800 transcript:FBtr0081248[more]
back to top
BLAST of Centrosomal protein 104 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cep1043.945e-16334.27centrosomal protein 104 [Source:ZFIN;Acc:ZDB-GENE-... [more]
cep1042.092e-16234.08centrosomal protein 104 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Centrosomal protein 104 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc11a16.310e-17335.63solute carrier family 11 member 1 [Source:Xenbase;... [more]
slc11a11.596e-16636.02solute carrier family 11 member 1 [Source:Xenbase;... [more]
slc11a18.126e-16435.96solute carrier family 11 member 1 [Source:Xenbase;... [more]
slc11a14.921e-16135.80solute carrier family 11 member 1 [Source:Xenbase;... [more]
slc11a14.556e-16035.56solute carrier family 11 member 1 [Source:Xenbase;... [more]
back to top
BLAST of Centrosomal protein 104 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Cep1042.238e-15635.15centrosomal protein 104 [Source:MGI Symbol;Acc:MGI... [more]
Cep1044.816e-7934.62centrosomal protein 104 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Centrosomal protein 104 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|O60308|CE104_HUMAN1.256e-16936.64Centrosomal protein of 104 kDa OS=Homo sapiens OX=... [more]
sp|D3Z8X7|CE104_RAT9.705e-15735.29Centrosomal protein of 104 kDa OS=Rattus norvegicu... [more]
sp|Q80V31|CE104_MOUSE1.565e-15535.15Centrosomal protein of 104 kDa OS=Mus musculus OX=... [more]
back to top
BLAST of Centrosomal protein 104 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8IIY90.000e+041.25UVR domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8GJZ30.000e+041.25UVR domain-containing protein OS=Macrostomum ligna... [more]
A0A210QD890.000e+039.75UVR domain-containing protein OS=Mizuhopecten yess... [more]
A0A2C9LW300.000e+038.76TOG domain-containing protein OS=Biomphalaria glab... [more]
R7TP870.000e+040.71TOG domain-containing protein OS=Capitella teleta ... [more]
back to top
BLAST of Centrosomal protein 104 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cep1042.291e-12834.33centrosomal protein 104 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Centrosomal protein 104 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cep1041.302e-15433.12centrosomal protein 104 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Centrosomal protein 104 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein 104 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO384447.537e-4530.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363214.182e-3345.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384421.119e-1161.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Centrosomal protein 104 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cep1042.672e-13833.07centrosomal protein 104 [Source:NCBI gene;Acc:1011... [more]
cep1044.843e-13833.04centrosomal protein 104 [Source:NCBI gene;Acc:1011... [more]
cep1044.917e-13833.00centrosomal protein 104 [Source:NCBI gene;Acc:1011... [more]
cep1046.199e-13232.87centrosomal protein 104 [Source:NCBI gene;Acc:1011... [more]
cep1045.818e-13031.60centrosomal protein 104 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Centrosomal protein 104 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000023549.10.000e+099.22SMESG000023549.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020291 ID=SMED30020291|Name=Centrosomal protein 104|organism=Schmidtea mediterranea sexual|type=transcript|length=2871bp
CACAAACACTTTAAATTTGTCAATTATATTTTAAAACTTCTATGCCACAC
AAATTACCGTTTCGAGTTATTCATGCAACAAGTCAAGAGGATTACCACAA
AGCCAGTGAAATAAGTAATCATACACCAACATCAAAAGGATGGCAGTCTG
CAAATTTTTGTCTATATCCGCAGGATATAGTTATTTCCTTAGAACATCGA
TGTCAAATTAAAAAAATACAACTTTTGTCTCATCAATGTTTAATTGCAAC
TAAAATCGAATTCTTCGTTGGGGATTGTCCGAATAATGTTCAATTTTCTC
CTTCTAATGCTAAATTTACAAGATTGGGCTATGTTTCGTTGTCTGACAAT
GAAAAAACACAATTCAAAGCCAGAGAACTGAAATCCGTTCATGTTGATGC
CATTTGCAGATTCGTTAAATTAGTCGTCCACACGAACTTTATTAATAAAT
TTAATCACTATAACCAAGTTGGAATAATAGCGGTGAATTTAATCGGAGAT
GAATTATTTTCTGTCAATAAAGATGAAATTGAAAATTTCAATGGCCCTCT
ACAACAAGACTATATTTCTCATACCGAAGATCTTGCTTTTGACATATCGG
TTGACCCAGAAACTGCACAAATTATACGAAATCTAGAAAAATTAAAAGTT
CAAGCAGTAGAAGAGGAACAATTTGATAAAGCATCTAAAATCCGGGACAC
GGTTAAGTATTTACAAGAAGTTGGGGAAAAGTTAGGTAAACTTGAGATTG
AAAAGAAAATTGCAAGCGATAATGAAAACTATGATCGAGCCAAAGTCAAA
AAGCAGCAAATAGATCAGTACAGACACCGCATATATAAAGAATTAGACGC
TCTTGAATTTTTAAATATGCCAGTTAATTTACAGAAGCCGGCACTGAAAT
TTGAAAAACCGATTGTGGAGCCAGAATTGTATAGTCAGCGAGGATACAAT
CAAAATAACAATGCATTAATTGCTGAAGAACCGAGAATGTATCCTAATCC
CGAAGACAGACCTTTACCAGCACTGAAAAACCAACCAATAGAAGTTCTAC
CATCACAAAGAAATGATTTTCGAGAACCAATTCCTGAAAAATCTTTTATT
GCAAGTCCTGAACCCGCATTATTTACTGGTGATGAAATTGACAGTGAGGA
AATAAATGCAATGACAAAAAGTGATTTATCTGAAGCTTCGGAAGCTATTG
AAGTCTACGGATTGCCTTTGGTTTCAAAGGTTTATAGCAAGAATTGGACT
CATCAAGAAAATGCATTGCTTGAAATAGAGAAAAGACTAACTGAGATGCC
GAGTGACATGGACAAAGATGATGTTAAAGCTGAAATAAGAGCAACAGCTT
GCTTGCTGAAAAAGGCGTTTAAGAGCAGAGTTACAAAAGTTGTTCAAGTA
GCGTGCAATGTTAACAAGTTGGTCCTTTTAGAACTGGTGGAACGTCTTGG
AATAGCTAAGCCTGAAGTTCATTATTATTTGGACAAGATAATTCCCGAAA
TATTTAAATGCGTTGAAGATAATAAAGCCCAGATACGAGAAATCACTCAA
AATTATTTGATCGAAATGAGTCAATGGGATCACGTTAGACAATTTCCAAC
AATTTTTTCTGAAGCAATCAAGCCATTCAGTCCGAATATATTAGCCAGAC
CGGGTCAAATAAAATTGGAATTATTATTAGAGCTTTATTCGATCCATCGG
TTAACTAATCACTATTTTACACTTGACAATTTTATGAAATACGCAGTTCA
CGCATTGCAACATAAATCCGCGGAATTAAGAGAGAGTGCAGAAACACTTA
TTGTTGTATTATATCGGAATGAAGATAAAGAAGTCGTACGAAGTTACTTA
CCTCCCGATGATATGAAGACTAGAAAAAATGTCCTATACAAAAGGTTGTT
TGAAAAGTTAGACAAAATTGATGGTATCAATCCTTTTGTTAACAAAAACA
ACAAAATTAATGATCAAGAATCAGCAAGACAAAAAGAATTAGACAATAAT
CAAGTCGAGCAAAAACCAAAGGAGCCTGTTAGAACCAAGCCAGTGAAACA
ACTCAATAAAAAACAAAGTATTCACCCAAATATACAGAAAGAGCCTCAGA
GCAGCAGAACTGCCCAGCAAAAACCATCTCAACAGATTTCAGCTCCGGCT
CCAGCTCATGCTTCTGGCAATCTTGCGAAATTGGAATTACAAGATGATCC
AACACTTGATTGGAATACAACGTGCATTTTCTGTGGGGAGAAAAATGAAT
CATTAAAGGATAACATGGACTTGCATTATTGGAAAAACTGTCCTATTTTA
AGAAGATGTCCTTATTGTAAACAAGCTGTGGAAATTTCATCACTCACTCA
ACATTTCCTTCAAGAATGTGAGCAAGAATCTCAGTTTGGTCAATGTCCCC
GTTGTACTGAAGCAATATTAAAAACAGAGCTTGATCAACATATATCTGAT
GCTTTATGCAATCCGGCGGATCAGAAGAATTCAATTCGTTGTCCATTGTG
TCATGAAAATATTACCCTCGGTCAATTTGTGGATTCTCCCGAGGCGTTGT
GGCAATACCACTTGATGGACGAGACAAATGGTTGTCCACAGAATCCCCGG
CGATTAGTAGCCATTCAGAGACAACACCAACAGAATGAAACCAATAATAA
AAACAACAATATCGGTGCCAGGCAGAATAACAACAATCGTAAATCTCAGT
TGCCGCGGGCAAAAGGAAAATAAAATTTTTATGATTTTTTGTTTATGAAA
CTTATTTTTGAATGTTACAGTTTCTGTGTAATAAATTCGAATTTTGTACT
TTTTATAAATTTCAGCCAATCAAATGTCATATTTTTTTGGATTAATATAA
ACAATTTTCATTGGAAAAAAA
back to top

protein sequence of SMED30020291-orf-1

>SMED30020291-orf-1 ID=SMED30020291-orf-1|Name=SMED30020291-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=894bp
MPHKLPFRVIHATSQEDYHKASEISNHTPTSKGWQSANFCLYPQDIVISL
EHRCQIKKIQLLSHQCLIATKIEFFVGDCPNNVQFSPSNAKFTRLGYVSL
SDNEKTQFKARELKSVHVDAICRFVKLVVHTNFINKFNHYNQVGIIAVNL
IGDELFSVNKDEIENFNGPLQQDYISHTEDLAFDISVDPETAQIIRNLEK
LKVQAVEEEQFDKASKIRDTVKYLQEVGEKLGKLEIEKKIASDNENYDRA
KVKKQQIDQYRHRIYKELDALEFLNMPVNLQKPALKFEKPIVEPELYSQR
GYNQNNNALIAEEPRMYPNPEDRPLPALKNQPIEVLPSQRNDFREPIPEK
SFIASPEPALFTGDEIDSEEINAMTKSDLSEASEAIEVYGLPLVSKVYSK
NWTHQENALLEIEKRLTEMPSDMDKDDVKAEIRATACLLKKAFKSRVTKV
VQVACNVNKLVLLELVERLGIAKPEVHYYLDKIIPEIFKCVEDNKAQIRE
ITQNYLIEMSQWDHVRQFPTIFSEAIKPFSPNILARPGQIKLELLLELYS
IHRLTNHYFTLDNFMKYAVHALQHKSAELRESAETLIVVLYRNEDKEVVR
SYLPPDDMKTRKNVLYKRLFEKLDKIDGINPFVNKNNKINDQESARQKEL
DNNQVEQKPKEPVRTKPVKQLNKKQSIHPNIQKEPQSSRTAQQKPSQQIS
APAPAHASGNLAKLELQDDPTLDWNTTCIFCGEKNESLKDNMDLHYWKNC
PILRRCPYCKQAVEISSLTQHFLQECEQESQFGQCPRCTEAILKTELDQH
ISDALCNPADQKNSIRCPLCHENITLGQFVDSPEALWQYHLMDETNGCPQ
NPRRLVAIQRQHQQNETNNKNNNIGARQNNNNRKSQLPRAKGK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR034085TOG
IPR011989ARM-like
IPR036876UVR_dom_sf
IPR001943UVR_dom
IPR008979Galactose-bd-like_sf
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005488binding
GO:0016594glycine binding
GO:0016595glutamate binding
GO:0016596thienylcyclohexylpiperidine binding
Vocabulary: cellular component
TermDefinition
GO:0000922spindle pole
GO:0005737cytoplasm
GO:0005814centriole
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
GO:0005929cilium
GO:0042995cell projection
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 224..244
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 861..887
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 642..708
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 861..893
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 675..704
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 642..668
NoneNo IPR availablePANTHERPTHR13371GLYCINE-, GLUTAMATE-, THIENYLCYCLOHEXYLPIPERIDINE-BINDING PROTEINcoord: 1..807
IPR034085TOG domainSMARTSM01349TOG_3coord: 378..632
e-value: 3.2E-5
score: 33.4
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 4..147
e-value: 1.2E-6
score: 30.5
IPR008979Galactose-binding-like domain superfamilySUPERFAMILYSSF49785Galactose-binding domain-likecoord: 4..151
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 378..638
e-value: 2.1E-21
score: 78.9
IPR001943UVR domainPFAMPF02151UVRcoord: 194..226
e-value: 1.9E-6
score: 27.4
IPR001943UVR domainPROSITEPS50151UVRcoord: 192..227
score: 10.115
IPR036876UVR domain superfamilySUPERFAMILYSSF46600C-terminal UvrC-binding domain of UvrBcoord: 188..229
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 392..605