Pyruvate kinase

Overview
NamePyruvate kinase
Smed IDSMED30020273
Length (bp)2114
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pyruvate kinase (SMED30020273) t-SNE clustered cells

Violin plots show distribution of expression levels for Pyruvate kinase (SMED30020273) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pyruvate kinase (SMED30020273) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pyruvate kinase (SMED30020273) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020273

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30020273SMESG000063570.1 dd_Smed_v4_1511_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30020273SMESG000063570.1 dd_Smed_v4_1511_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30020273SMESG000063570.1 dd_Smed_v4_1511_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30020273SMESG000063570.1 dd_Smed_v4_1511_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020273SMESG000063570.1 dd_Smed_v4_1511_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30020273SMESG000063570.1 dd_Smed_v6_1511_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020273SMESG000063570.1 dd_Smed_v6_1511_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020273SMESG000063570.1 dd_Smed_v4_1511_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pyruvate kinase vs. Ensembl Human
Match: PKM (pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:9021])

HSP 1 Score: 468.389 bits (1204), Expect = 6.869e-158
Identity = 248/530 (46.79%), Postives = 351/530 (66.23%), Query Frame = 1
Query:   34 AEAYLYQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKN-----ACVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            A     QTQ Q ++  A + L+H+C+LDID  P   R T IICTIG +S + E L+E+I++GMN+ARLN + G+  Y+++ I  +R   +   +       VA+A+D   P +RTGL+     AEVELK+G  +++T+D+ Y   C+   +W+D   ++N+   ++ G +I++DDG I + V++ G +     VE GG LGS K   LP  A+   A S    Q+L F +E  VDM+F+SFI   +DV  +++V+G  G+ IKI++KIE   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC  A KPV+  TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E ++  H + REAE+AMFHR+LF +L    ASSH  D  +  A+ +VEAS K  A+ +IV+T SGRSA  +A YRP+ P+I VTR  Q ARQ HL+RG+ P++  +   + W+ED+DLR+N+A+  G +RGF K GD VI++TGW  G+G TNT+RV  VP
Sbjct:    8 AGTAFIQTQ-QLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLD---YKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELV--RASSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP 531          
BLAST of Pyruvate kinase vs. Ensembl Human
Match: PKM (pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:9021])

HSP 1 Score: 468.389 bits (1204), Expect = 6.869e-158
Identity = 248/530 (46.79%), Postives = 351/530 (66.23%), Query Frame = 1
Query:   34 AEAYLYQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKN-----ACVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            A     QTQ Q ++  A + L+H+C+LDID  P   R T IICTIG +S + E L+E+I++GMN+ARLN + G+  Y+++ I  +R   +   +       VA+A+D   P +RTGL+     AEVELK+G  +++T+D+ Y   C+   +W+D   ++N+   ++ G +I++DDG I + V++ G +     VE GG LGS K   LP  A+   A S    Q+L F +E  VDM+F+SFI   +DV  +++V+G  G+ IKI++KIE   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC  A KPV+  TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E ++  H + REAE+AMFHR+LF +L    ASSH  D  +  A+ +VEAS K  A+ +IV+T SGRSA  +A YRP+ P+I VTR  Q ARQ HL+RG+ P++  +   + W+ED+DLR+N+A+  G +RGF K GD VI++TGW  G+G TNT+RV  VP
Sbjct:    8 AGTAFIQTQ-QLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLD---YKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELV--RASSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP 531          
BLAST of Pyruvate kinase vs. Ensembl Human
Match: PKM (pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:9021])

HSP 1 Score: 468.389 bits (1204), Expect = 6.869e-158
Identity = 248/530 (46.79%), Postives = 351/530 (66.23%), Query Frame = 1
Query:   34 AEAYLYQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKN-----ACVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            A     QTQ Q ++  A + L+H+C+LDID  P   R T IICTIG +S + E L+E+I++GMN+ARLN + G+  Y+++ I  +R   +   +       VA+A+D   P +RTGL+     AEVELK+G  +++T+D+ Y   C+   +W+D   ++N+   ++ G +I++DDG I + V++ G +     VE GG LGS K   LP  A+   A S    Q+L F +E  VDM+F+SFI   +DV  +++V+G  G+ IKI++KIE   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC  A KPV+  TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E ++  H + REAE+AMFHR+LF +L    ASSH  D  +  A+ +VEAS K  A+ +IV+T SGRSA  +A YRP+ P+I VTR  Q ARQ HL+RG+ P++  +   + W+ED+DLR+N+A+  G +RGF K GD VI++TGW  G+G TNT+RV  VP
Sbjct:    8 AGTAFIQTQ-QLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLD---YKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELV--RASSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP 531          
BLAST of Pyruvate kinase vs. Ensembl Human
Match: PKM (pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:9021])

HSP 1 Score: 468.389 bits (1204), Expect = 6.869e-158
Identity = 248/530 (46.79%), Postives = 351/530 (66.23%), Query Frame = 1
Query:   34 AEAYLYQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKN-----ACVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            A     QTQ Q ++  A + L+H+C+LDID  P   R T IICTIG +S + E L+E+I++GMN+ARLN + G+  Y+++ I  +R   +   +       VA+A+D   P +RTGL+     AEVELK+G  +++T+D+ Y   C+   +W+D   ++N+   ++ G +I++DDG I + V++ G +     VE GG LGS K   LP  A+   A S    Q+L F +E  VDM+F+SFI   +DV  +++V+G  G+ IKI++KIE   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC  A KPV+  TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E ++  H + REAE+AMFHR+LF +L    ASSH  D  +  A+ +VEAS K  A+ +IV+T SGRSA  +A YRP+ P+I VTR  Q ARQ HL+RG+ P++  +   + W+ED+DLR+N+A+  G +RGF K GD VI++TGW  G+G TNT+RV  VP
Sbjct:    8 AGTAFIQTQ-QLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLD---YKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELV--RASSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP 531          
BLAST of Pyruvate kinase vs. Ensembl Human
Match: PKM (pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:9021])

HSP 1 Score: 463.766 bits (1192), Expect = 3.878e-156
Identity = 246/530 (46.42%), Postives = 350/530 (66.04%), Query Frame = 1
Query:   34 AEAYLYQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKN-----ACVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            A     QTQ Q ++  A + L+H+C+LDID  P   R T IICTIG +S + E L+E+I++GMN+ARLN + G+  Y+++ I  +R   +   +       VA+A+D   P +RTGL+     AEVELK+G  +++T+D+ Y   C+   +W+D   ++N+   ++ G +I++DDG I + V++ G +     VE GG LGS K   LP  A+   A S    Q+L F +E  VDM+F+SFI   +DV  +++V+G  G+ IKI++KIE   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC  A KPV+  TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E ++  H + REAE+A++H QLF +L+    +    DPT+ TA+ AVEAS K  +  IIV+T SGRSA  +A YRP+ P+I VTR  Q ARQ HL+RG+ P++  +   + W+ED+DLR+N+A+  G +RGF K GD VI++TGW  G+G TNT+RV  VP
Sbjct:    8 AGTAFIQTQ-QLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLD---YKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELR--RLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP 531          
BLAST of Pyruvate kinase vs. Ensembl Celegans
Match: pyk-2 (Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q23539])

HSP 1 Score: 427.172 bits (1097), Expect = 1.710e-142
Identity = 224/505 (44.36%), Postives = 328/505 (64.95%), Query Frame = 1
Query:   82 AHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNACVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRV 1596
            A + + H+C L I  +P   R+T +ICTIG +    E LR++I  GMNIARLN + G+   ++  I  IR    E     VAIA+D   P +RTG+  N+ M EV+L+ G+ + ++ D   +    S +I+ D   +RN+   ++ G RI+IDDG I +IV      +  C +E GG LG+ K   LP   +   A +    ++LLF +E  VD+IF+SFI +   + +I++V+G  G+ I I+AKIE+++G+ + DEI+E +D +M+ RGDLG+E+P EKVF+AQK +IA+C +A KPV+  TQMLESM  KPR TRAE SDVANAVLDG D ++LS ETA+G YPVE L  MH +C+EAESA FH + F +L +H      +  T TTAIAAV A+   +A  II++TT+G++A L + YRP  P+ITV+R  +++RQ HL RG+ P+ Y + + D+W  D++ R+ Y +  G +RGF+  GDP+I++TGW  G G TNT+R+
Sbjct:   12 ATTNISHLCGLRISERPQKTRKTGVICTIGPACSDVETLRKMINTGMNIARLNFSHGTHEAHAATIKTIRE-AAENAPFPVAIALDTKGPEIRTGMFANN-MKEVQLENGKSVRVSTDPSMEFAATSSHIYAD---YRNLPKVVQPGSRIYIDDGLISLIVESCEETAVICTIENGGALGTRKGVNLPGTIVDLPAVTSKDIEDLLFGVEQGVDIIFASFIRNADGIHKIRQVLGEKGKHIYIIAKIESEDGVTNCDEIIEASDGVMVARGDLGIEIPAEKVFLAQKMLIAKCNLAGKPVICATQMLESMITKPRPTRAECSDVANAVLDGVDCVMLSGETAKGDYPVEALAIMHNICKEAESAFFHMKHFEELILHTKKPTGM--THTTAIAAVSATITCRAVAIILITTTGKTARLCSRYRPPVPIITVSRDERISRQLHLHRGIFPVYYPKGRIDEWDVDVEERVQYGVNLGKTRGFIHLGDPLIVITGWKQGAGFTNTMRI 509          
BLAST of Pyruvate kinase vs. Ensembl Celegans
Match: pyk-2 (Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q23539])

HSP 1 Score: 426.787 bits (1096), Expect = 2.032e-142
Identity = 224/505 (44.36%), Postives = 328/505 (64.95%), Query Frame = 1
Query:   82 AHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNACVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRV 1596
            A + + H+C L I  +P   R+T +ICTIG +    E LR++I  GMNIARLN + G+   ++  I  IR    E     VAIA+D   P +RTG+  N+ M EV+L+ G+ + ++ D   +    S +I+ D   +RN+   ++ G RI+IDDG I +IV      +  C +E GG LG+ K   LP   +   A +    ++LLF +E  VD+IF+SFI +   + +I++V+G  G+ I I+AKIE+++G+ + DEI+E +D +M+ RGDLG+E+P EKVF+AQK +IA+C +A KPV+  TQMLESM  KPR TRAE SDVANAVLDG D ++LS ETA+G YPVE L  MH +C+EAESA FH + F +L +H      +  T TTAIAAV A+   +A  II++TT+G++A L + YRP  P+ITV+R  +++RQ HL RG+ P+ Y + + D+W  D++ R+ Y +  G +RGF+  GDP+I++TGW  G G TNT+R+
Sbjct:   14 ATTNISHLCGLRISERPQKTRKTGVICTIGPACSDVETLRKMINTGMNIARLNFSHGTHEAHAATIKTIRE-AAENAPFPVAIALDTKGPEIRTGMFANN-MKEVQLENGKSVRVSTDPSMEFAATSSHIYAD---YRNLPKVVQPGSRIYIDDGLISLIVESCEETAVICTIENGGALGTRKGVNLPGTIVDLPAVTSKDIEDLLFGVEQGVDIIFASFIRNADGIHKIRQVLGEKGKHIYIIAKIESEDGVTNCDEIIEASDGVMVARGDLGIEIPAEKVFLAQKMLIAKCNLAGKPVICATQMLESMITKPRPTRAECSDVANAVLDGVDCVMLSGETAKGDYPVEALAIMHNICKEAESAFFHMKHFEELILHTKKPTGM--THTTAIAAVSATITCRAVAIILITTTGKTARLCSRYRPPVPIITVSRDERISRQLHLHRGIFPVYYPKGRIDEWDVDVEERVQYGVNLGKTRGFIHLGDPLIVITGWKQGAGFTNTMRI 511          
BLAST of Pyruvate kinase vs. Ensembl Celegans
Match: pyk-1 (Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q7JL40])

HSP 1 Score: 426.402 bits (1095), Expect = 4.701e-142
Identity = 237/523 (45.32%), Postives = 340/523 (65.01%), Query Frame = 1
Query:   37 EAYLYQTQEQQYSK-DAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNA-CVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVF 1599
            EA  Y  QEQ+ +   A + ++H+C+LDI   P  +RQT IICTIG +  + E L++LI NGMNIARLN + GS  Y++  I  +R       +   + IA+D   P +RTGL+     AE+EL  G  I LT D  +     + N++VD   ++N+   +  G R++IDDG I +IV E   ++  C VE GG LGS K   LP   +   A S    ++L F +E  VD+IF+SFI +   +  I++V+G  G+ IKI+AKIE + G+ + DEI+ E+D +M+ RGDLG+E+P EKVF+AQK +I++C  A KPV+  TQMLESM +KPR TRAE SDVANAVLDGAD ++LS ETA+G YPV+ L+ MH +C+EAE+A++HR+LF +L   + +    D + T AIAA  A++   AS I+++TT+GRSA   + Y+P  P++T++R V V RQ HL+RG+ P+ Y   +A DW  D+D RIN+AI  G  RGF+  GD +++VTGW  G G+TNT+R+ 
Sbjct:   11 EASGYDKQEQKLAAVPATTHMEHLCRLDIREAPHLVRQTGIICTIGPACASVEMLQKLILNGMNIARLNFSHGSHEYHAGTIANVREAADSFSDKRVIGIALDTKGPEIRTGLLAGGASAEIELARGASIRLTTDPHFSESGTAVNLFVD---YKNIAKVLSVGSRVYIDDGLISLIVEELQTDAVICSVENGGMLGSRKGVNLPGTIVDLPAVSEKDCKDLQFGVEQGVDIIFASFIRNAEGIRTIRKVLGEKGKKIKIIAKIENQEGVDNADEIISESDGVMVARGDLGIEIPAEKVFLAQKMLISKCNRAGKPVICATQMLESMVHKPRPTRAEGSDVANAVLDGADCVMLSGETAKGEYPVDALKIMHYICKEAEAAVYHRRLFDELL--QNTQKPTDMSHTIAIAATSAAASCHASAILLITTTGRSAIQCSRYKPAVPILTISRDVAVCRQLHLYRGVFPVHYPAERAADWPTDVDNRINHAIAIGKDRGFIHKGDFLVVVTGWRQGAGATNTLRII 528          
BLAST of Pyruvate kinase vs. Ensembl Celegans
Match: pyk-1 (Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q7JL40])

HSP 1 Score: 426.402 bits (1095), Expect = 4.701e-142
Identity = 237/523 (45.32%), Postives = 340/523 (65.01%), Query Frame = 1
Query:   37 EAYLYQTQEQQYSK-DAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNA-CVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVF 1599
            EA  Y  QEQ+ +   A + ++H+C+LDI   P  +RQT IICTIG +  + E L++LI NGMNIARLN + GS  Y++  I  +R       +   + IA+D   P +RTGL+     AE+EL  G  I LT D  +     + N++VD   ++N+   +  G R++IDDG I +IV E   ++  C VE GG LGS K   LP   +   A S    ++L F +E  VD+IF+SFI +   +  I++V+G  G+ IKI+AKIE + G+ + DEI+ E+D +M+ RGDLG+E+P EKVF+AQK +I++C  A KPV+  TQMLESM +KPR TRAE SDVANAVLDGAD ++LS ETA+G YPV+ L+ MH +C+EAE+A++HR+LF +L   + +    D + T AIAA  A++   AS I+++TT+GRSA   + Y+P  P++T++R V V RQ HL+RG+ P+ Y   +A DW  D+D RIN+AI  G  RGF+  GD +++VTGW  G G+TNT+R+ 
Sbjct:   11 EASGYDKQEQKLAAVPATTHMEHLCRLDIREAPHLVRQTGIICTIGPACASVEMLQKLILNGMNIARLNFSHGSHEYHAGTIANVREAADSFSDKRVIGIALDTKGPEIRTGLLAGGASAEIELARGASIRLTTDPHFSESGTAVNLFVD---YKNIAKVLSVGSRVYIDDGLISLIVEELQTDAVICSVENGGMLGSRKGVNLPGTIVDLPAVSEKDCKDLQFGVEQGVDIIFASFIRNAEGIRTIRKVLGEKGKKIKIIAKIENQEGVDNADEIISESDGVMVARGDLGIEIPAEKVFLAQKMLISKCNRAGKPVICATQMLESMVHKPRPTRAEGSDVANAVLDGADCVMLSGETAKGEYPVDALKIMHYICKEAEAAVYHRRLFDELL--QNTQKPTDMSHTIAIAATSAAASCHASAILLITTTGRSAIQCSRYKPAVPILTISRDVAVCRQLHLYRGVFPVHYPAERAADWPTDVDNRINHAIAIGKDRGFIHKGDFLVVVTGWRQGAGATNTLRII 528          
BLAST of Pyruvate kinase vs. Ensembl Celegans
Match: pyk-1 (Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q7JL40])

HSP 1 Score: 424.091 bits (1089), Expect = 9.877e-141
Identity = 235/519 (45.28%), Postives = 338/519 (65.13%), Query Frame = 1
Query:   49 YQTQEQQYSK-DAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNA-CVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVF 1599
            Y  QEQ+ +   A + ++H+C+LDI   P  +RQT IICTIG +  + E L++LI NGMNIARLN + GS  Y++  I  +R       +   + IA+D   P +RTGL+     AE+EL  G  I LT D  +     + N++VD   ++N+   +  G R++IDDG I +IV E   ++  C VE GG LGS K   LP   +   A S    ++L F +E  VD+IF+SFI +   +  I++V+G  G+ IKI+AKIE + G+ + DEI+ E+D +M+ RGDLG+E+P EKVF+AQK +I++C  A KPV+  TQMLESM +KPR TRAE SDVANAVLDGAD ++LS ETA+G YPV+ L+ MH +C+EAE+A++HR+LF +L   + +    D + T AIAA  A++   AS I+++TT+GRSA   + Y+P  P++T++R V V RQ HL+RG+ P+ Y   +A DW  D+D RIN+AI  G  RGF+  GD +++VTGW  G G+TNT+R+ 
Sbjct:   42 YFKQEQKLAAVPATTHMEHLCRLDIREAPHLVRQTGIICTIGPACASVEMLQKLILNGMNIARLNFSHGSHEYHAGTIANVREAADSFSDKRVIGIALDTKGPEIRTGLLAGGASAEIELARGASIRLTTDPHFSESGTAVNLFVD---YKNIAKVLSVGSRVYIDDGLISLIVEELQTDAVICSVENGGMLGSRKGVNLPGTIVDLPAVSEKDCKDLQFGVEQGVDIIFASFIRNAEGIRTIRKVLGEKGKKIKIIAKIENQEGVDNADEIISESDGVMVARGDLGIEIPAEKVFLAQKMLISKCNRAGKPVICATQMLESMVHKPRPTRAEGSDVANAVLDGADCVMLSGETAKGEYPVDALKIMHYICKEAEAAVYHRRLFDELL--QNTQKPTDMSHTIAIAATSAAASCHASAILLITTTGRSAIQCSRYKPAVPILTISRDVAVCRQLHLYRGVFPVHYPAERAADWPTDVDNRINHAIAIGKDRGFIHKGDFLVVVTGWRQGAGATNTLRII 555          
BLAST of Pyruvate kinase vs. Ensembl Fly
Match: PyK (gene:FBgn0267385 transcript:FBtr0084214)

HSP 1 Score: 472.626 bits (1215), Expect = 6.931e-160
Identity = 249/519 (47.98%), Postives = 356/519 (68.59%), Query Frame = 1
Query:   64 QQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNAC-----VAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYV 1605
            Q  +  A +QL+H+C+L  D    ++R + I+CTIG +S + E L +++  GMNIAR+N + GS  Y++  +  +R+  K           VAIA+D   P +RTGL+     AE+ELK+G++I+LT + ++    + E ++VD   + N++  +K G+R+F+DDG I +IVRE G +S  C VE GG LGS K   LP   +   A S   + +LLF +E +VDMIF+SFI + A +  I++V+G  G+ IKI++KIE + G+ +LDEI+E  D IM+ RGDLG+E+P EKVF+AQK++IARC  A KPV+  TQMLESM  KPR TRAEISDVANAVLDGAD ++LS ETA+G YP+E + TM + C+EAE+A++H+ LF DL +  A +  ID +   AIAAVEA++KAKAS I+V+TTSG+SA  ++ YRP+CP+I VTR  Q ARQ HL+RGL PL+Y E    DW +D+D+R+ + ++ G   GF+K GD V++VTGW  G+G TNT+R+  V
Sbjct:   20 QNMAAGADTQLEHMCRLQFDSPVPHVRLSGIVCTIGPASSSVEMLEKMMATGMNIARMNFSHGSHEYHAATVANVRQAVKNYSAKLGYEHPVAIALDTKGPEIRTGLIGGSGTAEIELKKGEKIKLTTNKEFLEKGSLEIVYVD---YENIVNVVKPGNRVFVDDGLISLIVREVGKDSLTCEVENGGSLGSRKGVNLPGVPVDLPAVSEKDKSDLLFGVEQEVDMIFASFIRNAAALTEIRKVLGEKGKNIKIISKIENQQGMHNLDEIIEAGDGIMVARGDLGIEIPAEKVFLAQKAMIARCNKAGKPVICATQMLESMVKKPRPTRAEISDVANAVLDGADCVMLSGETAKGEYPLECVLTMAKTCKEAEAALWHQNLFNDL-VRGAGT--IDASHAAAIAAVEAATKAKASAIVVITTSGKSAFQVSKYRPRCPIIAVTRFAQTARQAHLYRGLVPLIYKEPGLGDWLKDVDVRVQFGLQVGKKNGFIKTGDSVVVVTGWKQGSGFTNTIRIVTV 532          
BLAST of Pyruvate kinase vs. Ensembl Fly
Match: PyK (gene:FBgn0267385 transcript:FBtr0084213)

HSP 1 Score: 471.085 bits (1211), Expect = 1.621e-159
Identity = 248/513 (48.34%), Postives = 354/513 (69.01%), Query Frame = 1
Query:   82 AHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNAC-----VAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYV 1605
            A +QL+H+C+L  D    ++R + I+CTIG +S + E L +++  GMNIAR+N + GS  Y++  +  +R+  K           VAIA+D   P +RTGL+     AE+ELK+G++I+LT + ++    + E ++VD   + N++  +K G+R+F+DDG I +IVRE G +S  C VE GG LGS K   LP   +   A S   + +LLF +E +VDMIF+SFI + A +  I++V+G  G+ IKI++KIE + G+ +LDEI+E  D IM+ RGDLG+E+P EKVF+AQK++IARC  A KPV+  TQMLESM  KPR TRAEISDVANAVLDGAD ++LS ETA+G YP+E + TM + C+EAE+A++H+ LF DL +  A +  ID +   AIAAVEA++KAKAS I+V+TTSG+SA  ++ YRP+CP+I VTR  Q ARQ HL+RGL PL+Y E    DW +D+D+R+ + ++ G   GF+K GD V++VTGW  G+G TNT+R+  V
Sbjct:    5 ADTQLEHMCRLQFDSPVPHVRLSGIVCTIGPASSSVEMLEKMMATGMNIARMNFSHGSHEYHAATVANVRQAVKNYSAKLGYEHPVAIALDTKGPEIRTGLIGGSGTAEIELKKGEKIKLTTNKEFLEKGSLEIVYVD---YENIVNVVKPGNRVFVDDGLISLIVREVGKDSLTCEVENGGSLGSRKGVNLPGVPVDLPAVSEKDKSDLLFGVEQEVDMIFASFIRNAAALTEIRKVLGEKGKNIKIISKIENQQGMHNLDEIIEAGDGIMVARGDLGIEIPAEKVFLAQKAMIARCNKAGKPVICATQMLESMVKKPRPTRAEISDVANAVLDGADCVMLSGETAKGEYPLECVLTMAKTCKEAEAALWHQNLFNDL-VRGAGT--IDASHAAAIAAVEAATKAKASAIVVITTSGKSAFQVSKYRPRCPIIAVTRFAQTARQAHLYRGLVPLIYKEPGLGDWLKDVDVRVQFGLQVGKKNGFIKTGDSVVVVTGWKQGSGFTNTIRIVTV 511          
BLAST of Pyruvate kinase vs. Ensembl Fly
Match: CG2964 (gene:FBgn0031462 transcript:FBtr0077722)

HSP 1 Score: 358.992 bits (920), Expect = 1.614e-115
Identity = 201/514 (39.11%), Postives = 315/514 (61.28%), Query Frame = 1
Query:   76 KDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIR----RLEKEMKNA-CVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFY 1602
            K+  +QL H+C+LD+ ++ ++ R  ++I TI  SS   + +  +I  G+NI RLN +  S   +SK I +I     R+ KE      VAIA D   P +RTGL++ DV     L+ G  + L+I+    +  N E ++VD   + N+I   KTGDR+FIDDG +++ + E G++   C V  GG+L ++   ILP   +   A S     ++ F+++  VD +F+S + S  +V  ++ V+G  G+ IKI+AK+++K  +    EI+  AD +++ R DLG ++PIEK+F+ QKSI+ +C    KPV+V + +LESMR  P  TRAE  D+ANA++DGAD ++LS E A G +P ET+ T   +CREAE  ++ R LF DL + E    + D   + AIAAVE + +  A+ IIV+TTSGRSA+L++ +RP+CP++ +TR  + AR  +L RG+ P++YT   + D++ D+D R+ +A+      G +  GDP++IV+ W  G G TN VRV Y
Sbjct:   10 KEGSTQLSHICELDLAQQASHQRLVSLIATISVSSRNADTIYTMIMRGVNIFRLNFSHESHEMHSKTIELINEALERIHKETGQIRTVAIAADTRGPQIRTGLLDGDVF----LRSGDNLRLSINRDLYDKGNKEAVYVD---YPNIINLTKTGDRLFIDDGRLLLHILEVGVDGLLCEVIHGGQLNNNCNVILPEIEIDLPAVSEKDMFDIQFSIKANVDFLFASAVRSAKNVKELRTVLGEKGKHIKIIAKMDSKIALSRFSEILRAADGLLLSRADLGTQIPIEKLFITQKSILGQCNKVGKPVIVASHILESMRTLPHPTRAECFDLANAIIDGADCIMLSSEVAIGSFPKETVATCDTLCREAEKVLWFRDLFSDL-VSEVRGEL-DAAHSLAIAAVETAKRTNATLIIVLTTSGRSATLVSKFRPRCPIMAITRCERTARWVYLHRGVLPILYTLEPSTDYATDVDARVQFAMTSAKKWGIIDDGDPIVIVSAWKDGGGFTNNVRVVY 514          
BLAST of Pyruvate kinase vs. Ensembl Fly
Match: CG7069 (gene:FBgn0038952 transcript:FBtr0084215)

HSP 1 Score: 296.59 bits (758), Expect = 1.218e-89
Identity = 163/414 (39.37%), Postives = 250/414 (60.39%), Query Frame = 1
Query:  220 MNIARLNLTLGSFSYYSKIIHMIRR-----LEKEMKNACVAIAVDLVAPTVRTG-LVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTE 1443
            M + R+N + GS  Y+ + I   R+     +E+      +AIA+D   P +RTG L   +  AE+ELK G ++ L+   +  +  N +NI+VD   ++ +   +K G+R+F+DDG I +IV+E+  +   C VE GG+LGS K   LP   +   + +   +Q+L F  E +VDMIF+SFI     +  I++V+GP G  IKI++KIE   G+V++D+I+ E+D IM+ RGD+G+E+P E V +AQKSI+A+C    KPV+  TQM+ESM  KPR TRAE SDVANA+ DG D ++LS ETA+G YPVE +Q M R+C + E+ +++  L   LK  E  +   D       A  EA++  +A  I+V +     A +++  RP CP++ +T     A Q  L+RG++PL+  E
Sbjct:    1 MRVVRMNFSHGSHEYHCQTIQAARKAIAMYVEQTGLPRTLAIALDTKGPEIRTGKLAGGNDRAEIELKTGDKVTLSTKKEMADKSNKDNIYVD---YQRLPQLVKPGNRVFVDDGLIALIVKESKGDEVICQVENGGKLGSHKGINLPGVPVDLPSVTEKDKQDLKFGAEQKVDMIFASFIRDANALKEIRQVLGPAGACIKIISKIENHQGLVNIDDIIRESDGIMVARGDMGIEIPTEDVPLAQKSIVAKCNKVGKPVICATQMMESMTNKPRPTRAEASDVANAIFDGCDAVMLSGETAKGKYPVECVQCMARICAKVEAVLWYESLQNSLK-REIRTSAADHISAVTTAIAEAATVGQARAIVVASPCSMVAQMVSHMRPPCPIVMLTGNESEAAQSLLFRGIYPLLVEE 410          
BLAST of Pyruvate kinase vs. Ensembl Fly
Match: CG7362 (gene:FBgn0038258 transcript:FBtr0331700)

HSP 1 Score: 189.889 bits (481), Expect = 1.076e-50
Identity = 103/262 (39.31%), Postives = 163/262 (62.21%), Query Frame = 1
Query:  664 HAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIG--PVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTE 1443
            +A +   + +L F  + +VDMIF+SFI     +  I++ +G  P    IKI++KIE++  + ++DEI+ E+D IM+  G++G E+ +E V +AQKSI+A+C    KPV+   QM+ SM  KPR TRAE SDVANA+LDG D LVLS ETA+G YPV+ +Q M R+C + ES +++  +  +LK  E   +  D     + A  EA++ ++A  I+V +     + +++  RP CP++ +T     A Q  L+RG++PL+  E
Sbjct:  119 NAITEQDKLDLKFGADQKVDMIFASFIRDAKALKEIRQALGACPSSEHIKIISKIESQQALANIDEIIRESDGIMVALGNMGNEIALEAVPLAQKSIVAKCNKVGKPVICANQMMNSMITKPRPTRAESSDVANAILDGCDALVLSDETAKGKYPVQCVQCMARICAKVESVLWYESIQNNLK-SEVRINAADHISAVSTAIAEAATVSQAQAIVVASPCSIVSQMVSQMRPPCPIVLLTGCPHEAAQSLLFRGVYPLLVKE 379          
BLAST of Pyruvate kinase vs. Ensembl Zebrafish
Match: pkma (pyruvate kinase M1/2a [Source:ZFIN;Acc:ZDB-GENE-031201-4])

HSP 1 Score: 475.322 bits (1222), Expect = 9.081e-161
Identity = 250/524 (47.71%), Postives = 348/524 (66.41%), Query Frame = 1
Query:   52 QTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNAC-----VAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            QTQ Q  +  A + L+H+C LDID +P   R T IICTIG +S + + L+E+I++GMNIAR+N + GS  Y+ + I  +R      +        V IA+D   P +RTGL+     AEVELK+G +I++T+DD +  +C+ + +W+D   ++N+   ++ G +++IDDG I + V + G +   C +E GG LGS K   LP  A+   A S    ++L F +E  VDMIF+SFI   ADV  +++V+G  G+ IKI++K+E   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC  A KP++  TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E ++T H + REAE+AMFHRQ+F DL+         DP +  AI AVEAS K  +S  IV+T SGRSA LI+ YRP+ P++ VTR  Q ARQ HL+RG+ P+ Y     D W+ED+DLR+N+A++ G +RGF K GD VI++TGW  G+G TNT+RV  VP
Sbjct:   15 QTQ-QLNAAMADTFLEHMCLLDIDSEPTIARNTGIICTIGPASRSVDTLKEMIKSGMNIARMNFSHGSHEYHGETIKNVREACASFEPGSIQYRPVGIALDTKGPEIRTGLIKGSGTAEVELKKGNKIKVTLDDSFMENCDEDTLWLD---YKNITKVVEVGSKVYIDDGLISLQVLQIGSDYLICEIENGGSLGSKKGVNLPGAAVDLPAVSEKDIKDLQFGVEMGVDMIFASFIRKAADVQAVRKVLGEKGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNKAGKPIICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAAMFHRQVFEDLR--RCLPLSTDPAEAIAIGAVEASFKILSSAFIVLTGSGRSAHLISRYRPRAPILAVTRNEQTARQAHLYRGIFPIYYNSPSNDVWAEDVDLRVNFAMDVGKARGFFKAGDVVIVLTGWRPGSGYTNTMRVVPVP 532          
BLAST of Pyruvate kinase vs. Ensembl Zebrafish
Match: pkma (pyruvate kinase M1/2a [Source:ZFIN;Acc:ZDB-GENE-031201-4])

HSP 1 Score: 472.241 bits (1214), Expect = 1.449e-159
Identity = 249/524 (47.52%), Postives = 349/524 (66.60%), Query Frame = 1
Query:   52 QTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNAC-----VAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            QTQ Q  +  A + L+H+C LDID +P   R T IICTIG +S + + L+E+I++GMNIAR+N + GS  Y+ + I  +R      +        V IA+D   P +RTGL+     AEVELK+G +I++T+DD +  +C+ + +W+D   ++N+   ++ G +++IDDG I + V + G +   C +E GG LGS K   LP  A+   A S    ++L F +E  VDMIF+SFI   ADV  +++V+G  G+ IKI++K+E   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC  A KP++  TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E ++T H + REAE+A FHRQLF  L+   +S    DP+   A+ AVEAS K  AS II++T +GRSA LI+ YRP+ P++ VTR  Q ARQ HL+RG+ P+ Y     D W+ED+DLR+N+A++ G +RGF K GD VI++TGW  G+G TNT+RV  VP
Sbjct:   15 QTQ-QLNAAMADTFLEHMCLLDIDSEPTIARNTGIICTIGPASRSVDTLKEMIKSGMNIARMNFSHGSHEYHGETIKNVREACASFEPGSIQYRPVGIALDTKGPEIRTGLIKGSGTAEVELKKGNKIKVTLDDSFMENCDEDTLWLD---YKNITKVVEVGSKVYIDDGLISLQVLQIGSDYLICEIENGGSLGSKKGVNLPGAAVDLPAVSEKDIKDLQFGVEMGVDMIFASFIRKAADVQAVRKVLGEKGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNKAGKPIICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAATFHRQLFEGLR--RSSVLTRDPSDAVAVGAVEASFKCCASGIIILTKTGRSAHLISRYRPRAPILAVTRNEQTARQAHLYRGIFPIYYNSPSNDVWAEDVDLRVNFAMDVGKARGFFKAGDVVIVLTGWRPGSGYTNTMRVVPVP 532          
BLAST of Pyruvate kinase vs. Ensembl Zebrafish
Match: pkma (pyruvate kinase M1/2a [Source:ZFIN;Acc:ZDB-GENE-031201-4])

HSP 1 Score: 472.241 bits (1214), Expect = 1.449e-159
Identity = 249/524 (47.52%), Postives = 349/524 (66.60%), Query Frame = 1
Query:   52 QTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNAC-----VAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            QTQ Q  +  A + L+H+C LDID +P   R T IICTIG +S + + L+E+I++GMNIAR+N + GS  Y+ + I  +R      +        V IA+D   P +RTGL+     AEVELK+G +I++T+DD +  +C+ + +W+D   ++N+   ++ G +++IDDG I + V + G +   C +E GG LGS K   LP  A+   A S    ++L F +E  VDMIF+SFI   ADV  +++V+G  G+ IKI++K+E   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC  A KP++  TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E ++T H + REAE+A FHRQLF  L+   +S    DP+   A+ AVEAS K  AS II++T +GRSA LI+ YRP+ P++ VTR  Q ARQ HL+RG+ P+ Y     D W+ED+DLR+N+A++ G +RGF K GD VI++TGW  G+G TNT+RV  VP
Sbjct:   15 QTQ-QLNAAMADTFLEHMCLLDIDSEPTIARNTGIICTIGPASRSVDTLKEMIKSGMNIARMNFSHGSHEYHGETIKNVREACASFEPGSIQYRPVGIALDTKGPEIRTGLIKGSGTAEVELKKGNKIKVTLDDSFMENCDEDTLWLD---YKNITKVVEVGSKVYIDDGLISLQVLQIGSDYLICEIENGGSLGSKKGVNLPGAAVDLPAVSEKDIKDLQFGVEMGVDMIFASFIRKAADVQAVRKVLGEKGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNKAGKPIICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAATFHRQLFEGLR--RSSVLTRDPSDAVAVGAVEASFKCCASGIIILTKTGRSAHLISRYRPRAPILAVTRNEQTARQAHLYRGIFPIYYNSPSNDVWAEDVDLRVNFAMDVGKARGFFKAGDVVIVLTGWRPGSGYTNTMRVVPVP 532          
BLAST of Pyruvate kinase vs. Ensembl Zebrafish
Match: pkmb (pyruvate kinase M1/2b [Source:ZFIN;Acc:ZDB-GENE-040801-230])

HSP 1 Score: 467.618 bits (1202), Expect = 8.003e-158
Identity = 246/538 (45.72%), Postives = 359/538 (66.73%), Query Frame = 1
Query:   13 LYEMTTIAEAYLYQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNAC-----VAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMI-DPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            + +  T A  ++ QTQ Q  +  A + L+H+C LDID +P   R T I+CT+G +S + E LRE+I +GMN+ARLN + G+  Y+++ I  +R   +           VAIA+D   P +RTGL+      EV+L +G  I+LT+DDK+ ++C+   +W+D   ++N+   ++ G  I++DDG I + V+E G +   C +E GG LGS K   LP   +   A S    ++L F +E  VDM+F+SFI   ADV  +++V+G  G+ I+I++K+E   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I+RC    KP++  TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E++ T H + REAE+AMFHRQLF +L+    +SH+  DPT++ A+ AVEAS K  AS II +T +GRSA L++ YRP+ P++ VTR  Q +RQ HL+RG+ P++YT+   D W+ED+DLR+++A+E G  R + K GD +I+VTGW  G+G TNT+R+  VP
Sbjct:    1 MSQTKTTASGFI-QTQ-QMPAAMAETFLEHLCLLDIDSEPTVSRNTGIVCTLGPASRSLETLREMILSGMNVARLNFSHGTHEYHAETIKSVREAIESFGAGTIDYRPVAIALDTKGPEIRTGLIKGSGTEEVKLVKGNIIKLTLDDKFMDNCDENTLWLD---YKNITKVVQQGSHIYVDDGLISLKVKEIGSDFLNCEIENGGMLGSKKGVNLPGANVDLPAVSEKDIKDLQFGVEQGVDMVFASFIRKAADVHAVRKVLGEKGKDIRIISKLENHEGVRKFDEILEASDGIMVARGDLGIEIPTEKVFLAQKMMISRCNRIGKPIICATQMLESMIKKPRPTRAESSDVANAVLDGADCIMLSGETAKGEYPIESVLTQHLIAREAEAAMFHRQLFEELR---RTSHLTRDPTESVAVGAVEASFKCCASAIICLTKTGRSAQLLSRYRPRAPIMAVTRNGQTSRQLHLYRGVIPILYTKPANDIWAEDVDLRVSFALEIGKHRKYFKSGDVIIVVTGWRPGSGYTNTMRIVVVP 530          
BLAST of Pyruvate kinase vs. Ensembl Zebrafish
Match: pkmb (pyruvate kinase M1/2b [Source:ZFIN;Acc:ZDB-GENE-040801-230])

HSP 1 Score: 467.618 bits (1202), Expect = 8.003e-158
Identity = 246/538 (45.72%), Postives = 359/538 (66.73%), Query Frame = 1
Query:   13 LYEMTTIAEAYLYQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNAC-----VAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMI-DPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            + +  T A  ++ QTQ Q  +  A + L+H+C LDID +P   R T I+CT+G +S + E LRE+I +GMN+ARLN + G+  Y+++ I  +R   +           VAIA+D   P +RTGL+      EV+L +G  I+LT+DDK+ ++C+   +W+D   ++N+   ++ G  I++DDG I + V+E G +   C +E GG LGS K   LP   +   A S    ++L F +E  VDM+F+SFI   ADV  +++V+G  G+ I+I++K+E   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I+RC    KP++  TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E++ T H + REAE+AMFHRQLF +L+    +SH+  DPT++ A+ AVEAS K  AS II +T +GRSA L++ YRP+ P++ VTR  Q +RQ HL+RG+ P++YT+   D W+ED+DLR+++A+E G  R + K GD +I+VTGW  G+G TNT+R+  VP
Sbjct:    1 MSQTKTTASGFI-QTQ-QMPAAMAETFLEHLCLLDIDSEPTVSRNTGIVCTLGPASRSLETLREMILSGMNVARLNFSHGTHEYHAETIKSVREAIESFGAGTIDYRPVAIALDTKGPEIRTGLIKGSGTEEVKLVKGNIIKLTLDDKFMDNCDENTLWLD---YKNITKVVQQGSHIYVDDGLISLKVKEIGSDFLNCEIENGGMLGSKKGVNLPGANVDLPAVSEKDIKDLQFGVEQGVDMVFASFIRKAADVHAVRKVLGEKGKDIRIISKLENHEGVRKFDEILEASDGIMVARGDLGIEIPTEKVFLAQKMMISRCNRIGKPIICATQMLESMIKKPRPTRAESSDVANAVLDGADCIMLSGETAKGEYPIESVLTQHLIAREAEAAMFHRQLFEELR---RTSHLTRDPTESVAVGAVEASFKCCASAIICLTKTGRSAQLLSRYRPRAPIMAVTRNGQTSRQLHLYRGVIPILYTKPANDIWAEDVDLRVSFALEIGKHRKYFKSGDVIIVVTGWRPGSGYTNTMRIVVVP 530          
BLAST of Pyruvate kinase vs. Ensembl Xenopus
Match: pkm (pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224])

HSP 1 Score: 476.093 bits (1224), Expect = 4.666e-161
Identity = 255/534 (47.75%), Postives = 359/534 (67.23%), Query Frame = 1
Query:   22 MTTIAEAYLYQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNAC-----VAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            M++   +   QTQ Q ++  A + L+H+C+LDID +P   R T IICTIG +S + E L+E+I++GMNIARLN + G+  Y++  I  +R   +   +       VA+A+D   P +RTGL+     AEVELK+G  + +T+DD ++  C+   +WVD   ++N+   +K G +I++DDG I ++V+ETG +     VE GG LGS K   LP  A+   A S    Q+L F +E  VDM+F+SFI   ADV  +++V+G  G+ IKI++KIE   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC  A KPV+  TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E ++  H + REAE+A+FHRQLF +L+    S    DPT+ TA+ AVE+S K  +  IIV+T SGRSA L++ YRP+ P+I VTR  Q ARQ HL+RG+ P++Y E   + W+ED+D+R+N+A++ G +RGF K GD VI++TGW  G+G TNT+RV  VP
Sbjct:    1 MSSGKSSAFIQTQ-QLHAAMADTFLEHMCRLDIDSEPIVARNTGIICTIGPASRSVEILKEMIKSGMNIARLNFSHGTHEYHAGTIKNVREATESFSSNPIHYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLRITLDDAFQEKCDENILWVD---YKNLTKVVKPGSKIYVDDGLISLLVKETGADFCLTEVENGGMLGSKKGVNLPGAAVDLPAVSTKDIQDLQFGVEQNVDMVFASFIRKAADVHAVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHAIAREAEAAIFHRQLFEELR--RVSPLTRDPTEATAVGAVESSFKCSSGAIIVLTKSGRSAHLVSRYRPRAPIIAVTRNGQTARQAHLYRGIFPVLYREAVHEAWAEDVDMRVNFAMDIGKARGFFKSGDVVIVLTGWRPGSGFTNTMRVVPVP 528          
BLAST of Pyruvate kinase vs. Ensembl Xenopus
Match: pkm (pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224])

HSP 1 Score: 475.707 bits (1223), Expect = 7.929e-161
Identity = 256/534 (47.94%), Postives = 360/534 (67.42%), Query Frame = 1
Query:   22 MTTIAEAYLYQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNAC-----VAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            M+    A++ QTQ Q ++  A + L+H+C+LDID +P   R T IICTIG +S + E L+E+I++GMNIARLN + G+  Y++  I  +R   +   +       VA+A+D   P +RTGL+     AEVELK+G  + +T+DD ++  C+   +WVD   ++N+   +K G +I++DDG I ++V+ETG +     VE GG LGS K   LP  A+   A S    Q+L F +E  VDM+F+SFI   ADV  +++V+G  G+ IKI++KIE   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC  A KPV+  TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E ++  H + REAE+A+FHRQLF +L+    S    DPT+ TA+ AVE+S K  +  IIV+T SGRSA L++ YRP+ P+I VTR  Q ARQ HL+RG+ P++Y E   + W+ED+D+R+N+A++ G +RGF K GD VI++TGW  G+G TNT+RV  VP
Sbjct:    2 MSEAGSAFI-QTQ-QLHAAMADTFLEHMCRLDIDSEPIVARNTGIICTIGPASRSVEILKEMIKSGMNIARLNFSHGTHEYHAGTIKNVREATESFSSNPIHYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLRITLDDAFQEKCDENILWVD---YKNLTKVVKPGSKIYVDDGLISLLVKETGADFCLTEVENGGMLGSKKGVNLPGAAVDLPAVSTKDIQDLQFGVEQNVDMVFASFIRKAADVHAVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHAIAREAEAAIFHRQLFEELR--RVSPLTRDPTEATAVGAVESSFKCSSGAIIVLTKSGRSAHLVSRYRPRAPIIAVTRNGQTARQAHLYRGIFPVLYREAVHEAWAEDVDMRVNFAMDIGKARGFFKSGDVVIVLTGWRPGSGFTNTMRVVPVP 528          
BLAST of Pyruvate kinase vs. Ensembl Xenopus
Match: pkm (pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224])

HSP 1 Score: 475.322 bits (1222), Expect = 1.147e-160
Identity = 256/535 (47.85%), Postives = 359/535 (67.10%), Query Frame = 1
Query:   22 MTTIAEAYLYQTQEQQ-YSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNAC-----VAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            +  +AEA     Q QQ ++  A + L+H+C+LDID +P   R T IICTIG +S + E L+E+I++GMNIARLN + G+  Y++  I  +R   +   +       VA+A+D   P +RTGL+     AEVELK+G  + +T+DD ++  C+   +WVD   ++N+   +K G +I++DDG I ++V+ETG +     VE GG LGS K   LP  A+   A S    Q+L F +E  VDM+F+SFI   ADV  +++V+G  G+ IKI++KIE   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC  A KPV+  TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E ++  H + REAE+A+FHRQLF +L+    S    DPT+ TA+ AVE+S K  +  IIV+T SGRSA L++ YRP+ P+I VTR  Q ARQ HL+RG+ P++Y E   + W+ED+D+R+N+A++ G +RGF K GD VI++TGW  G+G TNT+RV  VP
Sbjct:    1 LCVLAEAGSAFIQTQQLHAAMADTFLEHMCRLDIDSEPIVARNTGIICTIGPASRSVEILKEMIKSGMNIARLNFSHGTHEYHAGTIKNVREATESFSSNPIHYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLRITLDDAFQEKCDENILWVD---YKNLTKVVKPGSKIYVDDGLISLLVKETGADFCLTEVENGGMLGSKKGVNLPGAAVDLPAVSTKDIQDLQFGVEQNVDMVFASFIRKAADVHAVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHAIAREAEAAIFHRQLFEELR--RVSPLTRDPTEATAVGAVESSFKCSSGAIIVLTKSGRSAHLVSRYRPRAPIIAVTRNGQTARQAHLYRGIFPVLYREAVHEAWAEDVDMRVNFAMDIGKARGFFKSGDVVIVLTGWRPGSGFTNTMRVVPVP 530          
BLAST of Pyruvate kinase vs. Ensembl Xenopus
Match: pkm (pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224])

HSP 1 Score: 473.011 bits (1216), Expect = 8.292e-160
Identity = 257/534 (48.13%), Postives = 358/534 (67.04%), Query Frame = 1
Query:   22 MTTIAEAYLYQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNAC-----VAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            M+    A++ QTQ Q ++  A + L+H+C+LDID +P   R T IICTIG +S + E L+E+I++GMNIARLN + G+  Y++  I  +R   +   +       VA+A+D   P +RTGL+     AEVELK+G  + +T+DD ++  C+   +WVD   ++N+   +K G +I++DDG I ++V+ETG +     VE GG LGS K   LP  A+   A S    Q+L F +E  VDM+F+SFI   ADV  +++V+G  G+ IKI++KIE   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC  A KPV+  TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E ++  H +  EAE+A FHRQLF +L    ASS   DP +  A+ AVEAS K  AS +IV+T SGRSA L++ YRP+ P+I VTR  Q ARQ HL+RG+ P++Y E   + W+ED+D+R+N+A++ G +RGF K GD VI++TGW  G+G TNT+RV  VP
Sbjct:    1 MSEAGSAFI-QTQ-QLHAAMADTFLEHMCRLDIDSEPIVARNTGIICTIGPASRSVEILKEMIKSGMNIARLNFSHGTHEYHAGTIKNVREATESFSSNPIHYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLRITLDDAFQEKCDENILWVD---YKNLTKVVKPGSKIYVDDGLISLLVKETGADFCLTEVENGGMLGSKKGVNLPGAAVDLPAVSTKDIQDLQFGVEQNVDMVFASFIRKAADVHAVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHAIALEAEAAAFHRQLFEELFRATASSK--DPAEAMALGAVEASFKCLASALIVMTESGRSAHLVSRYRPRAPIIAVTRNGQTARQAHLYRGIFPVLYREAVHEAWAEDVDMRVNFAMDIGKARGFFKSGDVVIVLTGWRPGSGFTNTMRVVPVP 527          
BLAST of Pyruvate kinase vs. Ensembl Xenopus
Match: pkm (pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224])

HSP 1 Score: 471.855 bits (1213), Expect = 1.104e-159
Identity = 251/514 (48.83%), Postives = 351/514 (68.29%), Query Frame = 1
Query:   82 AHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNAC-----VAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            A + L+H+C+LDID +P   R T IICTIG +S + E L+E+I++GMNIARLN + G+  Y++  I  +R   +   +       VA+A+D   P +RTGL+     AEVELK+G  + +T+DD ++  C+   +WVD   ++N+   +K G +I++DDG I ++V+ETG E++   VE GG LGS K   LP  A+   A S    Q+L F +E  VDM+F+SFI   ADV  +++V+G  G+ IKI++KIE   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC  A KPV+  TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E ++  H + REAE+A+FHRQLF +L+    S    DPT+ TA+ AVE+S K  +  IIV+T SGRSA L++ YRP+ P+I VTR  Q ARQ HL+RG+ P++Y E   + W+ED+D+R+N+A++ G +RGF K GD VI++TGW  G+G TNT+RV  VP
Sbjct:    2 ADTFLEHMCRLDIDSEPIVARNTGIICTIGPASRSVEILKEMIKSGMNIARLNFSHGTHEYHAGTIKNVREATESFSSNPIHYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLRITLDDAFQEKCDENILWVD---YKNLTKVVKPGSKIYVDDGLISLLVKETGTETS---VENGGMLGSKKGVNLPGAAVDLPAVSTKDIQDLQFGVEQNVDMVFASFIRKAADVHAVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHAIAREAEAAIFHRQLFEELR--RVSPLTRDPTEATAVGAVESSFKCSSGAIIVLTKSGRSAHLVSRYRPRAPIIAVTRNGQTARQAHLYRGIFPVLYREAVHEAWAEDVDMRVNFAMDIGKARGFFKSGDVVIVLTGWRPGSGFTNTMRVVPVP 507          
BLAST of Pyruvate kinase vs. Ensembl Mouse
Match: Pkm (pyruvate kinase, muscle [Source:MGI Symbol;Acc:MGI:97591])

HSP 1 Score: 468.774 bits (1205), Expect = 3.446e-158
Identity = 250/530 (47.17%), Postives = 350/530 (66.04%), Query Frame = 1
Query:   34 AEAYLYQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKN-----ACVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            A     QTQ Q ++  A + L+H+C+LDID  P   R T IICTIG +S + E L+E+I++GMN+ARLN + G+  Y+++ I  +R   +   +       VA+A+D   P +RTGL+     AEVELK+G  +++T+D+ Y   C+   +W+D   ++N+   ++ G +I++DDG I + V+E G +     VE GG LGS K   LP  A+   A S    Q+L F +E  VDM+F+SFI   ADV  +++V+G  G+ IKI++KIE   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC  A KPV+  TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E ++  H + REAE+AMFHR LF +L    ASSH  D  +  A+ +VEAS K  A+ +IV+T SGRSA  +A YRP+ P+I VTR  Q ARQ HL+RG+ P++  +   + W+ED+DLR+N A++ G +RGF K GD VI++TGW  G+G TNT+RV  VP
Sbjct:    8 AGTAFIQTQ-QLHAAMADTFLEHMCRLDIDSAPITARNTGIICTIGPASRSVEMLKEMIKSGMNVARLNFSHGTHEYHAETIKNVREATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLD---YKNICKVVEVGSKIYVDDGLISLQVKEKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRLLFEELV--RASSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDAVLNAWAEDVDLRVNLAMDVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP 531          
BLAST of Pyruvate kinase vs. Ensembl Mouse
Match: Pkm (pyruvate kinase, muscle [Source:MGI Symbol;Acc:MGI:97591])

HSP 1 Score: 461.84 bits (1187), Expect = 1.392e-155
Identity = 247/530 (46.60%), Postives = 349/530 (65.85%), Query Frame = 1
Query:   34 AEAYLYQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKN-----ACVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            A     QTQ Q ++  A + L+H+C+LDID  P   R T IICTIG +S + E L+E+I++GMN+ARLN + G+  Y+++ I  +R   +   +       VA+A+D   P +RTGL+     AEVELK+G  +++T+D+ Y   C+   +W+D   ++N+   ++ G +I++DDG I + V+E G +     VE GG LGS K   LP  A+   A S    Q+L F +E  VDM+F+SFI   ADV  +++V+G  G+ IKI++KIE   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC  A KPV+  TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E ++  H + REAE+A++H QLF +L+    +    DPT+  A+ AVEAS K  +  IIV+T SGRSA  +A YRP+ P+I VTR  Q ARQ HL+RG+ P++  +   + W+ED+DLR+N A++ G +RGF K GD VI++TGW  G+G TNT+RV  VP
Sbjct:    8 AGTAFIQTQ-QLHAAMADTFLEHMCRLDIDSAPITARNTGIICTIGPASRSVEMLKEMIKSGMNVARLNFSHGTHEYHAETIKNVREATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLD---YKNICKVVEVGSKIYVDDGLISLQVKEKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELR--RLAPITSDPTEAAAVGAVEASFKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDAVLNAWAEDVDLRVNLAMDVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP 531          
BLAST of Pyruvate kinase vs. Ensembl Mouse
Match: Pklr (pyruvate kinase liver and red blood cell [Source:MGI Symbol;Acc:MGI:97604])

HSP 1 Score: 455.677 bits (1171), Expect = 6.196e-153
Identity = 244/524 (46.56%), Postives = 346/524 (66.03%), Query Frame = 1
Query:   49 YQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNAC-----VAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYV 1605
            +  Q+Q  +  A + L+H+C LDID +P   R T+II TIG +S + ++L+E+I+ GMNIARLN + GS  Y+++ I  IR   +    +      VAIA+D   P +RTG++     +EVE+ +G Q+ +T+D K++   +++ +WVD   + N+   +  G RI+IDDG I ++VR+ G E     VE GG LG+ K   LP   +     S     +L F +E+ VD+IF+SF+   +DV+ +++ +GP GRGIKI++KIE   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC +A KPV+  TQMLESM  K R TRAE SDVANAVLDGAD ++LS ETA+G +PVE ++  H + REAE+A++HRQLF +L+   A+    DPT+ TAI AVEAS K  A+ IIV+T +GRSA L++ YRP+  VI VTR  Q ARQ HL RG+ PL+Y E     W++D+D R+ + IE G  RGFL+ GD VI+VTGW  G+G TN +RV  +
Sbjct:   24 FFQQQQLPAAMADTFLEHLCLLDIDSEPVAARSTSIIATIGPASRSVDRLKEMIKAGMNIARLNFSHGSHEYHAESIANIREAAESFATSPLSYRPVAIALDTKGPEIRTGVLQGGPESEVEIVKGSQVLVTVDPKFRTRGDAKTVWVD---YHNITQVVAVGGRIYIDDGLISLVVRKIGPEGLVTEVEHGGFLGNRKGVNLPNAEVDLPGLSEQDLLDLRFGVEHNVDIIFASFVRKASDVVAVRDALGPEGRGIKIISKIENHEGVKKFDEILEVSDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNLAGKPVVCATQMLESMITKARPTRAETSDVANAVLDGADCIMLSGETAKGSFPVEAVKMQHAIAREAEAAVYHRQLFEELR--RAAPLSRDPTEVTAIGAVEASFKCCAAAIIVLTKTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLSRGVFPLLYREPPEAVWADDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLTI 542          
BLAST of Pyruvate kinase vs. Ensembl Mouse
Match: Pklr (pyruvate kinase liver and red blood cell [Source:MGI Symbol;Acc:MGI:97604])

HSP 1 Score: 455.292 bits (1170), Expect = 2.330e-152
Identity = 244/524 (46.56%), Postives = 346/524 (66.03%), Query Frame = 1
Query:   49 YQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNAC-----VAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYV 1605
            +  Q+Q  +  A + L+H+C LDID +P   R T+II TIG +S + ++L+E+I+ GMNIARLN + GS  Y+++ I  IR   +    +      VAIA+D   P +RTG++     +EVE+ +G Q+ +T+D K++   +++ +WVD   + N+   +  G RI+IDDG I ++VR+ G E     VE GG LG+ K   LP   +     S     +L F +E+ VD+IF+SF+   +DV+ +++ +GP GRGIKI++KIE   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC +A KPV+  TQMLESM  K R TRAE SDVANAVLDGAD ++LS ETA+G +PVE ++  H + REAE+A++HRQLF +L+   A+    DPT+ TAI AVEAS K  A+ IIV+T +GRSA L++ YRP+  VI VTR  Q ARQ HL RG+ PL+Y E     W++D+D R+ + IE G  RGFL+ GD VI+VTGW  G+G TN +RV  +
Sbjct:   55 FFQQQQLPAAMADTFLEHLCLLDIDSEPVAARSTSIIATIGPASRSVDRLKEMIKAGMNIARLNFSHGSHEYHAESIANIREAAESFATSPLSYRPVAIALDTKGPEIRTGVLQGGPESEVEIVKGSQVLVTVDPKFRTRGDAKTVWVD---YHNITQVVAVGGRIYIDDGLISLVVRKIGPEGLVTEVEHGGFLGNRKGVNLPNAEVDLPGLSEQDLLDLRFGVEHNVDIIFASFVRKASDVVAVRDALGPEGRGIKIISKIENHEGVKKFDEILEVSDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNLAGKPVVCATQMLESMITKARPTRAETSDVANAVLDGADCIMLSGETAKGSFPVEAVKMQHAIAREAEAAVYHRQLFEELR--RAAPLSRDPTEVTAIGAVEASFKCCAAAIIVLTKTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLSRGVFPLLYREPPEAVWADDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLTI 573          
BLAST of Pyruvate kinase vs. Ensembl Mouse
Match: Pkm (pyruvate kinase, muscle [Source:MGI Symbol;Acc:MGI:97591])

HSP 1 Score: 155.992 bits (393), Expect = 7.867e-43
Identity = 85/223 (38.12%), Postives = 132/223 (59.19%), Query Frame = 1
Query:   52 QTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKN-----ACVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFA 705
            QTQ Q ++  A + L+H+C+LDID  P   R T IICTIG +S + E L+E+I++GMN+ARLN + G+  Y+++ I  +R   +   +       VA+A+D   P +RTGL+     AEVELK+G  +++T+D+ Y   C+   +W+D   ++N+   ++ G +I++DDG I + V+E G +     VE GG LGS K   LP  A+   A S    Q+L F 
Sbjct:   14 QTQ-QLHAAMADTFLEHMCRLDIDSAPITARNTGIICTIGPASRSVEMLKEMIKSGMNVARLNFSHGTHEYHAETIKNVREATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLD---YKNICKVVEVGSKIYVDDGLISLQVKEKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFG 232          
BLAST of Pyruvate kinase vs. UniProt/SwissProt
Match: sp|Q92122|KPYM_XENLA (Pyruvate kinase PKM OS=Xenopus laevis OX=8355 GN=pkm PE=2 SV=1)

HSP 1 Score: 473.396 bits (1217), Expect = 2.585e-159
Identity = 256/534 (47.94%), Postives = 361/534 (67.60%), Query Frame = 1
Query:   22 MTTIAEAYLYQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNAC-----VAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            M+    A++ QTQ Q ++  A + L+H+C+LDID +P   R T IICTIG +S + E L+E+I++GMNIARLN + G+  Y++  I  +R   + + +       VA+A+D   P +RTGL+     AEVELK+G  + +T+DD ++ +C+   +WVD   ++N+   +K G +I++DDG I ++V+E G +     +E GG LGS K   LP  A+   A S    Q+L F +E  VDM+F+SFI   ADV  ++EV+G  G+ IKI++KIE   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC  A KPV+  TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E ++  H + REAE+A+FHRQLF +L+    S    DPT+ TA+ AVEAS K  +  IIV+T SGRSA L++ YRP+ P+I+VTR  Q ARQ HL+RG+ P++Y E   + W+ED+D R+N+A++ G +RGF K GD VI++TGW  G+G TNT+RV  VP
Sbjct:    1 MSEAGSAFI-QTQ-QLHAAMADTFLEHMCRLDIDSEPIVARNTGIICTIGPASRSVEMLKEMIKSGMNIARLNFSHGTHEYHAGTIKNVREATESLASNPIHYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATMRITLDDAFQENCDENVLWVD---YKNLTKVVKPGSKIYVDDGLISLLVKEIGPDFCVTEIENGGMLGSKKGVNLPGAAVDLPAVSSKDIQDLQFGVEQDVDMVFASFIRKAADVHEVREVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHAIAREAEAAIFHRQLFEELR--RVSPLTRDPTEATAVGAVEASFKCSSGAIIVLTKSGRSAHLLSRYRPRAPIISVTRNGQTARQAHLYRGIFPVLYREAVHEAWAEDVDSRVNFAMDIGKARGFFKSGDVVIVLTGWRPGSGFTNTMRVVPVP 527          
BLAST of Pyruvate kinase vs. UniProt/SwissProt
Match: sp|O62619|KPYK_DROME (Pyruvate kinase OS=Drosophila melanogaster OX=7227 GN=PyK PE=2 SV=2)

HSP 1 Score: 472.626 bits (1215), Expect = 6.948e-159
Identity = 249/519 (47.98%), Postives = 356/519 (68.59%), Query Frame = 1
Query:   64 QQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNAC-----VAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYV 1605
            Q  +  A +QL+H+C+L  D    ++R + I+CTIG +S + E L +++  GMNIAR+N + GS  Y++  +  +R+  K           VAIA+D   P +RTGL+     AE+ELK+G++I+LT + ++    + E ++VD   + N++  +K G+R+F+DDG I +IVRE G +S  C VE GG LGS K   LP   +   A S   + +LLF +E +VDMIF+SFI + A +  I++V+G  G+ IKI++KIE + G+ +LDEI+E  D IM+ RGDLG+E+P EKVF+AQK++IARC  A KPV+  TQMLESM  KPR TRAEISDVANAVLDGAD ++LS ETA+G YP+E + TM + C+EAE+A++H+ LF DL +  A +  ID +   AIAAVEA++KAKAS I+V+TTSG+SA  ++ YRP+CP+I VTR  Q ARQ HL+RGL PL+Y E    DW +D+D+R+ + ++ G   GF+K GD V++VTGW  G+G TNT+R+  V
Sbjct:   20 QNMAAGADTQLEHMCRLQFDSPVPHVRLSGIVCTIGPASSSVEMLEKMMATGMNIARMNFSHGSHEYHAATVANVRQAVKNYSAKLGYEHPVAIALDTKGPEIRTGLIGGSGTAEIELKKGEKIKLTTNKEFLEKGSLEIVYVD---YENIVNVVKPGNRVFVDDGLISLIVREVGKDSLTCEVENGGSLGSRKGVNLPGVPVDLPAVSEKDKSDLLFGVEQEVDMIFASFIRNAAALTEIRKVLGEKGKNIKIISKIENQQGMHNLDEIIEAGDGIMVARGDLGIEIPAEKVFLAQKAMIARCNKAGKPVICATQMLESMVKKPRPTRAEISDVANAVLDGADCVMLSGETAKGEYPLECVLTMAKTCKEAEAALWHQNLFNDL-VRGAGT--IDASHAAAIAAVEAATKAKASAIVVITTSGKSAFQVSKYRPRCPIIAVTRFAQTARQAHLYRGLVPLIYKEPGLGDWLKDVDVRVQFGLQVGKKNGFIKTGDSVVVVTGWKQGSGFTNTIRIVTV 532          
BLAST of Pyruvate kinase vs. UniProt/SwissProt
Match: sp|P00548|KPYM_CHICK (Pyruvate kinase PKM OS=Gallus gallus OX=9031 GN=PKM PE=2 SV=2)

HSP 1 Score: 472.241 bits (1214), Expect = 8.609e-159
Identity = 250/530 (47.17%), Postives = 349/530 (65.85%), Query Frame = 1
Query:   34 AEAYLYQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKN-----ACVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            A     QTQ Q ++  A + L+H+C+LDID +P   R T IICTIG +S + +KL+E+I++GMN+ARLN + G+  Y+   I  +R   +   +       VAIA+D   P +RTGL+     AEVELK+G  +++T+D+ +  +C+   +WVD   ++N+I  +  G +I++DDG I ++V+E G +     VE GG LGS K   LP  A+   A S    Q+L F +E  VDM+F+SFI   ADV  +++V+G  G+ IKI++KIE   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC  A KP++  TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E ++  H + REAE+AMFHRQ F ++  H  S H  +P    A  AVEAS K  A+ +IV+T SGRSA L++ YRP+ P+I VTR  Q ARQ HL+RG+ P++  +   D W+ED+DLR+N  +  G +RGF K GD VI++TGW  G+G TNT+RV  VP
Sbjct:    7 AGTAFIQTQ-QLHAAMADTFLEHMCRLDIDSEPTIARNTGIICTIGPASRSVDKLKEMIKSGMNVARLNFSHGTHEYHEGTIKNVREATESFASDPITYRPVAIALDTKGPEIRTGLIKGSGTAEVELKKGAALKVTLDNAFMENCDENVLWVD---YKNLIKVIDVGSKIYVDDGLISLLVKEKGKDFVMTEVENGGMLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQNVDMVFASFIRKAADVHAVRKVLGEKGKHIKIISKIENHEGVRRFDEIMEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPIICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHAIAREAEAAMFHRQQFEEILRH--SVHHREPADAMAAGAVEASFKCLAAALIVMTESGRSAHLVSRYRPRAPIIAVTRNDQTARQAHLYRGVFPVLCKQPAHDAWAEDVDLRVNLGMNVGKARGFFKTGDLVIVLTGWRPGSGYTNTMRVVPVP 530          
BLAST of Pyruvate kinase vs. UniProt/SwissProt
Match: sp|P11980|KPYM_RAT (Pyruvate kinase PKM OS=Rattus norvegicus OX=10116 GN=Pkm PE=1 SV=3)

HSP 1 Score: 469.159 bits (1206), Expect = 1.287e-157
Identity = 250/530 (47.17%), Postives = 349/530 (65.85%), Query Frame = 1
Query:   34 AEAYLYQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKN-----ACVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            A     QTQ Q ++  A + L+H+C+LDID  P   R T IICTIG +S + E L+E+I++GMN+ARLN + G+  Y+++ I  +R   +   +       VA+A+D   P +RTGL+     AEVELK+G  +++T+D+ Y   C+   +W+D   ++N+   ++ G +I++DDG I + V+E G +     VE GG LGS K   LP  A+   A S    Q+L F +E  VDM+F+SFI   ADV  +++V+G  G+ IKI++KIE   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC  A KPV+  TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E ++  H + REAE+A+FHR LF +L    ASS   DP +  A+ +VEAS K  A+ +IV+T SGRSA  +A YRP+ P+I VTR  Q ARQ HL+RG+ P++  +   D W+ED+DLR+N A+  G +RGF K GD VI++TGW  G+G TNT+RV  VP
Sbjct:    8 AGTAFIQTQ-QLHAAMADTFLEHMCRLDIDSAPITARNTGIICTIGPASRSVEMLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRAATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLD---YKNICKVVEVGSKIYVDDGLISLQVKEKGADYLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAVFHRLLFEELA--RASSQSTDPLEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDAVLDAWAEDVDLRVNLAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP 531          
BLAST of Pyruvate kinase vs. UniProt/SwissProt
Match: sp|P11979|KPYM_FELCA (Pyruvate kinase PKM OS=Felis catus OX=9685 GN=PKM PE=1 SV=2)

HSP 1 Score: 466.848 bits (1200), Expect = 1.157e-156
Identity = 247/524 (47.14%), Postives = 350/524 (66.79%), Query Frame = 1
Query:   52 QTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKE-----MKNACVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            QTQ Q ++  A + L+H+C+LDID  P   R T IICTIG +S + E L+E+I++GMN+ARLN + G+  Y+++ I  +R   +      ++   VA+A+D   P +RTGL+     AEVELK+G  +++T+D+ Y   C+   +W+D   ++N+   ++ G ++++DDG I ++V+E G +     VE GG LGS K   LP  A+   A S    Q+L F +E  VDM+F+SFI   +DV  +++V+G  G+ IKI++KIE   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC  A KPV+  TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E ++  H + REAE+AMFHR+LF +L     SSH  D  +  A+ +VEAS K  A+ +IV+T SGRSA  +A YRP+ P+I VTR  Q ARQ HL+RG+ P+V  +   + W+ED+DLR+N A+  G +RGF K GD VI++TGW  G+G TNT+RV  VP
Sbjct:   14 QTQ-QLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVEILKEMIKSGMNVARLNFSHGTHEYHAETIKNVRAATESFASDPIRYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENVLWLD---YKNICKVVEVGSKVYVDDGLISLLVKEKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELV--RGSSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNHQTARQAHLYRGIFPVVCKDPVQEAWAEDVDLRVNLAMNVGKARGFFKHGDVVIVLTGWRPGSGFTNTMRVVPVP 531          
BLAST of Pyruvate kinase vs. TrEMBL
Match: A0A267EYV5 (Pyruvate kinase (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019710g1 PE=3 SV=1)

HSP 1 Score: 514.227 bits (1323), Expect = 3.188e-172
Identity = 264/535 (49.35%), Postives = 368/535 (68.79%), Query Frame = 1
Query:   22 MTTIAEAYLYQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMK--NACVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDP---TKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVPE 1611
            + + A  Y  Q Q+ Q S +A S L+H+C LD+D +PAY+R T IICTIG +  +   L ++I NGMNIAR+N + G+  Y+ + + ++R+  +  K  +  V IA+D   P +RTGL+     AEVEL  G+ I +TID  +  +C+ + +WVD   + N++  +  G R+FIDDG I ++V+E   +S  C VE GG+LGS K   LP + +   A S   R++L FA++  +DM+F+SFI +   +  I+ ++G  G+ IKI+AKIE   G+   DEI+E AD IM+ RGDLG+E+P EKVF+AQK +I RC  A KPV+  TQMLESM  KPR TRAEISDVANAVLDGAD ++LS ETA+G +P+E ++TMH+VCREAESAM+  QLF DLK     + +++P   T TTAIAA EA+++ +A+ IIV+TT+GRSA L+A +RP+CP++TV+R  Q  RQ HLWRGLHPL + E ++D W+EDMD RI +AI +G  RGF+  GD V++VTGW AGTG TNT+RV  V E
Sbjct:   16 LGSFANQYFIQKQQLQAS-NARSHLEHLCHLDVDSEPAYVRNTGIICTIGPACKSVAILHKMIANGMNIARMNFSHGTHEYHRQTVELVRQAAETFKPWSRPVGIALDTKGPEIRTGLIGGSGTAEVELVRGEPITVTIDSAFAENCSKDTLWVD---YPNIVKVINEGGRVFIDDGLISLLVKEIRDKSLLCEVENGGKLGSKKGVNLPGSPVDLPAVSEKDREDLKFAVDLGLDMVFASFIRNADAIREIRHILGEAGKNIKIIAKIENHEGVRRFDEIMEAADGIMVARGDLGIEIPPEKVFLAQKMMIGRCNRAGKPVICATQMLESMISKPRPTRAEISDVANAVLDGADCVMLSGETAKGDFPLEAVRTMHQVCREAESAMYTSQLFEDLK-----AELLEPTDITHTTAIAASEAANRCRAAAIIVITTTGRSAQLVARHRPRCPILTVSRLAQTCRQAHLWRGLHPLFFDETRSDQWTEDMDKRIEFAIAYGRQRGFINRGDFVVMVTGWKAGTGFTNTLRVIQVTE 541          
BLAST of Pyruvate kinase vs. TrEMBL
Match: A0A2T7PRU9 (Pyruvate kinase OS=Pomacea canaliculata OX=400727 GN=C0Q70_03126 PE=3 SV=1)

HSP 1 Score: 509.605 bits (1311), Expect = 7.018e-170
Identity = 259/532 (48.68%), Postives = 364/532 (68.42%), Query Frame = 1
Query:   37 EAYLYQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNA-CVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVPEKKTTEL 1629
            E   Y  ++Q  +  A S L H+C LDID +P  +R T IICTIG +S   + L++++  GMNIARLN + G++ Y+   I  +R+   E      + IA+D   P +RTGL+ +   AEV+L  G  I++TI+D+YK  C+ + +WVD   ++N+I  +  G R+FIDDG I VIV+E G +   C VE GG++GS K C LP  A+   A S   + +LLF +EN VDM+F+SFI S   +  I++++G  G+ IKI+AKIE   GI   DEI+ EAD +M+ RGD+G+E+P EKVF+AQK +IA+C  A KPV+  TQMLESM YKPR TRAE SDVANAVLDGAD ++LS E+A+G+YP+ET++TMH +CREAESA FH Q F DL+    +    DPT T AIAAVEAS    A+ IIV+TT+GRSA L+++YRP+CP++ VTR  +VARQCHL+RG+ P+ Y + K ++W+ D+D RI  A+    SRGF++ GDPV+++TGW  G+G+TNT+R+    + +  +L
Sbjct:   33 EGDYYIQKQQLQAAYATSHLQHICALDIDSEPLQVRMTGIICTIGPASREVKTLQKMMMEGMNIARLNFSHGTYEYHKGTIENVRQAVAEFSEPRPIGIALDTKGPEIRTGLLQDGASAEVQLNLGDTIKITINDEYKEKCSKDILWVD---YKNIIKVLDVGKRMFIDDGLISVIVKEKGDDYLVCTVENGGKVGSKKGCNLPGIAVDLPAVSEKDKDDLLFGVENNVDMVFASFIRSADGIREIRKIMGEKGKNIKIIAKIENHEGIKRFDEILGEADGVMVARGDMGIEIPTEKVFLAQKMMIAKCNRAGKPVICATQMLESMTYKPRPTRAEGSDVANAVLDGADCVMLSGESAKGLYPLETVRTMHLICREAESAYFHNQRFEDLR--RETPLYADPTHTIAIAAVEASYTCMAAVIIVITTTGRSAHLVSAYRPRCPILAVTRDGRVARQCHLYRGIFPIHYVDPKLNEWTADVDRRIWKAVHAAMSRGFVQAGDPVVVLTGWKPGSGATNTMRIITATDMRDKDL 559          
BLAST of Pyruvate kinase vs. TrEMBL
Match: A0A267GKQ7 (Pyruvate kinase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028607g1 PE=3 SV=1)

HSP 1 Score: 508.064 bits (1307), Expect = 5.507e-169
Identity = 273/563 (48.49%), Postives = 386/563 (68.56%), Query Frame = 1
Query:   13 LYEMTTIAEAYLYQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLE-----KEMKNACVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETG--LESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEA--------SSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP--EKKTTELHVVRSIQ 1650
            L ++++    Y     + +      +QL H+C+LDID  P Y R T+I+CT+G S +T E +R +I  GMNIAR+NLTLGS+ Y S++I  +R  E     + M +  VA+AVD+ APT+RTG V   V    ++ EG+ + +T+D+ YK+DC +E++++D+ Y+R    A+  GDRI IDDG +++I RE      S RCLVEQGG L SS+   LPR A ++HA +  ++Q+LLFA+ENQVD++   F +S   + +I++V+GP     K++A+IE+ +G+ +L +I+  AD + + RG+LG  LPIEKVF+AQKS+IA    AKKP +V  QML+SMR+KPRATRAE+SDVANAVLDGAD L L VETA+G +P+ETLQ M +VC+EAESA +H + F+DLK  EA        +   I+ T T+A AAV A+    A+ IIVVTT+G++A  +ASYRP CP++TVTRQ+ VARQCHL+RGL P+ ++E K DDWSEDMD RI + +++     F+KPG+ V+I TGW A  G TNTVR+  VP  E  ++ LH+VRS Q
Sbjct:   24 LSKVSSTMPGYYRMNTQSRIMHSRETQLTHLCRLDIDNLPIYPRVTSIMCTLGPSCETPEMIRRMIVRGMNIARINLTLGSYKYCSQLIKAVRAEEAKLNSESMDSYMVAVAVDITAPTLRTGQVGGAVNGSFKVSEGEFVTITVDEAYKDDCTAEHLYIDTAYWRKSFHAINVGDRIDIDDGTVMLIAREKASLTGSIRCLVEQGGILLSSRVVRLPRMAEYRHAVAEKYKQDLLFAVENQVDIVCCGFAESGLAITQIRKVLGPFSLNTKVLARIESSDGLKNLADILSVADGVFVDRGELGRNLPIEKVFLAQKSVIAHANAAKKPAVVAAQMLDSMRHKPRATRAEVSDVANAVLDGADVLALGVETAKGAFPLETLQVMVQVCQEAESAYYHGRKFVDLKRIEAVRLAAMGPNDEQIE-TFTSATAAVSAAMTNGAAAIIVVTTTGKTAFAVASYRPPCPILTVTRQMSVARQCHLYRGLRPVYFSEEKCDDWSEDMDRRITHTLQFAVRSKFVKPGERVVICTGWHA--GQTNTVRLVVVPAEEFMSSPLHIVRSSQ 583          
BLAST of Pyruvate kinase vs. TrEMBL
Match: A0A430Q112 (Pyruvate kinase OS=Schistosoma bovis OX=6184 GN=DC041_0005495 PE=3 SV=1)

HSP 1 Score: 504.597 bits (1298), Expect = 2.000e-168
Identity = 273/552 (49.46%), Postives = 367/552 (66.49%), Query Frame = 1
Query:   22 MTTIAEAYLYQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKN--ACVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTK---TTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVPEKKTTELHVVRSIQRLID 1662
            ++   EA  Y  Q    S    S L+HV  LDID +PAY+R T IICTIG +  T E L+ ++ +GMNIARLN + GS  Y++K I ++R     +K     + IA+D   P +RTGL+N    AEV L+ G +I +T D  Y   CN   ++VD   +RN++  +  G +IF+DDG I ++V + G +   C VE GG+LGS K   LP   +   A S   +Q+L FA+E+ VDM+F+SFI +   V +I++++G  G  IKI+AKIE   G+   +EI++ AD IM+ RGDLG+E+P EKVF+AQK +I RC    KPV+  TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G+YP+E +QTMHR+C +AE+AMFH QLF DLK     S +  PT+   TTAIAAVEA+S+  A+ IIV+TTSGRS  LI+ +RP+CP++TVTR   +ARQ HL+RG+HPL Y E +A +W EDMD RI YAI++G  R F  PG  VIIVTGW AG+GSTNT+RV  + + +T  + +V SI    D
Sbjct:   22 VSRFGEASPYH-QNPPLSVYPRSLLEHVVSLDIDHQPAYVRNTGIICTIGPACRTVEILQNMMTSGMNIARLNFSHGSHEYHAKTIELVREAAATLKPFPRPIGIALDTKGPEIRTGLINGSGTAEVNLQVGHKIRVTTDCAYMEACNESILYVD---YRNIVHVLSKGSKIFVDDGLISLVVLDKGPDYLECEVENGGKLGSRKGVNLPGAHVDLDAVSEKDKQDLRFAVEHNVDMVFASFIRNADAVHQIRQLLGDNGSHIKIIAKIENHEGVQRFNEILDAADGIMVARGDLGIEIPAEKVFIAQKMMIGRCNQVGKPVICATQMLESMTTKPRPTRAESSDVANAVLDGADCVMLSGETAKGLYPLEAVQTMHRICVQAEAAMFHGQLFEDLK-----SSLYGPTEMAHTTAIAAVEAASRCNAAAIIVITTSGRSCQLISRHRPRCPILTVTRHEYIARQIHLYRGVHPLYYGEPRAGEWYEDMDRRIRYAIDYGRKRSFFSPGCFVIIVTGWKAGSGSTNTLRVVKLEDAETKPIVMVPSITHFDD 564          
BLAST of Pyruvate kinase vs. TrEMBL
Match: A0A095B084 (Pyruvate kinase OS=Schistosoma haematobium OX=6185 GN=MS3_08937 PE=3 SV=1)

HSP 1 Score: 504.212 bits (1297), Expect = 2.379e-168
Identity = 273/559 (48.84%), Postives = 370/559 (66.19%), Query Frame = 1
Query:    1 SI*ILYEMTTIAEAYLYQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKN--ACVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTK---TTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVPEKKTTELHVVRSIQRLID 1662
            S  ++  ++   EA  Y  Q    S    S L+HV  LDID +PAY+R T IICTIG +  T E L+ ++ +GMNIARLN + GS  Y++K I ++R     +K     + IA+D   P +RTGL+N    AEV L+ G +I +T D  Y   CN   +++D   +RN++  +  G +IF+DDG I ++V + G +   C VE GG+LGS K   LP   +   A S   +Q+L FA+E+ VDM+F+SFI +   V +I++++G  G  IKI+AKIE   G+   +EI++ AD IM+ RGDLG+E+P EKVF+AQK +I RC    KPV+  TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G+YP+E +QTMHR+C +AE+AMFH QLF DLK     S +  PT+   TTAIAAVEA+S+  A+ IIV+TTSGRS  LI+ +RP+CP++TVTR   +ARQ HL+RG+HPL Y E +A +W EDMD RI YAI++G  R F  PG  VIIVTGW AG+GSTNT+RV  + + +T  + +V SI    D
Sbjct:   15 SFHVVSSVSRFGEASPYH-QNPPLSVYPRSLLEHVVSLDIDHQPAYVRNTGIICTIGPACRTVEILQNMMTSGMNIARLNFSHGSHEYHAKTIELVREAAATLKPFPRPIGIALDTKGPEIRTGLINGSGTAEVTLQVGHKIRVTTDCAYMEACNESILYMD---YRNIVHVLSKGSKIFVDDGLISLVVLDKGPDYLECEVENGGKLGSRKGVNLPGAHVDLDAVSEKDKQDLRFAVEHNVDMVFASFIRNADAVHQIRQLLGDNGSHIKIIAKIENHEGVQRFNEILDAADGIMVARGDLGIEIPAEKVFIAQKMMIGRCNQVGKPVICATQMLESMTTKPRPTRAESSDVANAVLDGADCVMLSGETAKGLYPLEAVQTMHRICVQAEAAMFHGQLFEDLK-----SSLYGPTEMAHTTAIAAVEAASRCNAAAIIVITTSGRSCQLISRHRPRCPILTVTRHEYIARQIHLYRGVHPLYYGEPRAGEWYEDMDRRIRYAIDYGRKRSFFSPGCFVIIVTGWKAGSGSTNTLRVVKLEDAETKPIVMVPSITHFDD 564          
BLAST of Pyruvate kinase vs. Ensembl Cavefish
Match: pkma (pyruvate kinase PKM [Source:NCBI gene;Acc:103044212])

HSP 1 Score: 482.256 bits (1240), Expect = 3.030e-163
Identity = 254/524 (48.47%), Postives = 352/524 (67.18%), Query Frame = 1
Query:   52 QTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNACV-----AIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            QTQ Q  +  A + L+H+C LDID +P   R T IICTIG +S + + L+E+I++GMNIARLN + GS  Y+ + I  IR   +  +   +      IA+D   P +RTGL+     AEVELK+G  I++T+DD Y  +C+ + +W+D   ++N+   ++ G +++IDDG I + V+E G +   C +E GG LGS K   LP  A+   A S    ++L F +E  VDM+F+SFI    DV  +++V+G  G+ IKI++K+E   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC  A KP+   TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E ++T H + REAE+AMFHRQLF +L+     +H  DP++  AI AVE+S K  AS IIV+T SGRSA LI+ YRP+ P+I VTR  Q ARQ HL+RG+ P+ Y +   D W+ED+DLR+N+A++ G +RGF K GD VI++TGW  G+G TNT+RV  VP
Sbjct:   38 QTQ-QLNAAMADTFLEHMCLLDIDSEPTTARNTGIICTIGPASRSVDMLKEMIKSGMNIARLNFSHGSHEYHGETIKNIREATESFEPGSIHYRPIGIALDTKGPEIRTGLIKGSGTAEVELKKGNTIKVTLDDAYMENCDEDVLWLD---YKNITKVVEIGSKVYIDDGLISLQVQEIGSDYILCEIENGGTLGSKKGVNLPGAAVDLPAVSEKDIKDLQFGVEMGVDMVFASFIRKAQDVNEVRQVLGEKGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNRAGKPITCATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAAMFHRQLFEELRRANKMTH--DPSEAVAIGAVESSFKCCASAIIVLTKSGRSAHLISRYRPRAPIIAVTRNGQTARQAHLYRGIFPVFYNKPAHDVWAEDVDLRVNFAMDVGKARGFFKTGDVVIVLTGWRPGSGFTNTMRVVPVP 555          
BLAST of Pyruvate kinase vs. Ensembl Cavefish
Match: pkmb (pyruvate kinase PKM-like [Source:NCBI gene;Acc:103047790])

HSP 1 Score: 480.715 bits (1236), Expect = 4.749e-163
Identity = 251/522 (48.08%), Postives = 354/522 (67.82%), Query Frame = 1
Query:   61 EQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNAC-----VAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMI-DPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            +Q ++  A + L+H+C LDID +PA  R T IICTIG +S + EKLRE+I+ GMNIARLN + G+  Y+++ I  +R   +           VAIA+D   P +RTGL+      EV L +G +I+LT+DDKYK++C+ + +W+D   ++N+   ++ G  I++DDG I + V E G +   C +E GG LGS K   LP   +   A S    Q+L F +E  VDM+F+SFI   ADV  +++V+G  G+ I++++K+E   G+   DEI+E +D IM+ RGD+G+E+P EKVF+AQK +I+R     KP+   TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YPVE+++T H++ REAE+AMFHRQ+F +L+     +H+  DP ++ AI AVEAS K  AS IIV+T SGRSA L++ YRP+ P++ VTR  Q ARQ HL+RG++P++Y +   D W+ED+DLR+N+A+E G  R F K GD VI+VTGW  G+G TNT+RV  VP
Sbjct:   15 QQLHAAMADTLLEHMCLLDIDSEPAVYRNTGIICTIGPASRSVEKLREMIKAGMNIARLNFSHGTHEYHAETIKNVREATESFGPGTLEYRPVAIALDTKGPEIRTGLIKGSGTEEVTLNKGDKIKLTLDDKYKDNCDEKTLWLD---YKNITKVVQQGSHIYVDDGLISLKVIEVGGDYLTCEIENGGMLGSKKGVNLPGANIDLPAVSEKDTQDLQFGVEQGVDMVFASFIRKAADVQAVRKVLGEKGKEIRVISKLENHEGVRRFDEILEASDGIMVARGDMGIEIPTEKVFLAQKMMISRSNRIGKPITCATQMLESMIKKPRPTRAESSDVANAVLDGADCIMLSGETAKGEYPVESVRTQHQIAREAEAAMFHRQVFEELR---RITHLTRDPCESVAIGAVEASFKCCASGIIVLTKSGRSAHLLSKYRPRAPILAVTRNEQTARQSHLYRGIYPILYNKPANDVWAEDVDLRVNFALEMGKFRKFFKSGDVVIVVTGWRPGSGYTNTMRVVLVP 530          
BLAST of Pyruvate kinase vs. Ensembl Cavefish
Match: pkma (pyruvate kinase PKM [Source:NCBI gene;Acc:103044212])

HSP 1 Score: 481.1 bits (1237), Expect = 7.284e-163
Identity = 254/524 (48.47%), Postives = 352/524 (67.18%), Query Frame = 1
Query:   52 QTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNACV-----AIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            QTQ Q  +  A + L+H+C LDID +P   R T IICTIG +S + + L+E+I++GMNIARLN + GS  Y+ + I  IR   +  +   +      IA+D   P +RTGL+     AEVELK+G  I++T+DD Y  +C+ + +W+D   ++N+   ++ G +++IDDG I + V+E G +   C +E GG LGS K   LP  A+   A S    ++L F +E  VDM+F+SFI    DV  +++V+G  G+ IKI++K+E   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC  A KP+   TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E ++T H + REAE+AMFHRQLF +L+     +H  DP++  AI AVE+S K  AS IIV+T SGRSA LI+ YRP+ P+I VTR  Q ARQ HL+RG+ P+ Y +   D W+ED+DLR+N+A++ G +RGF K GD VI++TGW  G+G TNT+RV  VP
Sbjct:   40 QTQ-QLNAAMADTFLEHMCLLDIDSEPTTARNTGIICTIGPASRSVDMLKEMIKSGMNIARLNFSHGSHEYHGETIKNIREATESFEPGSIHYRPIGIALDTKGPEIRTGLIKGSGTAEVELKKGNTIKVTLDDAYMENCDEDVLWLD---YKNITKVVEIGSKVYIDDGLISLQVQEIGSDYILCEIENGGTLGSKKGVNLPGAAVDLPAVSEKDIKDLQFGVEMGVDMVFASFIRKAQDVNEVRQVLGEKGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNRAGKPITCATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAAMFHRQLFEELRRANKMTH--DPSEAVAIGAVESSFKCCASAIIVLTKSGRSAHLISRYRPRAPIIAVTRNGQTARQAHLYRGIFPVFYNKPAHDVWAEDVDLRVNFAMDVGKARGFFKTGDVVIVLTGWRPGSGFTNTMRVVPVP 557          
BLAST of Pyruvate kinase vs. Ensembl Cavefish
Match: pkma (pyruvate kinase PKM [Source:NCBI gene;Acc:103044212])

HSP 1 Score: 480.33 bits (1235), Expect = 4.133e-162
Identity = 254/524 (48.47%), Postives = 352/524 (67.18%), Query Frame = 1
Query:   52 QTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNACV-----AIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            QTQ Q  +  A + L+H+C LDID +P   R T IICTIG +S + + L+E+I++GMNIARLN + GS  Y+ + I  IR   +  +   +      IA+D   P +RTGL+     AEVELK+G  I++T+DD Y  +C+ + +W+D   ++N+   ++ G +++IDDG I + V+E G +   C +E GG LGS K   LP  A+   A S    ++L F +E  VDM+F+SFI    DV  +++V+G  G+ IKI++K+E   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC  A KP+   TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E ++T H + REAE+AMFHRQLF +L+     +H  DP++  AI AVE+S K  AS IIV+T SGRSA LI+ YRP+ P+I VTR  Q ARQ HL+RG+ P+ Y +   D W+ED+DLR+N+A++ G +RGF K GD VI++TGW  G+G TNT+RV  VP
Sbjct:   68 QTQ-QLNAAMADTFLEHMCLLDIDSEPTTARNTGIICTIGPASRSVDMLKEMIKSGMNIARLNFSHGSHEYHGETIKNIREATESFEPGSIHYRPIGIALDTKGPEIRTGLIKGSGTAEVELKKGNTIKVTLDDAYMENCDEDVLWLD---YKNITKVVEIGSKVYIDDGLISLQVQEIGSDYILCEIENGGTLGSKKGVNLPGAAVDLPAVSEKDIKDLQFGVEMGVDMVFASFIRKAQDVNEVRQVLGEKGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNRAGKPITCATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAAMFHRQLFEELRRANKMTH--DPSEAVAIGAVESSFKCCASAIIVLTKSGRSAHLISRYRPRAPIIAVTRNGQTARQAHLYRGIFPVFYNKPAHDVWAEDVDLRVNFAMDVGKARGFFKTGDVVIVLTGWRPGSGFTNTMRVVPVP 585          
BLAST of Pyruvate kinase vs. Ensembl Cavefish
Match: pkma (pyruvate kinase PKM [Source:NCBI gene;Acc:103044212])

HSP 1 Score: 480.33 bits (1235), Expect = 1.638e-161
Identity = 254/524 (48.47%), Postives = 352/524 (67.18%), Query Frame = 1
Query:   52 QTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNACV-----AIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            QTQ Q  +  A + L+H+C LDID +P   R T IICTIG +S + + L+E+I++GMNIARLN + GS  Y+ + I  IR   +  +   +      IA+D   P +RTGL+     AEVELK+G  I++T+DD Y  +C+ + +W+D   ++N+   ++ G +++IDDG I + V+E G +   C +E GG LGS K   LP  A+   A S    ++L F +E  VDM+F+SFI    DV  +++V+G  G+ IKI++K+E   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC  A KP+   TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E ++T H + REAE+AMFHRQLF +L+     +H  DP++  AI AVE+S K  AS IIV+T SGRSA LI+ YRP+ P+I VTR  Q ARQ HL+RG+ P+ Y +   D W+ED+DLR+N+A++ G +RGF K GD VI++TGW  G+G TNT+RV  VP
Sbjct:  113 QTQ-QLNAAMADTFLEHMCLLDIDSEPTTARNTGIICTIGPASRSVDMLKEMIKSGMNIARLNFSHGSHEYHGETIKNIREATESFEPGSIHYRPIGIALDTKGPEIRTGLIKGSGTAEVELKKGNTIKVTLDDAYMENCDEDVLWLD---YKNITKVVEIGSKVYIDDGLISLQVQEIGSDYILCEIENGGTLGSKKGVNLPGAAVDLPAVSEKDIKDLQFGVEMGVDMVFASFIRKAQDVNEVRQVLGEKGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNRAGKPITCATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAAMFHRQLFEELRRANKMTH--DPSEAVAIGAVESSFKCCASAIIVLTKSGRSAHLISRYRPRAPIIAVTRNGQTARQAHLYRGIFPVFYNKPAHDVWAEDVDLRVNFAMDVGKARGFFKTGDVVIVLTGWRPGSGFTNTMRVVPVP 630          
BLAST of Pyruvate kinase vs. Ensembl Sea Lamprey
Match: pkma (pyruvate kinase M1/2a [Source:ZFIN;Acc:ZDB-GENE-031201-4])

HSP 1 Score: 463.381 bits (1191), Expect = 9.474e-157
Identity = 254/534 (47.57%), Postives = 348/534 (65.17%), Query Frame = 1
Query:   46 LYQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNAC-----VAIAVDLVAPTVRTGLVNNDVM-------AEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCL--VEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYV 1605
              QTQ+   S+ A + L+H+C LDID +P   R T IICTIG +S + + L+E+I++GMNIAR+N + GS  Y+S  I  +R   +           V +A+D   P +RTGL+   V+       AEVELK+G ++++T+DD Y++ C+   +W+D   ++N+   +  G +IF+DDG I ++V+E G      +  VE GG LGS K   LP  A+   A S    Q+L F ++  VDM+F+SFI   ADV  ++ V+G  G+ IKI++KIE   G+   +EI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC  A KPV+  TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E ++  H + REAE+AM+HRQLF +L+    S    DPT+TTAI  VEAS K  A  IIV+T SGRSA L++ YRP+ P+I VTR  Q ARQ HL+RG+ P++  E   D W+ED+DLR+N A+E G  RGF K  D VI+VTGW  G+G TN +RV  V
Sbjct:   12 FVQTQQLSASR-ADTFLEHMCLLDIDSEPITARNTGIICTIGPASRSLDTLKEMIKSGMNIARMNFSHGSHEYHSDTIKNVREATESFAGNPIYYRPVGVALDTKGPEIRTGLIKGAVVVAAQSGTAEVELKKGAELKVTLDDAYQDACDDTMVWLD---YKNITKVVTPGSKIFVDDGLISLLVKEIGKGDDYVITEVENGGMLGSRKGVNLPGAAVDLPAVSAKDVQDLQFGVDQGVDMVFASFIRKAADVEEVRAVLGEKGKNIKIISKIENHEGVRRFEEILEASDGIMVARGDLGIEIPGEKVFIAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAESSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHAIAREAEAAMYHRQLFEELR--RLSGITSDPTETTAIGTVEASFKCSAGAIIVLTKSGRSAHLLSKYRPRAPIIAVTRCGQTARQAHLYRGIFPVLCREPVNDVWAEDVDLRVNLAMEVGKCRGFFKQDDVVIVVTGWRPGSGYTNMMRVIKV 539          
BLAST of Pyruvate kinase vs. Ensembl Yeast
Match: CDC19 (Pyruvate kinase; functions as a homotetramer in glycolysis to convert phosphoenolpyruvate to pyruvate, the input for aerobic (TCA cycle) or anaerobic (glucose fermentation) respiration; regulated via allosteric activation by fructose bisphosphate; CDC19 has a paralog, PYK2, that arose from the whole genome duplication [Source:SGD;Acc:S000000036])

HSP 1 Score: 346.28 bits (887), Expect = 3.914e-112
Identity = 190/490 (38.78%), Postives = 293/490 (59.80%), Query Frame = 1
Query:  139 IRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNACVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRET-GLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYV 1605
            +R+T+II TIG  ++  E L  L + G+NI R+N + GS+ Y+  +I   R+ E+      +AIA+D   P +RTG   NDV  +  +    ++  T DDKY   C+ + ++VD   ++N+   +  G  I++DDG +   V E    ++ +      G++ S K   LP   +   A S   +++L F ++N V M+F+SFI +  DVL I+EV+G  G+ +KI+ KIE + G+ + DEI++  D +M+ RGDLG+E+P  +V   QK +IA+  +A KPV+  TQMLESM Y PR TRAE+SDV NA+LDGAD ++LS ETA+G YP+  + TM      AE A+ +   + D++    +      T+T A +AV A  + KA  IIV++TSG +  L++ YRP CP+I VTR  + AR  HL+RG+ P V+ +    DW++D++ RIN+ IE     G LK GD  + + G+ AG G +NT++V  V
Sbjct:   18 LRRTSIIGTIGPKTNNPETLVALRKAGLNIVRMNFSHGSYEYHKSVIDNARKSEELYPGRPLAIALDTKGPEIRTGTTTNDV--DYPIPPNHEMIFTTDDKYAKACDDKIMYVD---YKNITKVISAGRIIYVDDGVLSFQVLEVVDDKTLKVKALNAGKICSHKGVNLPGTDVDLPALSEKDKEDLRFGVKNGVHMVFASFIRTANDVLTIREVLGEQGKDVKIIVKIENQQGVNNFDEILKVTDGVMVARGDLGIEIPAPEVLAVQKKLIAKSNLAGKPVICATQMLESMTYNPRPTRAEVSDVGNAILDGADCVMLSGETAKGNYPINAVTTMAETAVIAEQAIAYLPNYDDMR--NCTPKPTSTTETVAASAVAAVFEQKAKAIIVLSTSGTTPRLVSKYRPNCPIILVTRCPRAARFSHLYRGVFPFVFEKEPVSDWTDDVEARINFGIEKAKEFGILKKGDTYVSIQGFKAGAGHSNTLQVSTV 500          
BLAST of Pyruvate kinase vs. Ensembl Yeast
Match: PYK2 (Pyruvate kinase; appears to be modulated by phosphorylation; transcription repressed by glucose, and Pyk2p may be active under low glycolytic flux; PYK2 has a paralog, CDC19, that arose from the whole genome duplication [Source:SGD;Acc:S000005874])

HSP 1 Score: 328.946 bits (842), Expect = 2.027e-105
Identity = 188/513 (36.65%), Postives = 296/513 (57.70%), Query Frame = 1
Query:   88 SQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNACVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDG----AIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVPEK 1614
            S+L  +  L I   P  +R+T+II TIG  +++ E +  L + G+NI RLN + GS+ ++  +I    + E++     +AIA+D   P +RTG   ND   ++ +    Q+  T D  + N  N + +++D   + N+   +  G  I++DDG     ++ I+ E+ L   R      G + S K   LP   +     S    ++L F + N + ++F+SFI +  DVL I++ +G  G+ IKI++KIE + G+ + DEI+E  D +MI RGDLG+E+   +V   QK +IA+C +A KPV+  TQML+SM + PR TRAE+SDV NAVLDGAD ++LS ETA+G YPV  +  M      AES + H  L+ DL+  +A+      T+T A AA  A  +     I+V++T+G +A L++ YRP CP+I VTR  + AR  HL+RG+ P +Y   + DDW ED+  R+ + +E   S G +  GD V+ + G+  G G +NT+R+  V ++
Sbjct:    4 SRLQRLANLKIG-TPQQLRRTSIIGTIGPKTNSCEAITALRKAGLNIIRLNFSHGSYEFHQSVIENAVKSEQQFPGRPLAIALDTKGPEIRTGRTLND--QDLYIPVDHQMIFTTDASFANTSNDKIMYID---YANLTKVIVPGRFIYVDDGILSFKVLQIIDESNL---RVQAVNSGYIASHKGVNLPNTDVDLPPLSAKDMKDLQFGVRNGIHIVFASFIRTSEDVLSIRKALGSEGQDIKIISKIENQQGLDNFDEILEVTDGVMIARGDLGIEILAPEVLAIQKKLIAKCNLAGKPVICATQMLDSMTHNPRPTRAEVSDVGNAVLDGADCVMLSGETAKGDYPVNAVNIMAATALIAESTIAHLALYDDLR--DATPKPTSTTETVAAAATAAILEQDGKAIVVLSTTGNTARLLSKYRPSCPIILVTRHARTARIAHLYRGVFPFLYEPKRLDDWGEDVHRRLKFGVEMARSFGMVDNGDTVVSIQGFKGGVGHSNTLRISTVGQE 505          
BLAST of Pyruvate kinase vs. Ensembl Yeast
Match: YAL037C-B_mRNA (Dubious open reading frame; unlikely to encode a functional protein, based on available experimental and comparative sequence data; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching [Source:SGD;Acc:S000028592])

HSP 1 Score: 83.1889 bits (204), Expect = 9.500e-18
Identity = 78/317 (24.61%), Postives = 145/317 (45.74%), Query Frame = -3
Query:  688 LFRHIENAHRIGGAGSCNPTSDNDHRISGLQETSTAAPFNCVIDPQIHVFRPIVS-FIFRINQGVKATP*MAXXXXXXXXXXXXNRTLWSIAGNQAGRSA*SGHDNNA*RLCLARCLNCSNCCS-------FGRINHM**CFVDFQIEKQLTMEHCRFCFSTNPMHCLQCFNWVHSSSSFHR*Y*TICTIQNCICHITDFCSRRPRLVTHRLQHLCDDHNGLFGHLAASNY*FLCYEYLFYWELQAKITSSDHDSVSFFDYLIKMNNSILGXXXXXXXNASANWTDNLLDSQHVGS*IDET*KYHINLILQSKQQIL 1614
            LF +  +   +G   +   T D +  ++ LQ+T   + FN  +D   ++  P+   F+F  N+    +  +  SS    S N ++ T+WS+ GNQ+     SG DN++  L      +             +  ++H+    V +Q+   L      F  S N +      +WV +   F R + T+ TIQ+ +  I +F S    +V+H  QHL    N L   +  SN   L  +  + W+   ++TS +H++VS     +++ N++L FN  N+ +    +T +  D Q++    DE  + H++ +L ++ QI 
Sbjct:    3 LFLNGRDLQSVGVTSTGLETLDGNVSVTLLQDTEFLSLFNTEVDTGFNIISPVRDRFLFE-NEWEDTSVQVRESSSSWASGNQDDWTVWSVLGNQSWGGTGSGQDNDSLGLLFENSSDSGGSDGFGGGGWLWSTVSHV---IVVWQVSDSLFSNDSGFSHSGNGV------DWVVTLGGFTRQHNTVSTIQDSVTDIGNFSSGWSWVVSHGFQHLGSTDNWLTSQVRLSNQFLLDSQDFWGWDFNTQVTSGNHNTVSDLQDFVEVVNTLLVFNLDNDLDVLTLFTQDFSDGQNIVGGSDERSEDHVDTVLDTESQIF 309          
BLAST of Pyruvate kinase vs. Ensembl Nematostella
Match: EDO49963 (Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:A7RER9])

HSP 1 Score: 415.231 bits (1066), Expect = 1.236e-137
Identity = 233/545 (42.75%), Postives = 342/545 (62.75%), Query Frame = 1
Query:   37 EAYLYQT---QEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNACVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVPEKKTTELHVVRSIQRLID 1662
            E YL+      +Q  S  A S L+   +LDID+ P  IR + ++CTIG +S + E + +LIENGMNIARLN + G+  Y+ + I  IRR         V IA+D   P +RTGL+      E++L++GQ+++++ D    +  ++E I+VD   + N++  ++ G  +++DDG I + V E G       V     LGS K   LP  A+   A S   ++++ FA+E +VDMIF+SFI    D+  I++++    + IKIVAKIE   G+   +EI+E AD IM+ RGDLG+E+P EKVF+AQK +IARC M   PV+  TQMLESM   PR TRAE SDVANA+LDGAD ++LS ETA+G+YPV+ +  MHR+ REAE+A+FH+Q F +L+ H    +  D   +TAIAAV AS  A A  II +T +GR+A+++A +RP+CP++ VTR  +VARQ HLWRG  P+VY +   D+  E+ D R+++A+  G   GFL  G   + V+GW +G   TNT+R+  + ++K   +H+ RS+    D
Sbjct:    8 EEYLHDVLNRHKQWISSRARSNLEFRSELDIDKHPLTIRNSGVVCTIGPASRSVEIVAQLIENGMNIARLNFSHGTHEYHRETIMNIRRAALLEWPHAVGIALDTKGPEIRTGLLK---AGEIKLEKGQKLKVSTDKAMYDQGHTECIFVD---YENIVKVVQIGGTVYVDDGLISLKVLEKGDNFLITEVLNDALLGSKKGVNLPNCAVDLPAVSEQDKKDIAFAVEMEVDMIFASFIRKPEDIAEIRKLLEKHAKNIKIVAKIENHEGVRRFNEILEVADGIMVARGDLGIEIPAEKVFLAQKMMIARCNMKGVPVICATQMLESMVQNPRPTRAETSDVANAILDGADCVMLSGETAKGLYPVQAVAMMHRISREAEAAIFHKQSFDELR-HNLEGYA-DTHISTAIAAVAASFTAGADAIICLTHTGRTAAVVARFRPRCPIVVVTRDPRVARQMHLWRGCFPIVYDQEPLDNVLEEHDQRLDFALGMGKKMGFLTIGSTFVFVSGWKSGAAHTNTLRILTLTQEK---IHIARSLSESAD 541          
BLAST of Pyruvate kinase vs. Ensembl Medaka
Match: pkma (pyruvate kinase PKM [Source:NCBI gene;Acc:101170748])

HSP 1 Score: 497.664 bits (1280), Expect = 1.243e-169
Identity = 260/524 (49.62%), Postives = 359/524 (68.51%), Query Frame = 1
Query:   52 QTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRR-----LEKEMKNACVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            QTQ Q  +  A S L+H+C LDID +P   R T IICTIG +S + E L+E+I++GMNIAR+N + GS  Y+++ I  +R      +   ++   + IA+D   P +RTGL+     AEVELK+G  I++T+DD Y+ +C+ EN+W+D   ++N+   ++ G +I+IDDG I + V E G +   C +E GG LGS K   LP  A+   A S    Q+L F +E  VDM+F+SFI   ADV  +++V+G  G+ IKI++K+E   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC  A KP+   TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E ++T H + REAE+AMFHRQ+F DL+   ++ H  DP +  AI AVEAS K+ AS IIV+T SGRSA LI+ YRP+ P++ VTR  Q ARQ HL+RG+ P++YT+   D W+ED+D+R+N+A+E G +RGF K GD VI++TGW  G+G TNT+RV  VP
Sbjct:   15 QTQ-QLNAAMADSFLEHMCLLDIDSEPTTARNTGIICTIGPASRSVEMLKEMIKSGMNIARMNFSHGSHEYHAETIKNVREACESFVPGSIQYRPIGIALDTKGPEIRTGLIRGSGTAEVELKKGNTIKITLDDAYQENCSEENLWLD---YKNITKVVEIGSKIYIDDGLISLQVVEIGSDFIICEIENGGTLGSKKGVNLPGAAVDLPAVSEKDIQDLQFGVEQGVDMVFASFIRKAADVHAVRKVLGERGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNRAGKPITCATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAAMFHRQVFEDLR--RSTPHCSDPAEAIAIGAVEASFKSLASAIIVLTGSGRSAHLISRYRPRAPILAVTRNAQTARQAHLYRGIFPVLYTKPAHDVWAEDVDMRVNFAMEMGKARGFFKEGDVVIVLTGWRPGSGYTNTMRVILVP 532          
BLAST of Pyruvate kinase vs. Ensembl Medaka
Match: pkmb (pyruvate kinase PKM [Source:NCBI gene;Acc:101170426])

HSP 1 Score: 494.197 bits (1271), Expect = 2.999e-168
Identity = 255/531 (48.02%), Postives = 362/531 (68.17%), Query Frame = 1
Query:   34 AEAYLYQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNACV-----AIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMI-DPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            A + + QTQ Q ++  A + ++H+C LDID +PA  R T I+CTIG +S + +  +E+I+ GMNIAR+N + G+  Y+++ I  +R   +      V     AIA+D   P +RTGL+     AEVELK+GQ I+LT+DDKYK++C+   +WVD   ++N+   ++ G+ ++IDDG I + V+E G +   C +E GG LGS K   LP  A+   A S    Q+L F LE  VDM+F+SFI   ADV  +++V+G  G+ +KI++K+E   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +  +C    KP++  TQMLESM  KPR TRAE SDVANAVLDG D ++LS ETA+G YP+E + T HR+ REAE+AMFHRQ+F +L+    +SH+  DPT++ AI AVEAS K  AS IIV+T SGRSA +++ YRP+ P++ VTR  Q ARQ HL+RG++P++YT+   D W+ED+D+R+N+A+E+G  R F K GD  I+VTGW  G+G TNT+RV  VP
Sbjct:    7 AASSIMQTQ-QLHAAMADTYIEHMCLLDIDSEPAVSRNTGIVCTIGPASRSVDMAKEMIKAGMNIARMNFSHGTHEYHAETIKNVREATESFGPGTVEYRPVAIALDTKGPEIRTGLIKGSGTAEVELKKGQNIKLTLDDKYKDNCDENYLWVD---YKNITKVLQVGNNVYIDDGLISLKVKEVGNDYLMCEIENGGLLGSKKGVNLPGAAVDLPALSEKDIQDLQFGLEQGVDMVFASFIRKAADVQAVRKVLGEKGKDVKIISKLENHEGVRRFDEILEASDGIMVARGDLGIEIPTEKVFIAQKMMTGKCNRIGKPIICATQMLESMTKKPRPTRAEASDVANAVLDGNDCIMLSGETAKGDYPLEAVLTQHRIAREAEAAMFHRQMFEELR---RTSHLTRDPTESVAIGAVEASFKCCASAIIVLTKSGRSAYMLSRYRPRAPILAVTRCGQTARQAHLYRGVYPVLYTKNANDVWAEDVDMRVNFAMEYGKYRKFFKSGDVAIVVTGWRPGSGYTNTMRVVLVP 530          
BLAST of Pyruvate kinase vs. Ensembl Medaka
Match: pkma (pyruvate kinase PKM [Source:NCBI gene;Acc:101170748])

HSP 1 Score: 489.96 bits (1260), Expect = 1.261e-166
Identity = 255/524 (48.66%), Postives = 356/524 (67.94%), Query Frame = 1
Query:   52 QTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRR-----LEKEMKNACVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            QTQ Q  +  A S L+H+C LDID +P   R T IICTIG +S + E L+E+I++GMNIAR+N + GS  Y+++ I  +R      +   ++   + IA+D   P +RTGL+     AEVELK+G  I++T+DD Y+ +C+ EN+W+D   ++N+   ++ G +I+IDDG I + V E G +   C +E GG LGS K   LP  A+   A S    Q+L F +E  VDM+F+SFI   ADV  +++V+G  G+ IKI++K+E   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC  A KP+   TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E ++T H + REAE+A FHRQLF +L+ H   +   DP++  A+ AVE+S K  AS II +T +GRSA LI+ YRP+ P++ VTR  Q ARQ HL+RG+ P++YT+   D W+ED+D+R+N+A+E G +RGF K GD VI++TGW  G+G TNT+RV  VP
Sbjct:   15 QTQ-QLNAAMADSFLEHMCLLDIDSEPTTARNTGIICTIGPASRSVEMLKEMIKSGMNIARMNFSHGSHEYHAETIKNVREACESFVPGSIQYRPIGIALDTKGPEIRTGLIRGSGTAEVELKKGNTIKITLDDAYQENCSEENLWLD---YKNITKVVEIGSKIYIDDGLISLQVVEIGSDFIICEIENGGTLGSKKGVNLPGAAVDLPAVSEKDIQDLQFGVEQGVDMVFASFIRKAADVHAVRKVLGERGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNRAGKPITCATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAATFHRQLFEELRRHTQLTR--DPSEAVAVGAVESSFKCCASAIITLTKTGRSAHLISRYRPRAPILAVTRNAQTARQAHLYRGIFPVLYTKPAHDVWAEDVDMRVNFAMEMGKARGFFKEGDVVIVLTGWRPGSGYTNTMRVILVP 532          
BLAST of Pyruvate kinase vs. Ensembl Medaka
Match: pkma (pyruvate kinase PKM [Source:NCBI gene;Acc:101170748])

HSP 1 Score: 489.96 bits (1260), Expect = 2.702e-166
Identity = 255/524 (48.66%), Postives = 356/524 (67.94%), Query Frame = 1
Query:   52 QTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRR-----LEKEMKNACVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            QTQ Q  +  A S L+H+C LDID +P   R T IICTIG +S + E L+E+I++GMNIAR+N + GS  Y+++ I  +R      +   ++   + IA+D   P +RTGL+     AEVELK+G  I++T+DD Y+ +C+ EN+W+D   ++N+   ++ G +I+IDDG I + V E G +   C +E GG LGS K   LP  A+   A S    Q+L F +E  VDM+F+SFI   ADV  +++V+G  G+ IKI++K+E   G+   DEI+E +D IM+ RGDLG+E+P EKVF+AQK +I RC  A KP+   TQMLESM  KPR TRAE SDVANAVLDGAD ++LS ETA+G YP+E ++T H + REAE+A FHRQLF +L+ H   +   DP++  A+ AVE+S K  AS II +T +GRSA LI+ YRP+ P++ VTR  Q ARQ HL+RG+ P++YT+   D W+ED+D+R+N+A+E G +RGF K GD VI++TGW  G+G TNT+RV  VP
Sbjct:   33 QTQ-QLNAAMADSFLEHMCLLDIDSEPTTARNTGIICTIGPASRSVEMLKEMIKSGMNIARMNFSHGSHEYHAETIKNVREACESFVPGSIQYRPIGIALDTKGPEIRTGLIRGSGTAEVELKKGNTIKITLDDAYQENCSEENLWLD---YKNITKVVEIGSKIYIDDGLISLQVVEIGSDFIICEIENGGTLGSKKGVNLPGAAVDLPAVSEKDIQDLQFGVEQGVDMVFASFIRKAADVHAVRKVLGERGKNIKIISKLENHEGVRRFDEIMEASDGIMVARGDLGIEIPTEKVFLAQKMMIGRCNRAGKPITCATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRTQHMIAREAEAATFHRQLFEELRRHTQLTR--DPSEAVAVGAVESSFKCCASAIITLTKTGRSAHLISRYRPRAPILAVTRNAQTARQAHLYRGIFPVLYTKPAHDVWAEDVDMRVNFAMEMGKARGFFKEGDVVIVLTGWRPGSGYTNTMRVILVP 550          
BLAST of Pyruvate kinase vs. Ensembl Medaka
Match: pklr (pyruvate kinase PKM [Source:NCBI gene;Acc:101161188])

HSP 1 Score: 437.958 bits (1125), Expect = 3.683e-146
Identity = 239/538 (44.42%), Postives = 348/538 (64.68%), Query Frame = 1
Query:   19 EMTTIAEAYLYQTQEQQYSKD-AHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKN-----ACVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFK-HAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDL-KIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVP 1608
            ++ T+ ++++   Q QQ     A + L+H+C LDID++P   R T+IICTIG +S + +KL+E+++ GMNIARLN + G   Y+S+ I  IR   + + +       VAIA+D   P +RTGLV   V  EV+L +G  + +   +  ++  ++  +WVD  +   V   ++ G RI+IDDG + + V E G +    +VE GG L S K   LP   L    A S     +L F + + VDM+F+SFI S  DV  ++  +G +G  IK+++K+E++ G+ + +EI+ E+D +M+ RGDLG+E+P EKVF+AQK +I RC  A KPV+  TQMLESM   PR TRAE SDVANAVLDGAD ++LS ETA+G +P+E +  MH +CREAE+A+FH QLF +L ++   SS   DPT+ TAI AVE+S K  A  IIV+T+SGRS+ L++ YRP+CP+I VTR  QVARQ  L RG+ P ++    A  W++D+D R+ + ++ G +RGF K GD VI+VTGWI G+G TN +R  + P
Sbjct:   15 DLMTMPDSFI---QRQQLDASMADTFLEHLCLLDIDQEPITARNTSIICTIGPASRSIQKLQEMVKAGMNIARLNFSHGCHEYHSETIKNIREAVETITSDPLYYRPVAIALDTKGPEIRTGLVKGKVDEEVQLVKGSHVRVVTAESERDKTDATMVWVDYPHLPKV---LEKGRRIYIDDGLLALKVLEIGSDWVDTVVEAGGLLCSRKGVNLPGCDLIGLQAVSEQDEADLRFGVAHGVDMVFASFIRSAQDVKDVRRALGELGSHIKVISKVESRQGVQNFEEILAESDGVMVARGDLGIEIPAEKVFIAQKMMIGRCNSAGKPVICATQMLESMVSHPRPTRAESSDVANAVLDGADCVMLSAETAKGKFPLEAVAMMHSICREAEAAIFHHQLFEELRRLTPLSS---DPTEVTAIGAVESSFKCCAGAIIVLTSSGRSSHLLSRYRPRCPIIAVTRSPQVARQSQLLRGVFPALFHPLPAPVWADDVDSRVKFGMDIGKARGFFKSGDMVIVVTGWIPGSGHTNIMRAVHAP 543          
BLAST of Pyruvate kinase vs. Planmine SMEST
Match: SMESG000063570.1 (SMESG000063570.1)

HSP 1 Score: 1180.24 bits (3052), Expect = 0.000e+0
Identity = 583/584 (99.83%), Postives = 584/584 (100.00%), Query Frame = 1
Query:   19 EMTTIAEAYLYQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNACVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVPEKKTTELHVVRSIQRLIDLGDEKAMAVVQDMASLDRTESNTHLGVFDKSNLLYD 1770
            +MTTIAEAYLYQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNACVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTAIAAVEASSKAKASCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVPEKKTTELHVVRSIQRLIDLGDEKAMAVVQDMASLDRTESNTHLGVFDKSNLLYD
Sbjct:    4 KMTTIAEAYLYQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNACVAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTAIAAVEASSKAKASCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVPEKKTTELHVVRSIQRLIDLGDEKAMAVVQDMASLDRTESNTHLGVFDKSNLLYD 587          
BLAST of Pyruvate kinase vs. Planmine SMEST
Match: SMESG000045839.1 (SMESG000045839.1)

HSP 1 Score: 496.508 bits (1277), Expect = 3.289e-169
Identity = 254/525 (48.38%), Postives = 351/525 (66.86%), Query Frame = 1
Query:   40 AYLYQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNAC--VAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVY-TEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYV 1605
            +Y  Q Q+ Q    A S L+H C LD+  +PAY R T I+CT+G +S + E ++ +I  GMNIARLN + GS+ Y+ + I  +R++     N    VAIA+D   P +RTGL+     AEV LK G  I LT D+KYK DC+   ++VD   + N+I   K   +I++DDG I ++V+  G    +CL+E GG LGS K   +P   +   A S   +Q+L+FA E ++DM+F+SFI S + +  I+ ++G  G+ +KI+AKIE+  GI+  DEI+   D I++ RGDLG+E+P EKVF+AQK +I +C    KPV+  TQMLESM YKPR TRAE SDVANAVLDGAD ++LS ETA+G+YP+E + TMH++CREAE+  FH +L  DLK     +  ID T + AIAAVEA+S + A CIIVVTTSGRSA L++ +RP+CP++ VTR+    RQCHLWRGLHPL Y  E    DW EDMD R+ +A++    RGF++ G+ V+IVTGW AG+G TNT+R+  +
Sbjct:   10 SYFVQRQQVQIEA-ARSTLEHTCLLDVYSEPAYARNTGIVCTLGPASKSPEVIKNMINAGMNIARLNFSHGSYEYHKETIETVRQVTLSFGNVYRPVAIALDTKGPEIRTGLIKGSGTAEVILKSGNYITLTTDEKYKEDCDENTLYVD---YANIIKVAKMDKKIYVDDGLISLVVKSIGANEIKCLIENGGNLGSKKGINMPGQNVDLPAVSEKDKQDLIFAAEQELDMVFASFIRSGSAIDEIRAILGEKGKHMKIIAKIESHEGIIRFDEILASCDGILVARGDLGIEIPTEKVFIAQKMMIGKCNKVGKPVICATQMLESMIYKPRPTRAEASDVANAVLDGADCVMLSGETAKGLYPLEAVMTMHQICREAEAVTFHDELQKDLKY--GLTLPIDVTHSVAIAAVEAASMSLAGCIIVVTTSGRSAQLMSRHRPKCPILVVTREKITCRQCHLWRGLHPLYYEAEKPHGDWIEDMDERLKFAVDMAKKRGFVREGNNVVIVTGWRAGSGRTNTLRIITI 528          
BLAST of Pyruvate kinase vs. Planmine SMEST
Match: SMESG000052083.1 (SMESG000052083.1)

HSP 1 Score: 478.019 bits (1229), Expect = 8.515e-162
Identity = 254/519 (48.94%), Postives = 347/519 (66.86%), Query Frame = 1
Query:   49 YQTQEQQYSKD-AHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNAC--VAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRV 1596
            Y  Q Q   +  + S L+ +C LDID +P  +R ++IICTIG +  T   L+++I +GMNIAR+N + GS  Y+++ I ++R   +        VA+A+D   P +RTGL++     EV L +G +I+L ID+KY + CN E +WVD   ++N++  +  G RI++DDG I +IV ETG +   C VE GG LGS K   LP   +   A S     +L F +E  VDM+F+SFI   A V  I+ ++G  G+ I I++KIE   G+   DEI++ +D IM+ RGDLG+E+P EKVF+AQK +I RC    KP++  TQMLESM  KPR TRAE SDVANA+LDGAD ++LS ETA+G YP+E +Q MH +CREAESA+F  + F DLK     S   D T +TAIAAVEA+ + +AS I+VVTT+GRSA LI+ YRP+CP++TVTR    ARQ HLWRG+HPL+Y   + D+W+ DMD RIN+A  +   RGF+K GD VI+VTGW AG+GSTNT+RV
Sbjct:   13 YFIQNQNVHRGVSRSHLEFICNLDIDNEPDVVRSSSIICTIGPACRTVSTLKKMIASGMNIARMNFSHGSHEYHAETIKLVREAVETFTPYYRPVALALDTKGPEIRTGLIHGSGTGEVTLVKGNKIKLVIDEKYADSCNEEILWVD---YKNIVKILHKGCRIYVDDGLISLIVVETGKDYLDCEVENGGNLGSKKGVNLPGAKVDLPAVSDKDISDLHFGVEQGVDMVFASFIRCGAAVDEIRAILGEKGKHILIISKIENHEGVKRFDEILQASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRLGKPIICATQMLESMITKPRPTRAESSDVANAILDGADCVMLSGETAKGAYPLEAVQIMHHICREAESAVFQGKFFEDLKGEIVGS--TDQTHSTAIAAVEAAQRCRASAIVVVTTTGRSAYLISRYRPRCPILTVTRHPVTARQGHLWRGVHPLLYDAKRLDEWTTDMDNRINWAFGYAMRRGFVKNGDYVIVVTGWKAGSGSTNTMRV 526          
BLAST of Pyruvate kinase vs. Planmine SMEST
Match: SMESG000017675.1 (SMESG000017675.1)

HSP 1 Score: 471.085 bits (1211), Expect = 4.005e-159
Identity = 250/531 (47.08%), Postives = 344/531 (64.78%), Query Frame = 1
Query:   43 YLYQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNAC--VAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMI----DPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYVPEKK 1617
            Y  Q Q +  S D  S L+H  +L+ + +P  IR + IICTIG +  +   L ++I  GMN+ARLN + G++ Y+ + I+++R      K     +AIA+D   P +RTGLVN     EV L +G  I++ +D+KY   CNS  +WVD   + N+I  ++    I+IDDG I ++V + G +   C VE GG LGS K   LP   +   A S   +++L F +E+ VDM+F+SFI S   +  IK+++G  G+ I I++KIE   G+   DEI+E +D IM+ RGDLG+E+P EKV +AQK +I RC  A KPV+  TQMLESM  KP  T+AEISDVANAVLDGAD ++LS ETA+G YP+E +Q MH +CREAE+ ++  + F      EA  H I    D T +TA+AAVEA+ +  A+ IIV+TT+GRSA LIA YRP CP++TVTR    ARQ HLWRGLHP+ Y E +  DW+EDMD RI+Y++ +G  RGFL+  D VIIVTGW AG GSTNT+R+  + E +
Sbjct:   14 YFIQNQ-RITSNDYRSNLEHTSKLNYNDEPGVIRNSGIICTIGPACKSVTILHKMISAGMNVARLNFSHGTYEYHEETINLVREAVDTFKPYFRPIAIALDTKGPEIRTGLVNGSATGEVNLYKGSTIKIVVDNKYSEQCNSSQLWVD---YVNIINILEVNSSIYIDDGLISLVVIKKGSDFLMCEVENGGLLGSKKGVNLPGAKVDLPAVSEKDKEDLRFGVEHNVDMVFASFIRSGNAIKEIKDILGEKGKHILIISKIENLEGVQKFDEILEISDGIMVARGDLGIEIPPEKVVLAQKMMIGRCNRAGKPVICATQMLESMINKPTPTKAEISDVANAVLDGADCVMLSGETAKGQYPLEAVQVMHSICREAENVLYQSKFF------EAIKHTISGPTDQTHSTAVAAVEAAQRCHAAAIIVITTTGRSAHLIAKYRPTCPILTVTRHPITARQSHLWRGLHPIFYNEPRMIDWTEDMDERIHYSLSYGFRRGFLQMNDFVIIVTGWKAGVGSTNTLRIIRIEENQ 534          
BLAST of Pyruvate kinase vs. Planmine SMEST
Match: SMESG000068454.1 (SMESG000068454.1)

HSP 1 Score: 468.003 bits (1203), Expect = 2.200e-158
Identity = 241/510 (47.25%), Postives = 339/510 (66.47%), Query Frame = 1
Query:   82 AHSQLDHVCQLDIDRKPAYIRQTNIICTIGDSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNAC--VAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENIWVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLGSSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRIKEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIEKVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLDGADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEASSHMIDPTKTTXXXXXXXXXXXXXXCIIVVTTSGRSASLIASYRPQCPVITVTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGFLKPGDPVIIVTGWIAGTGSTNTVRVFYV 1605
            A S L+H+C LDID+KP  IR T IICTIG + +    L  +I  GMNIARLN + G+  Y+   + +I       + A   ++IA+D   P +RTGL+N    AE+ L EG++I +  ++K+ N C+++ IW+D   ++NV+  +K   RI+IDDG I +IV   G +   C +E GG LGS K   LP   +   A S   + +LLF ++++VD++F+SFI + A +  I+ ++G  G+ I I+AKIE   G+  +DEI++ AD IM+ RGDLG+E+P EKV  AQK +IA+C    KPV+  TQMLESM  K R TRAEISDVANAVLDG+D ++LS ETA+G +PV+T+ TMH VC+E ES  F  +   +LK    S +  D  +T+A+AAVEA+  + A  I+V+TT+G+SA LIA YRP CP++ VTR   VARQCHLWRGLHPL+ T     +WS+D+D RI+Y+IE+GC +GF K GD +++VTGW    GSTNTVR+  +
Sbjct:   16 ASSSLNHLCDLDIDKKPFIIRNTGIICTIGPACNNIATLHGMIAAGMNIARLNFSHGTHDYHVNSLKLIHEASNTYQAAYRPISIALDTKGPEIRTGLINGSETAEILLNEGEKIRIVTNEKFANKCDNKTIWLD---YKNVVNILKIESRIYIDDGLISLIVIGKGEDYLDCEIENGGSLGSKKGVNLPGAYVDLPAVSEKDKADLLFGVKHKVDIVFASFIRNAAAIREIRSILGDAGKYILIIAKIENYEGVKRIDEIIDAADGIMVARGDLGIEIPAEKVVAAQKMMIAKCNRKGKPVICATQMLESMVTKARPTRAEISDVANAVLDGSDCVMLSGETAKGKFPVQTVHTMHEVCKEGESMFFQNRYLQELK--SDSKYYGDAIETSAVAAVEAAQLSSAHAIVVLTTTGKSAHLIAKYRPSCPILAVTRNEIVARQCHLWRGLHPLLCTLPCFQNWSDDVDARISYSIEYGCEQGFFKTGDLIVLVTGWKPTPGSTNTVRIINI 520          
The following BLAST results are available for this feature:
BLAST of Pyruvate kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PKM6.869e-15846.79pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:... [more]
PKM6.869e-15846.79pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:... [more]
PKM6.869e-15846.79pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:... [more]
PKM6.869e-15846.79pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:... [more]
PKM3.878e-15646.42pyruvate kinase M1/2 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pyk-21.710e-14244.36Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q235... [more]
pyk-22.032e-14244.36Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q235... [more]
pyk-14.701e-14245.32Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q7JL... [more]
pyk-14.701e-14245.32Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q7JL... [more]
pyk-19.877e-14145.28Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:Q7JL... [more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PyK6.931e-16047.98gene:FBgn0267385 transcript:FBtr0084214[more]
PyK1.621e-15948.34gene:FBgn0267385 transcript:FBtr0084213[more]
CG29641.614e-11539.11gene:FBgn0031462 transcript:FBtr0077722[more]
CG70691.218e-8939.37gene:FBgn0038952 transcript:FBtr0084215[more]
CG73621.076e-5039.31gene:FBgn0038258 transcript:FBtr0331700[more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkma9.081e-16147.71pyruvate kinase M1/2a [Source:ZFIN;Acc:ZDB-GENE-03... [more]
pkma1.449e-15947.52pyruvate kinase M1/2a [Source:ZFIN;Acc:ZDB-GENE-03... [more]
pkma1.449e-15947.52pyruvate kinase M1/2a [Source:ZFIN;Acc:ZDB-GENE-03... [more]
pkmb8.003e-15845.72pyruvate kinase M1/2b [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pkmb8.003e-15845.72pyruvate kinase M1/2b [Source:ZFIN;Acc:ZDB-GENE-04... [more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkm4.666e-16147.75pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224][more]
pkm7.929e-16147.94pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224][more]
pkm1.147e-16047.85pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224][more]
pkm8.292e-16048.13pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224][more]
pkm1.104e-15948.83pyruvate kinase M1/2 [Source:NCBI gene;Acc:549224][more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pkm3.446e-15847.17pyruvate kinase, muscle [Source:MGI Symbol;Acc:MGI... [more]
Pkm1.392e-15546.60pyruvate kinase, muscle [Source:MGI Symbol;Acc:MGI... [more]
Pklr6.196e-15346.56pyruvate kinase liver and red blood cell [Source:M... [more]
Pklr2.330e-15246.56pyruvate kinase liver and red blood cell [Source:M... [more]
Pkm7.867e-4338.12pyruvate kinase, muscle [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Pyruvate kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q92122|KPYM_XENLA2.585e-15947.94Pyruvate kinase PKM OS=Xenopus laevis OX=8355 GN=p... [more]
sp|O62619|KPYK_DROME6.948e-15947.98Pyruvate kinase OS=Drosophila melanogaster OX=7227... [more]
sp|P00548|KPYM_CHICK8.609e-15947.17Pyruvate kinase PKM OS=Gallus gallus OX=9031 GN=PK... [more]
sp|P11980|KPYM_RAT1.287e-15747.17Pyruvate kinase PKM OS=Rattus norvegicus OX=10116 ... [more]
sp|P11979|KPYM_FELCA1.157e-15647.14Pyruvate kinase PKM OS=Felis catus OX=9685 GN=PKM ... [more]
back to top
BLAST of Pyruvate kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EYV53.188e-17249.35Pyruvate kinase (Fragment) OS=Macrostomum lignano ... [more]
A0A2T7PRU97.018e-17048.68Pyruvate kinase OS=Pomacea canaliculata OX=400727 ... [more]
A0A267GKQ75.507e-16948.49Pyruvate kinase OS=Macrostomum lignano OX=282301 G... [more]
A0A430Q1122.000e-16849.46Pyruvate kinase OS=Schistosoma bovis OX=6184 GN=DC... [more]
A0A095B0842.379e-16848.84Pyruvate kinase OS=Schistosoma haematobium OX=6185... [more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkma3.030e-16348.47pyruvate kinase PKM [Source:NCBI gene;Acc:10304421... [more]
pkmb4.749e-16348.08pyruvate kinase PKM-like [Source:NCBI gene;Acc:103... [more]
pkma7.284e-16348.47pyruvate kinase PKM [Source:NCBI gene;Acc:10304421... [more]
pkma4.133e-16248.47pyruvate kinase PKM [Source:NCBI gene;Acc:10304421... [more]
pkma1.638e-16148.47pyruvate kinase PKM [Source:NCBI gene;Acc:10304421... [more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pkma9.474e-15747.57pyruvate kinase M1/2a [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
CDC193.914e-11238.78Pyruvate kinase; functions as a homotetramer in gl... [more]
PYK22.027e-10536.65Pyruvate kinase; appears to be modulated by phosph... [more]
YAL037C-B_mRNA9.500e-1824.61Dubious open reading frame; unlikely to encode a f... [more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO499631.236e-13742.75Pyruvate kinase [Source:UniProtKB/TrEMBL;Acc:A7RE... [more]
back to top
BLAST of Pyruvate kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkma1.243e-16949.62pyruvate kinase PKM [Source:NCBI gene;Acc:10117074... [more]
pkmb2.999e-16848.02pyruvate kinase PKM [Source:NCBI gene;Acc:10117042... [more]
pkma1.261e-16648.66pyruvate kinase PKM [Source:NCBI gene;Acc:10117074... [more]
pkma2.702e-16648.66pyruvate kinase PKM [Source:NCBI gene;Acc:10117074... [more]
pklr3.683e-14644.42pyruvate kinase PKM [Source:NCBI gene;Acc:10116118... [more]
back to top
BLAST of Pyruvate kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063570.10.000e+099.83SMESG000063570.1[more]
SMESG000045839.13.289e-16948.38SMESG000045839.1[more]
SMESG000052083.18.515e-16248.94SMESG000052083.1[more]
SMESG000017675.14.005e-15947.08SMESG000017675.1[more]
SMESG000068454.12.200e-15847.25SMESG000068454.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020273 ID=SMED30020273|Name=Pyruvate kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2114bp
TCTATATAAATCTTATATGAAATGACAACTATTGCGGAAGCATATCTATA
TCAAACTCAAGAACAACAATATTCAAAAGACGCTCACTCGCAGTTAGACC
ACGTTTGTCAATTAGACATCGATCGCAAACCAGCTTACATTCGCCAAACT
AATATCATTTGCACAATTGGTGATTCGTCTGATACTGAAGAGAAGTTACG
AGAGTTAATTGAAAATGGAATGAATATTGCTCGATTAAATTTAACTCTGG
GATCATTTTCGTACTACAGCAAAATTATCCACATGATCCGTCGGTTGGAA
AAGGAAATGAAAAATGCATGCGTTGCAATAGCTGTAGATTTAGTAGCTCC
AACAGTAAGAACTGGATTGGTGAATAATGATGTTATGGCGGAGGTTGAAT
TGAAGGAAGGACAGCAGATTGAACTGACTATCGATGATAAATATAAAAAT
GATTGCAATTCAGAAAATATTTGGGTTGATTCGACTTATTTTCGAAATGT
GATTCCTGCAATGAAAACTGGTGACAGAATTTTCATTGACGACGGCGCTA
TAATTGTTATTGTGCGAGAAACAGGATTGGAAAGTGCTCGATGTCTTGTT
GAGCAAGGGGGTAGACTTGGCAGCAGTAAGAGATGTATTTTACCTAGAAA
TGCTCTTTTCAAACATGCATTTTCTGTCTCGTTTCGGCAAAATCTGTTGT
TTGCTCTGGAGAATCAGGTTGATATGATATTTTCAAGTTTCATCGATTCA
AGAGCCGACGTGCTGAGAATCAAGGAGGTTATCGGTCCAGTTGGCAGAGG
CATTAAAATTGTTGCAAAAATTGAAACCAAGAATGGAATTGTTCATCTTG
ATGAGATAGTCGAAGAAGCTGACGCTATCATGATCGGAAGAGGTGATCTT
GGCTTGGAGCTCCCAATAGAAAAGGTATTCGTAGCACAGAAATCAATAAT
TGCTCGCTGCCAAATGGCCAAAAAGCCCGTTATGGTCGTCACACAAATGT
TGGAGTCTATGCGTTACAAGCCTAGGGCGACGAGAGCAGAAATCAGTGAT
GTGGCAAATGCAGTTCTGGATGGTGCAGATGGTCTAGTATTATCTGTGGA
AACTGCTAGAGGAATGTACCCAGTTGAAACACTGCAAACAATGCATAGGG
TTTGTCGAGAAGCAGAATCGGCAATGTTCCATCGTCAACTGTTTCTCGAT
TTGAAAATCCACGAAGCATCATCACATATGATTGATCCGACCAAAACTAC
AGCAATTGCTGCAGTTGAGGCATCGAGCAAGGCAAAGGCGTCATGCATTA
TTGTCGTGACCACTTCAGGCCGATCTGCCAGCTTGATTGCCAGCTATCGA
CCACAATGTCCGGTTATTACTGTTACTAGACAAGTGCAAGTAGCTAGACA
ATGCCATTTATGGCGTGGCCTTCACCCCCTGGTTTATACGGAATATAAAG
CTGACGATTGGTCGGAAGACATGGATTTGCGGATCAATTACGCAATTGAA
TGGGGCTGCAGTAGAGGTTTCCTGAAGCCCGGAGATCCTGTGATCATTGT
CACTGGTTGGATTGCAGGAACCGGCTCCACCAATACGGTGCGCGTTTTCT
ATGTGCCTGAAAAGAAAACGACTGAACTGCATGTAGTGCGATCAATTCAG
CGATTGATCGATCTCGGAGATGAAAAGGCAATGGCCGTAGTTCAGGACAT
GGCATCTCTTGATCGTACAGAATCGAATACTCATCTAGGAGTATTCGACA
AGTCCAATCTTTTATACGATTGATTTATGAGCATTTTATTTCACTCTGAC
CTTTAGTGGATTGATCAGAATTATCCTTTTTTCCATTGGTTTTGTGTGCA
TCTTAGTTGATTTAGTTTCAATAATAAATGTTATTTTATATTATTTCATC
TACTGTCAATTGTCAGTAGATCATTTCATTCTATTGCTATATAATTTTTC
AATGTTATTTACGGATTTTATTTTGGTATTTATTGATGTATGATATATTT
AGTTTTTATTATAATTACAAGATCGTCCTATTTATCATTATTGTTTCTGA
GTTGATCCCGATACGTGGAGACATATATTTCATTCAAGTCTCTAATAGCC
ATCTATAATAGAGC
back to top

protein sequence of SMED30020273-orf-1

>SMED30020273-orf-1 ID=SMED30020273-orf-1|Name=SMED30020273-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=584bp
MTTIAEAYLYQTQEQQYSKDAHSQLDHVCQLDIDRKPAYIRQTNIICTIG
DSSDTEEKLRELIENGMNIARLNLTLGSFSYYSKIIHMIRRLEKEMKNAC
VAIAVDLVAPTVRTGLVNNDVMAEVELKEGQQIELTIDDKYKNDCNSENI
WVDSTYFRNVIPAMKTGDRIFIDDGAIIVIVRETGLESARCLVEQGGRLG
SSKRCILPRNALFKHAFSVSFRQNLLFALENQVDMIFSSFIDSRADVLRI
KEVIGPVGRGIKIVAKIETKNGIVHLDEIVEEADAIMIGRGDLGLELPIE
KVFVAQKSIIARCQMAKKPVMVVTQMLESMRYKPRATRAEISDVANAVLD
GADGLVLSVETARGMYPVETLQTMHRVCREAESAMFHRQLFLDLKIHEAS
SHMIDPTKTTAIAAVEASSKAKASCIIVVTTSGRSASLIASYRPQCPVIT
VTRQVQVARQCHLWRGLHPLVYTEYKADDWSEDMDLRINYAIEWGCSRGF
LKPGDPVIIVTGWIAGTGSTNTVRVFYVPEKKTTELHVVRSIQRLIDLGD
EKAMAVVQDMASLDRTESNTHLGVFDKSNLLYD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR040442Pyrv_Kinase-like_dom_sf
IPR036918Pyrv_Knase_C_sf
IPR001697Pyr_Knase
IPR015806Pyrv_Knase_insert_dom_sf
IPR015794Pyrv_Knase_a/b
IPR015813Pyrv/PenolPyrv_Kinase-like_dom
IPR015795Pyrv_Knase_C
IPR015793Pyrv_Knase_brl
IPR011037Pyrv_Knase-like_insert_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0030955potassium ion binding
GO:0004743pyruvate kinase activity
GO:0000287magnesium ion binding
GO:0003824catalytic activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006096glycolytic process
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001697Pyruvate kinasePRINTSPR01050PYRUVTKNASEcoord: 291..315
score: 58.15
coord: 316..340
score: 58.83
coord: 264..290
score: 40.51
coord: 341..359
score: 69.88
coord: 360..376
score: 48.14
coord: 100..116
score: 41.18
coord: 234..248
score: 48.51
IPR001697Pyruvate kinaseTIGRFAMTIGR01064TIGR01064coord: 42..529
e-value: 2.2E-132
score: 439.9
IPR001697Pyruvate kinasePANTHERPTHR11817PYRUVATE KINASEcoord: 6..530
IPR015806Pyruvate kinase, insert domain superfamilyGENE3DG3DSA:2.40.33.10coord: 111..216
e-value: 2.3E-192
score: 641.7
IPR015795Pyruvate kinase, C-terminalPFAMPF02887PK_Ccoord: 410..526
e-value: 1.3E-31
score: 109.3
IPR040442Pyruvate kinase-like domain superfamilyGENE3DG3DSA:3.20.20.60coord: 42..382
e-value: 2.3E-192
score: 641.7
IPR015793Pyruvate kinase, barrelPFAMPF00224PKcoord: 42..391
e-value: 6.4E-110
score: 367.3
IPR036918Pyruvate kinase, C-terminal domain superfamilyGENE3DG3DSA:3.40.1380.20coord: 25..526
e-value: 2.3E-192
score: 641.7
IPR036918Pyruvate kinase, C-terminal domain superfamilySUPERFAMILYSSF52935PK C-terminal domain-likecoord: 370..529
NoneNo IPR availablePANTHERPTHR11817:SF83PYRUVATE KINASE PKMcoord: 6..530
IPR011037Pyruvate kinase-like, insert domain superfamilySUPERFAMILYSSF50800PK beta-barrel domain-likecoord: 111..210
IPR015813Pyruvate/Phosphoenolpyruvate kinase-like domain superfamilySUPERFAMILYSSF51621Phosphoenolpyruvate/pyruvate domaincoord: 18..392