Dynamin-type G domain-containing protein

Overview
NameDynamin-type G domain-containing protein
Smed IDSMED30020268
Length (bp)3959
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynamin-type G domain-containing protein (SMED30020268) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynamin-type G domain-containing protein (SMED30020268) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynamin-type G domain-containing protein (SMED30020268) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynamin-type G domain-containing protein (SMED30020268) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020268

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30020268SMESG000014761.1 SMESG000014754.1 dd_Smed_v4_2777_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30020268SMESG000014761.1 SMESG000014754.1 dd_Smed_v4_2777_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020268SMESG000014761.1 SMESG000014754.1 dd_Smed_v4_2777_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30020268SMESG000014761.1 SMESG000014754.1 dd_Smed_v4_2777_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30020268SMESG000014761.1 SMESG000014754.1 dd_Smed_v4_2777_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30020268SMESG000014761.1 SMESG000014754.1 dd_Smed_v4_2777_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30020268SMESG000014756.1 SMESG000014755.1 dd_Smed_v4_2390_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30020268SMESG000014756.1 SMESG000014755.1 dd_Smed_v4_2390_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30020268SMESG000014756.1 SMESG000014755.1 dd_Smed_v4_2390_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30020268SMESG000014756.1 SMESG000014755.1 dd_Smed_v4_2390_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30020268SMESG000014756.1 SMESG000014755.1 dd_Smed_v4_2390_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30020268SMESG000014756.1 SMESG000014755.1 dd_Smed_v4_2390_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30020268SMESG000014756.1 SMESG000014755.1 dd_Smed_v4_2390_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30020268SMESG000014756.1 SMESG000014755.1 dd_Smed_v4_2390_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30020268SMESG000014756.1 SMESG000014755.1 dd_Smed_v4_2390_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30020268SMESG000014756.1 SMESG000014755.1 dd_Smed_v6_2390_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020268SMESG000014756.1 SMESG000014755.1 dd_Smed_v6_2390_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020268SMESG000014761.1 SMESG000014754.1 dd_Smed_v4_2777_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30020268SMESG000014761.1 SMESG000014754.1 dd_Smed_v4_2777_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020268SMESG000014756.1 SMESG000014755.1 dd_Smed_v4_2390_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Match: MFN2 (mitofusin 2 [Source:HGNC Symbol;Acc:HGNC:16877])

HSP 1 Score: 117.472 bits (293), Expect = 4.586e-26
Identity = 75/242 (30.99%), Postives = 127/242 (52.48%), Query Frame = 2
Query: 1817 TKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFLNIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTC--TLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKE 2536
            +KVR I   + +  +K++FFG  S GKS V+N ++ + +  S +  TT+CF+ V  +D    +L  EGSE    + T     V +L   L ++      +  +V ++ N +  ++K++  + D PG +   E+   I +  LD+D+F+ V     TL   EK FF   S+  S+P+IF+L N+WD S  +   + E  R  ++R    L+ + G     +A  RIFFVSA E+   RI++ +
Sbjct:   83 SKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKT-----VNQLAHALHQDKQLHAGSLVSV-MWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRSQAGDRIFFVSAKEVLNARIQKAQ 318          

HSP 2 Score: 109.768 bits (273), Expect = 1.478e-23
Identity = 69/241 (28.63%), Postives = 123/241 (51.04%), Query Frame = 2
Query:  230 KINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKD-YNDTERNTAKSRIFFISAKEQMDSFMEAKEGINE 943
            K+  I E+L +  + V F G  S GKS +IN++L +++LPS IG T    +R+ G++   + +     E K       ++ +    +   +   +L+ V+  N K P+L D   L+D+PG +        + + C  +D+ V V          EK  F  +SE+ S+ N+FIL N+WD S S+  +  ++ +  +E R   +  D     +R+ A  RIFF+SAKE +++ ++  +G+ E
Sbjct:   84 KVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAG-SLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHME-RCTSFLVDELGVVDRSQAGDRIFFVSAKEVLNARIQKAQGMPE 322          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Match: MFN2 (mitofusin 2 [Source:HGNC Symbol;Acc:HGNC:16877])

HSP 1 Score: 117.472 bits (293), Expect = 4.586e-26
Identity = 75/242 (30.99%), Postives = 127/242 (52.48%), Query Frame = 2
Query: 1817 TKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFLNIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTC--TLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKE 2536
            +KVR I   + +  +K++FFG  S GKS V+N ++ + +  S +  TT+CF+ V  +D    +L  EGSE    + T     V +L   L ++      +  +V ++ N +  ++K++  + D PG +   E+   I +  LD+D+F+ V     TL   EK FF   S+  S+P+IF+L N+WD S  +   + E  R  ++R    L+ + G     +A  RIFFVSA E+   RI++ +
Sbjct:   83 SKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKT-----VNQLAHALHQDKQLHAGSLVSV-MWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRSQAGDRIFFVSAKEVLNARIQKAQ 318          

HSP 2 Score: 109.768 bits (273), Expect = 1.478e-23
Identity = 69/241 (28.63%), Postives = 123/241 (51.04%), Query Frame = 2
Query:  230 KINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKD-YNDTERNTAKSRIFFISAKEQMDSFMEAKEGINE 943
            K+  I E+L +  + V F G  S GKS +IN++L +++LPS IG T    +R+ G++   + +     E K       ++ +    +   +   +L+ V+  N K P+L D   L+D+PG +        + + C  +D+ V V          EK  F  +SE+ S+ N+FIL N+WD S S+  +  ++ +  +E R   +  D     +R+ A  RIFF+SAKE +++ ++  +G+ E
Sbjct:   84 KVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAG-SLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHME-RCTSFLVDELGVVDRSQAGDRIFFVSAKEVLNARIQKAQGMPE 322          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Match: MFN1 (mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262])

HSP 1 Score: 106.686 bits (265), Expect = 7.066e-24
Identity = 71/242 (29.34%), Postives = 129/242 (53.31%), Query Frame = 2
Query: 1820 KVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFL-NIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTC--TLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKE 2536
            K+  I   + +  +K++FFG  S+GKS V+N ++ + +  S +   T+CF++V  +D  + YL  EGS+    S+  +      L  H+ ++    L     V+VF    +  +++++  + D PG++   E+   I +  LD+D+F+ V     TL N EK FF   ++  SKP+IF+L N+WD S  +   + +  R  ++R +  L+ +    ++ EA  RIFFVSA E+   R ++ +
Sbjct:   63 KLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEGSDEK-KSVKTVNQLAHAL--HMDKD----LKAGCLVRVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVVNALEAQNRIFFVSAKEVLSARKQKAQ 297          

HSP 2 Score: 95.9005 bits (237), Expect = 2.885e-20
Identity = 79/294 (26.87%), Postives = 141/294 (47.96%), Query Frame = 2
Query:  143 TFDEEKYDKIFTLNESCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCI--KGCDKEFKDKEA-MYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIE---GRFVDWFKDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINE----------YRKEEFKRF 970
            T+   + D+I T     E  L  ++  + K++ I E+L++  + V F G  S+GKS +IN++L +++LPS IG      + + G++   + +  +G D++   K        +++  D   G     L+ V     K  +L D   L+D+PG +        + + C  +D+ V V        + EK  F  ++E+ SK N+FIL N+WD S S+  +   + +  +E      V+  K  N  E   A++RIFF+SAKE + +  +  +G+ E           R +EF+ F
Sbjct:   39 TYKNPELDRIAT-----EDDLVEMQGYKDKLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAG----CLVRVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVVNALE---AQNRIFFVSAKEVLSARKQKAQGMPESGVALAEGFHARLQEFQNF 320          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Match: MFN1 (mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262])

HSP 1 Score: 107.071 bits (266), Expect = 8.712e-23
Identity = 70/244 (28.69%), Postives = 131/244 (53.69%), Query Frame = 2
Query: 1820 KVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSE--TNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFL-NIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTC--TLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKE 2536
            K+  I   + +  +K++FFG  S+GKS V+N ++ + +  S +   T+CF++V  +D  + YL  EGS+   +  ++  L + +     H+ ++    L     V+VF    +  +++++  + D PG++   E+   I +  LD+D+F+ V     TL N EK FF   ++  SKP+IF+L N+WD S  +   + +  R  ++R +  L+ +    ++ EA  RIFFVSA E+   R ++ +
Sbjct:   63 KLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHAL-----HMDKD----LKAGCLVRVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVVNALEAQNRIFFVSAKEVLSARKQKAQ 297          

HSP 2 Score: 96.6709 bits (239), Expect = 1.591e-19
Identity = 79/294 (26.87%), Postives = 141/294 (47.96%), Query Frame = 2
Query:  143 TFDEEKYDKIFTLNESCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCI--KGCDKEFKDKEA-MYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIE---GRFVDWFKDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINE----------YRKEEFKRF 970
            T+   + D+I T     E  L  ++  + K++ I E+L++  + V F G  S+GKS +IN++L +++LPS IG      + + G++   + +  +G D++   K        +++  D   G     L+ V     K  +L D   L+D+PG +        + + C  +D+ V V        + EK  F  ++E+ SK N+FIL N+WD S S+  +   + +  +E      V+  K  N  E   A++RIFF+SAKE + +  +  +G+ E           R +EF+ F
Sbjct:   39 TYKNPELDRIAT-----EDDLVEMQGYKDKLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAG----CLVRVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVVNALE---AQNRIFFVSAKEVLSARKQKAQGMPESGVALAEGFHARLQEFQNF 320          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Match: MFN1 (mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262])

HSP 1 Score: 107.071 bits (266), Expect = 8.712e-23
Identity = 70/244 (28.69%), Postives = 131/244 (53.69%), Query Frame = 2
Query: 1820 KVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSE--TNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFL-NIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTC--TLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKE 2536
            K+  I   + +  +K++FFG  S+GKS V+N ++ + +  S +   T+CF++V  +D  + YL  EGS+   +  ++  L + +     H+ ++    L     V+VF    +  +++++  + D PG++   E+   I +  LD+D+F+ V     TL N EK FF   ++  SKP+IF+L N+WD S  +   + +  R  ++R +  L+ +    ++ EA  RIFFVSA E+   R ++ +
Sbjct:   63 KLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHAL-----HMDKD----LKAGCLVRVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVVNALEAQNRIFFVSAKEVLSARKQKAQ 297          

HSP 2 Score: 96.6709 bits (239), Expect = 1.591e-19
Identity = 79/294 (26.87%), Postives = 141/294 (47.96%), Query Frame = 2
Query:  143 TFDEEKYDKIFTLNESCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCI--KGCDKEFKDKEA-MYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIE---GRFVDWFKDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINE----------YRKEEFKRF 970
            T+   + D+I T     E  L  ++  + K++ I E+L++  + V F G  S+GKS +IN++L +++LPS IG      + + G++   + +  +G D++   K        +++  D   G     L+ V     K  +L D   L+D+PG +        + + C  +D+ V V        + EK  F  ++E+ SK N+FIL N+WD S S+  +   + +  +E      V+  K  N  E   A++RIFF+SAKE + +  +  +G+ E           R +EF+ F
Sbjct:   39 TYKNPELDRIAT-----EDDLVEMQGYKDKLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAG----CLVRVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVVNALE---AQNRIFFVSAKEVLSARKQKAQGMPESGVALAEGFHARLQEFQNF 320          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Celegans
Match: fzo-1 (Transmembrane GTPase fzo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q23424])

HSP 1 Score: 97.4413 bits (241), Expect = 3.723e-20
Identity = 68/254 (26.77%), Postives = 127/254 (50.00%), Query Frame = 2
Query: 1805 EIIETKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFD--SLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFLNIENE-----IMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTC--TLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKEI 2539
            E I   ++ I    ++D++K+ FFG  S GKS  +N ++ E +    +  TT CF+ V  S+    +L+++ +    D   L  + + + +  + L       +     ++VF   ++E     +++N+  I D PG +   E    I +  LD+D+F+ V     TLT  EK+FF   +K  SKP++F+L N+WD S  +   + +  +  + R    L+ +    S  E + RIFFVS+ E+ + R++ + +
Sbjct:   83 EAIGDSIKTIMDTFQRDNMKVVFFGRTSNGKSTTINAMLHEKVLPQGMGHTTCCFLQVEGSEGEVGHLQLDDNPQKIDMKMLGKIGHALSDENSDLPA-----MGQDSLLKVFHPKKSESGECRLLQNDVVILDSPGVDLSPEFDSWIDKHCLDADVFVLVSNAESTLTQAEKNFFLRVAKKLSKPNVFILNNRWDASAAETENIEDVKKQHLTRFRQFLVDELEVCSEREVNDRIFFVSSREVLESRLKARGL 331          

HSP 2 Score: 87.0409 bits (214), Expect = 5.713e-17
Identity = 68/245 (27.76%), Postives = 122/245 (49.80%), Query Frame = 2
Query:  233 INNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDE---LDGNDNEALIEVVISNPKKP------ILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTY--VFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKDYND--TERNTAKSRIFFISAKEQMDSFMEAK 928
            I  I +   +  + V+F G  S GKS  IN++L E++LP  +G T    +++ GS      ++  D   K    M  ++ +  +DE   L     ++L++V   +PKK       +L +   ++D+PG + +      + + C  +D+ V V       +  EK  F  +++K SK N+FIL N+WD S + ET  ++  K     RF  +  D  +  +ER     RIFF+S++E ++S ++A+
Sbjct:   89 IKTIMDTFQRDNMKVVFFGRTSNGKSTTINAMLHEKVLPQGMGHTTCCFLQVEGSEGEVGHLQLDDNPQKIDMKMLGKIGHALSDENSDLPAMGQDSLLKVF--HPKKSESGECRLLQNDVVILDSPGVDLSPEFDSWIDKHCLDADVFVLVSNAESTLTQAEKNFFLRVAKKLSKPNVFILNNRWDAS-AAETENIEDVKKQHLTRFRQFLVDELEVCSEREV-NDRIFFVSSREVLESRLKAR 329          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Fly
Match: Marf (gene:FBgn0029870 transcript:FBtr0343373)

HSP 1 Score: 129.413 bits (324), Expect = 5.950e-30
Identity = 87/265 (32.83%), Postives = 145/265 (54.72%), Query Frame = 2
Query: 1820 KVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFLNIEN-EIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTC--TLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKS-DQDKTAVTEKSRIKIKR--EIVNLLTKDGNFSSE-EASKRIFFVSALEMFKCRIERKEIFGNQRTRRAI----EMRY 2581
            KV  I   +++D +K++FFG  S GKS V+N ++ E +  S +  TT+CF  V  S+ G  YL  EGSE   + +      +K+L   L +    +L  +  V++F   E   +++++    D PG +    + + I    L++D+F+ V+    T+T  EK FF   S+  SKP+IF+L N+WD S ++ +   +E +++K +     ++ LTK+   S+E EA++R+FFVSA E  + RIE  E  GN     AI    ++RY
Sbjct:  125 KVAAIREVLQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVVN-----IKQLANALCQE---KLCESSLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEPECQESELAKVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETLQARIE--EAKGNPPHMGAIAEGFQIRY 379          

HSP 2 Score: 105.145 bits (261), Expect = 1.785e-22
Identity = 71/242 (29.34%), Postives = 120/242 (49.59%), Query Frame = 2
Query:  230 KINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTY--VFSDEEKEMFKLISEKTSKLNLFILVNKWD----ESDSDETFTVKMSKDMIEGRFVDWF-KDYNDTERNTAKSRIFFISAKEQMDSFMEAKEG 934
            K+  IRE+L +  + V F G  S GKS +IN++L E+ILPS IG T     ++ GSN G + +     E K      +++ N    E       +L+ +     +  +L D    +D+PG + +    + +   C  +D+ V V+      +  EK+ F  +S+K SK N+FIL N+WD    E +  E+   K+     E R +D+  K+   +    A  R+FF+SA+E + + +E  +G
Sbjct:  125 KVAAIREVLQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVVNIKQLANALCQEKLCES--SLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEPECQESELAKVKSQHTE-RCIDFLTKELKVSNEKEAAERVFFVSARETLQARIEEAKG 363          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Fly
Match: Marf (gene:FBgn0029870 transcript:FBtr0070910)

HSP 1 Score: 128.257 bits (321), Expect = 1.116e-29
Identity = 86/262 (32.82%), Postives = 140/262 (53.44%), Query Frame = 2
Query: 1820 KVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFLNIEN-EIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTC--TLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSE-EASKRIFFVSALEMFKCRIERKEIFGNQRTRRAI----EMRY 2581
            KV  I   +++D +K++FFG  S GKS V+N ++ E +  S +  TT+CF  V  S+ G  YL  EGSE   + +      +K+L   L +    +L  +  V++F   E   +++++    D PG +    + + I    L++D+F+ V+    T+T  EK FF   S+  SKP+IF+L N+WD S  ++    E  + +     ++ LTK+   S+E EA++R+FFVSA E  + RIE  E  GN     AI    ++RY
Sbjct:  125 KVAAIREVLQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVVN-----IKQLANALCQE---KLCESSLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDAS-ANEPECQESVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETLQARIE--EAKGNPPHMGAIAEGFQIRY 375          

HSP 2 Score: 104.76 bits (260), Expect = 2.415e-22
Identity = 69/238 (28.99%), Postives = 118/238 (49.58%), Query Frame = 2
Query:  230 KINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTY--VFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWF-KDYNDTERNTAKSRIFFISAKEQMDSFMEAKEG 934
            K+  IRE+L +  + V F G  S GKS +IN++L E+ILPS IG T     ++ GSN G + +     E K      +++ N    E       +L+ +     +  +L D    +D+PG + +    + +   C  +D+ V V+      +  EK+ F  +S+K SK N+FIL N+WD S ++      +     E R +D+  K+   +    A  R+FF+SA+E + + +E  +G
Sbjct:  125 KVAAIREVLQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVVNIKQLANALCQEKLCES--SLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEPECQESVKSQHTE-RCIDFLTKELKVSNEKEAAERVFFVSARETLQARIEEAKG 359          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Fly
Match: Marf (gene:FBgn0029870 transcript:FBtr0070909)

HSP 1 Score: 128.257 bits (321), Expect = 1.116e-29
Identity = 86/262 (32.82%), Postives = 140/262 (53.44%), Query Frame = 2
Query: 1820 KVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFLNIEN-EIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTC--TLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSE-EASKRIFFVSALEMFKCRIERKEIFGNQRTRRAI----EMRY 2581
            KV  I   +++D +K++FFG  S GKS V+N ++ E +  S +  TT+CF  V  S+ G  YL  EGSE   + +      +K+L   L +    +L  +  V++F   E   +++++    D PG +    + + I    L++D+F+ V+    T+T  EK FF   S+  SKP+IF+L N+WD S  ++    E  + +     ++ LTK+   S+E EA++R+FFVSA E  + RIE  E  GN     AI    ++RY
Sbjct:  125 KVAAIREVLQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVVN-----IKQLANALCQE---KLCESSLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDAS-ANEPECQESVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETLQARIE--EAKGNPPHMGAIAEGFQIRY 375          

HSP 2 Score: 104.76 bits (260), Expect = 2.415e-22
Identity = 69/238 (28.99%), Postives = 118/238 (49.58%), Query Frame = 2
Query:  230 KINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTY--VFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWF-KDYNDTERNTAKSRIFFISAKEQMDSFMEAKEG 934
            K+  IRE+L +  + V F G  S GKS +IN++L E+ILPS IG T     ++ GSN G + +     E K      +++ N    E       +L+ +     +  +L D    +D+PG + +    + +   C  +D+ V V+      +  EK+ F  +S+K SK N+FIL N+WD S ++      +     E R +D+  K+   +    A  R+FF+SA+E + + +E  +G
Sbjct:  125 KVAAIREVLQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVVNIKQLANALCQEKLCES--SLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEPECQESVKSQHTE-RCIDFLTKELKVSNEKEAAERVFFVSARETLQARIEEAKG 359          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Fly
Match: fzo (gene:FBgn0011596 transcript:FBtr0084399)

HSP 1 Score: 109.768 bits (273), Expect = 6.320e-24
Identity = 69/241 (28.63%), Postives = 130/241 (53.94%), Query Frame = 2
Query: 1817 TKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGR-HYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFLNIEN-EIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTC--TLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKD-GNFS-SEEASKRIFFVSALEMFKCR 2521
            ++V  I   + +D +K++FFG  S GKS V+N ++ E +  SA+  TTSCF  V+ +      +++VE  + + +        +  L+   S ++ G L  +  +QV +      I+  +  + D PG +   ++ +C+    +D+D+FI V+    T++  E+ FF+  +   S+P++F+L N+WDK+   +  + +K + +     VNLL  + G +S ++EA +RI+ VSALE    R
Sbjct:   73 SRVEAIAKVLSRDRMKVAFFGRTSNGKSAVINALLHEKILPSAMGHTTSCFCQVQANGSNETEHVKVEQEDEHME--------LSALSQLASAHSPGALKPSTLLQVNMAKNRCSILDYDVVLMDTPGVDVTAQLDDCLDSYCMDADVFILVLNAESTVSRVERQFFKDVASKLSRPNLFILNNRWDKASSLEPEMEQKVKDQHMERCVNLLVDELGVYSTAQEAWERIYHVSALEALHIR 305          

HSP 2 Score: 95.1301 bits (235), Expect = 2.254e-19
Identity = 73/276 (26.45%), Postives = 137/276 (49.64%), Query Frame = 2
Query:  200 LLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGN-DNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTY--VFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKD----YNDTERNTAKSRIFFISAKEQM---DSFMEAKEGINEYRKEEFKRFITELNKSLS 997
            +L  + A   ++  I ++L++  + V F G  S GKS +IN++L E+ILPS++G T +   ++    NG++  +    E +D+      +  +++    G      L++V ++  +  IL+    L+DTPG +   +  + +   C  +D+ + V+      S  E++ FK ++ K S+ NLFIL N+WD++ S E    +  KD    R V+   D    Y+  +   A  RI+ +SA E +   +  +    G  + R +EF RF  + +  L+
Sbjct:   64 MLEHLCAFSSRVEAIAKVLSRDRMKVAFFGRTSNGKSAVINALLHEKILPSAMGHTTSCFCQVQA--NGSNETEHVKVEQEDEHMELSALSQLASAHSPGALKPSTLLQVNMAKNRCSILDYDVVLMDTPGVDVTAQLDDCLDSYCMDADVFILVLNAESTVSRVERQFFKDVASKLSRPNLFILNNRWDKASSLEPEMEQKVKDQHMERCVNLLVDELGVYSTAQE--AWERIYHVSALEALHIRNGQITNPSGQTQQRYQEFLRFENDFSNCLA 335          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Match: mfn1b (mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553])

HSP 1 Score: 112.849 bits (281), Expect = 1.951e-26
Identity = 80/262 (30.53%), Postives = 139/262 (53.05%), Query Frame = 2
Query: 1778 TIENFVKKYEIIE-----TKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFL-NIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMT--CTLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGN-FSSEEASKRIFFVSALEMFKCRIERKE 2536
            ++EN   K ++ E     +K+  I+  + +  +K++FFG  S GKS V+N ++ + +  S +  TT+CF++V  +D  + +L+ EGSE    S+  +      L  H+ E+    LD    V+VF    +  +++++  + D PG++   E+   I +  LD+D+F+ V     TL N EK FF   ++  SKP+IF+L N+WD S  +   + E  R +     VN L ++       +A  RIFFVSA E+   R++R +
Sbjct:   45 SLENIANKDQLDEIESYTSKLSIIQEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAFLKTEGSEEE-KSIKTVNQLAHAL--HMDES----LDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAAEPEYM-EDVRKQHTDRCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRMQRAQ 298          

HSP 2 Score: 105.145 bits (261), Expect = 8.986e-24
Identity = 78/261 (29.89%), Postives = 135/261 (51.72%), Query Frame = 2
Query:  182 NESCESL-----LSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIK--GCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWF-KDYNDTERNTAKSRIFFISAKEQMDSFMEAKEG 934
            NES E++     L  I +   K++ I+E+L +  + V F G  S GKS +IN++L + +LPS IG T    + + G++   + +K  G ++E K  + + +    +  DE    D   L++V     K  +L D   L+D+PG +        + + C  +D+ V V        + EK  F  ++EK SK N+FIL N+WD S ++  +   + K   + R V++  ++    +R  A +RIFF+SAKE ++S M+  +G
Sbjct:   43 NESLENIANKDQLDEIESYTSKLSIIQEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAFLKTEGSEEE-KSIKTVNQLAHALHMDE--SLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAAEPEYMEDVRKQHTD-RCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRMQRAQG 299          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Match: mfn1b (mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553])

HSP 1 Score: 113.235 bits (282), Expect = 1.954e-26
Identity = 80/262 (30.53%), Postives = 139/262 (53.05%), Query Frame = 2
Query: 1778 TIENFVKKYEIIE-----TKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFL-NIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMT--CTLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGN-FSSEEASKRIFFVSALEMFKCRIERKE 2536
            ++EN   K ++ E     +K+  I+  + +  +K++FFG  S GKS V+N ++ + +  S +  TT+CF++V  +D  + +L+ EGSE    S+  +      L  H+ E+    LD    V+VF    +  +++++  + D PG++   E+   I +  LD+D+F+ V     TL N EK FF   ++  SKP+IF+L N+WD S  +   + E  R +     VN L ++       +A  RIFFVSA E+   R++R +
Sbjct:   45 SLENIANKDQLDEIESYTSKLSIIQEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAFLKTEGSEEE-KSIKTVNQLAHAL--HMDES----LDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAAEPEYM-EDVRKQHTDRCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRMQRAQ 298          

HSP 2 Score: 107.071 bits (266), Expect = 2.506e-24
Identity = 80/269 (29.74%), Postives = 134/269 (49.81%), Query Frame = 2
Query:  182 NESCESL-----LSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDEL-------DGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWF-KDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINE 943
            NES E++     L  I +   K++ I+E+L +  + V F G  S GKS +IN++L + +LPS IG T    + + G++         DK F   E   EE    + ++L       +  D   L++V     K  +L D   L+D+PG +        + + C  +D+ V V        + EK  F  ++EK SK N+FIL N+WD S ++  +   + K   + R V++  ++    +R  A +RIFF+SAKE ++S M+  +G+ E
Sbjct:   43 NESLENIANKDQLDEIESYTSKLSIIQEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDE--------DKAFLKTEGSEEEKSIKTVNQLAHALHMDESLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAAEPEYMEDVRKQHTD-RCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRMQRAQGMPE 302          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Match: mfn1b (mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553])

HSP 1 Score: 112.849 bits (281), Expect = 8.155e-25
Identity = 79/264 (29.92%), Postives = 141/264 (53.41%), Query Frame = 2
Query: 1778 TIENFVKKYEIIE-----TKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGS--ETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFL-NIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMT--CTLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGN-FSSEEASKRIFFVSALEMFKCRIERKE 2536
            ++EN   K ++ E     +K+  I+  + +  +K++FFG  S GKS V+N ++ + +  S +  TT+CF++V  +D  + +L+ EGS  E +  ++  L + +     H+ E+    LD    V+VF    +  +++++  + D PG++   E+   I +  LD+D+F+ V     TL N EK FF   ++  SKP+IF+L N+WD S  +   + E  R +     VN L ++       +A  RIFFVSA E+   R++R +
Sbjct:   45 SLENIANKDQLDEIESYTSKLSIIQEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAFLKTEGSEEEKSIKTVNQLAHAL-----HMDES----LDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAAEPEYM-EDVRKQHTDRCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRMQRAQ 298          

HSP 2 Score: 107.457 bits (267), Expect = 3.698e-23
Identity = 80/269 (29.74%), Postives = 134/269 (49.81%), Query Frame = 2
Query:  182 NESCESL-----LSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDEL-------DGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWF-KDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINE 943
            NES E++     L  I +   K++ I+E+L +  + V F G  S GKS +IN++L + +LPS IG T    + + G++         DK F   E   EE    + ++L       +  D   L++V     K  +L D   L+D+PG +        + + C  +D+ V V        + EK  F  ++EK SK N+FIL N+WD S ++  +   + K   + R V++  ++    +R  A +RIFF+SAKE ++S M+  +G+ E
Sbjct:   43 NESLENIANKDQLDEIESYTSKLSIIQEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDE--------DKAFLKTEGSEEEKSIKTVNQLAHALHMDESLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAAEPEYMEDVRKQHTD-RCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRMQRAQGMPE 302          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Match: mfn1b (mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553])

HSP 1 Score: 112.849 bits (281), Expect = 8.155e-25
Identity = 79/264 (29.92%), Postives = 141/264 (53.41%), Query Frame = 2
Query: 1778 TIENFVKKYEIIE-----TKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGS--ETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFL-NIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMT--CTLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGN-FSSEEASKRIFFVSALEMFKCRIERKE 2536
            ++EN   K ++ E     +K+  I+  + +  +K++FFG  S GKS V+N ++ + +  S +  TT+CF++V  +D  + +L+ EGS  E +  ++  L + +     H+ E+    LD    V+VF    +  +++++  + D PG++   E+   I +  LD+D+F+ V     TL N EK FF   ++  SKP+IF+L N+WD S  +   + E  R +     VN L ++       +A  RIFFVSA E+   R++R +
Sbjct:   45 SLENIANKDQLDEIESYTSKLSIIQEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAFLKTEGSEEEKSIKTVNQLAHAL-----HMDES----LDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAAEPEYM-EDVRKQHTDRCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRMQRAQ 298          

HSP 2 Score: 107.457 bits (267), Expect = 3.698e-23
Identity = 80/269 (29.74%), Postives = 134/269 (49.81%), Query Frame = 2
Query:  182 NESCESL-----LSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDEL-------DGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWF-KDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINE 943
            NES E++     L  I +   K++ I+E+L +  + V F G  S GKS +IN++L + +LPS IG T    + + G++         DK F   E   EE    + ++L       +  D   L++V     K  +L D   L+D+PG +        + + C  +D+ V V        + EK  F  ++EK SK N+FIL N+WD S ++  +   + K   + R V++  ++    +R  A +RIFF+SAKE ++S M+  +G+ E
Sbjct:   43 NESLENIANKDQLDEIESYTSKLSIIQEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDE--------DKAFLKTEGSEEEKSIKTVNQLAHALHMDESLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAAEPEYMEDVRKQHTD-RCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRMQRAQGMPE 302          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Match: mfn1b (mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553])

HSP 1 Score: 112.849 bits (281), Expect = 8.775e-25
Identity = 79/264 (29.92%), Postives = 141/264 (53.41%), Query Frame = 2
Query: 1778 TIENFVKKYEIIE-----TKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGS--ETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFL-NIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMT--CTLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGN-FSSEEASKRIFFVSALEMFKCRIERKE 2536
            ++EN   K ++ E     +K+  I+  + +  +K++FFG  S GKS V+N ++ + +  S +  TT+CF++V  +D  + +L+ EGS  E +  ++  L + +     H+ E+    LD    V+VF    +  +++++  + D PG++   E+   I +  LD+D+F+ V     TL N EK FF   ++  SKP+IF+L N+WD S  +   + E  R +     VN L ++       +A  RIFFVSA E+   R++R +
Sbjct:   45 SLENIANKDQLDEIESYTSKLSIIQEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAFLKTEGSEEEKSIKTVNQLAHAL-----HMDES----LDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAAEPEYM-EDVRKQHTDRCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRMQRAQ 298          

HSP 2 Score: 105.916 bits (263), Expect = 1.254e-22
Identity = 78/261 (29.89%), Postives = 135/261 (51.72%), Query Frame = 2
Query:  182 NESCESL-----LSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIK--GCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWF-KDYNDTERNTAKSRIFFISAKEQMDSFMEAKEG 934
            NES E++     L  I +   K++ I+E+L +  + V F G  S GKS +IN++L + +LPS IG T    + + G++   + +K  G ++E K  + + +    +  DE    D   L++V     K  +L D   L+D+PG +        + + C  +D+ V V        + EK  F  ++EK SK N+FIL N+WD S ++  +   + K   + R V++  ++    +R  A +RIFF+SAKE ++S M+  +G
Sbjct:   43 NESLENIANKDQLDEIESYTSKLSIIQEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAFLKTEGSEEE-KSIKTVNQLAHALHMDE--SLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAAEPEYMEDVRKQHTD-RCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRMQRAQG 299          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 111.309 bits (277), Expect = 4.240e-24
Identity = 77/254 (30.31%), Postives = 137/254 (53.94%), Query Frame = 2
Query: 1784 ENFVKKYEIIETKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFL-NIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMT--CTLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKE 2536
            E+ V K +  +TK+  I   + + ++K++FFG  S+GKS V+N+++ + +  S +  TT+CF++V  ++  + YL  EGSE    S+  +      L  H+ ++    L     V VF    +  +++++  + D PG++   E+   I +  LD+D+F+ V     TL N EK FF   ++  SKP+IF+L N+WD S  +   + +  +  ++R    L+ +     S EA KRIFFVSA E+   R+ + +
Sbjct:   62 EDDVNKVKASKTKLAGIGEVLARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGDKAYLMTEGSEEK-KSVKTVNQLAHAL--HMDKD----LGAGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHMERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMHKAQ 308          

HSP 2 Score: 105.916 bits (263), Expect = 1.598e-22
Identity = 76/259 (29.34%), Postives = 127/259 (49.03%), Query Frame = 2
Query:  182 NESCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIE---GRFVDWFKDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINE 943
            N S E  +++++A + K+  I E+L +  + V F G  S+GKS +INS+L +++LPS IG T    + + G+    + +     E K       ++ +    + D      L+ V     K  +L D   L+D+PG +        + + C  +D+ V V        + EK  F  ++EK SK N+FIL N+WD S S+  +   + K  +E      VD  K  +  E   A+ RIFF+SAKE +++ M   +G+ E
Sbjct:   58 NVSTEDDVNKVKASKTKLAGIGEVLARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGDKAYLMTEGSEEKKSVKTVNQLAHALHMDKDLGAG-CLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHMERCQSFLVDELKVVDSLE---AQKRIFFVSAKEVLNARMHKAQGMPE 312          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 110.923 bits (276), Expect = 5.502e-24
Identity = 77/256 (30.08%), Postives = 138/256 (53.91%), Query Frame = 2
Query: 1778 TIENFVKKYEIIETKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFL-NIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMT--CTLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKE 2536
            + E+ V K +  +TK+  I   + + ++K++FFG  S+GKS V+N+++ + +  S +  TT+CF++V  ++  + YL  EGSE    S+  +      L  H+ ++    L     V VF    +  +++++  + D PG++   E+   I +  LD+D+F+ V     TL N EK FF   ++  SKP+IF+L N+WD S  +   + +  +  ++R    L+ +     S EA KRIFFVSA E+   R+ + +
Sbjct:   68 STEDDVNKVKASKTKLAGIGEVLARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGDKAYLMTEGSEEK-KSVKTVNQLAHAL--HMDKD----LGAGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHMERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMHKAQ 316          

HSP 2 Score: 109.383 bits (272), Expect = 1.575e-23
Identity = 80/272 (29.41%), Postives = 132/272 (48.53%), Query Frame = 2
Query:  143 TFDEEKYDKIFTLNESCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIE---GRFVDWFKDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINE 943
            TF EE +      N S E  +++++A + K+  I E+L +  + V F G  S+GKS +INS+L +++LPS IG T    + + G+    + +     E K       ++ +    + D      L+ V     K  +L D   L+D+PG +        + + C  +D+ V V        + EK  F  ++EK SK N+FIL N+WD S S+  +   + K  +E      VD  K  +  E   A+ RIFF+SAKE +++ M   +G+ E
Sbjct:   53 TFVEETFQNPELKNVSTEDDVNKVKASKTKLAGIGEVLARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGDKAYLMTEGSEEKKSVKTVNQLAHALHMDKDLGAG-CLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHMERCQSFLVDELKVVDSLE---AQKRIFFVSAKEVLNARMHKAQGMPE 320          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 110.538 bits (275), Expect = 5.691e-24
Identity = 77/256 (30.08%), Postives = 138/256 (53.91%), Query Frame = 2
Query: 1778 TIENFVKKYEIIETKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFL-NIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMT--CTLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKE 2536
            + E+ V K +  +TK+  I   + + ++K++FFG  S+GKS V+N+++ + +  S +  TT+CF++V  ++  + YL  EGSE    S+  +      L  H+ ++    L     V VF    +  +++++  + D PG++   E+   I +  LD+D+F+ V     TL N EK FF   ++  SKP+IF+L N+WD S  +   + +  +  ++R    L+ +     S EA KRIFFVSA E+   R+ + +
Sbjct:   50 STEDDVNKVKASKTKLAGIGEVLARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGDKAYLMTEGSEEK-KSVKTVNQLAHAL--HMDKD----LGAGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHMERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMHKAQ 298          

HSP 2 Score: 109.383 bits (272), Expect = 1.675e-23
Identity = 80/272 (29.41%), Postives = 132/272 (48.53%), Query Frame = 2
Query:  143 TFDEEKYDKIFTLNESCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIE---GRFVDWFKDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINE 943
            TF EE +      N S E  +++++A + K+  I E+L +  + V F G  S+GKS +INS+L +++LPS IG T    + + G+    + +     E K       ++ +    + D      L+ V     K  +L D   L+D+PG +        + + C  +D+ V V        + EK  F  ++EK SK N+FIL N+WD S S+  +   + K  +E      VD  K  +  E   A+ RIFF+SAKE +++ M   +G+ E
Sbjct:   35 TFVEETFQNPELKNVSTEDDVNKVKASKTKLAGIGEVLARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGDKAYLMTEGSEEKKSVKTVNQLAHALHMDKDLGAG-CLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHMERCQSFLVDELKVVDSLE---AQKRIFFVSAKEVLNARMHKAQGMPE 302          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 110.538 bits (275), Expect = 5.730e-24
Identity = 77/256 (30.08%), Postives = 138/256 (53.91%), Query Frame = 2
Query: 1778 TIENFVKKYEIIETKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFL-NIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMT--CTLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKE 2536
            + E+ V K +  +TK+  I   + + ++K++FFG  S+GKS V+N+++ + +  S +  TT+CF++V  ++  + YL  EGSE    S+  +      L  H+ ++    L     V VF    +  +++++  + D PG++   E+   I +  LD+D+F+ V     TL N EK FF   ++  SKP+IF+L N+WD S  +   + +  +  ++R    L+ +     S EA KRIFFVSA E+   R+ + +
Sbjct:   50 STEDDVNKVKASKTKLAGIGEVLARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGDKAYLMTEGSEEK-KSVKTVNQLAHAL--HMDKD----LGAGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHMERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMHKAQ 298          

HSP 2 Score: 108.997 bits (271), Expect = 1.649e-23
Identity = 80/272 (29.41%), Postives = 132/272 (48.53%), Query Frame = 2
Query:  143 TFDEEKYDKIFTLNESCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIE---GRFVDWFKDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINE 943
            TF EE +      N S E  +++++A + K+  I E+L +  + V F G  S+GKS +INS+L +++LPS IG T    + + G+    + +     E K       ++ +    + D      L+ V     K  +L D   L+D+PG +        + + C  +D+ V V        + EK  F  ++EK SK N+FIL N+WD S S+  +   + K  +E      VD  K  +  E   A+ RIFF+SAKE +++ M   +G+ E
Sbjct:   35 TFVEETFQNPELKNVSTEDDVNKVKASKTKLAGIGEVLARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGDKAYLMTEGSEEKKSVKTVNQLAHALHMDKDLGAG-CLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHMERCQSFLVDELKVVDSLE---AQKRIFFVSAKEVLNARMHKAQGMPE 302          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 110.538 bits (275), Expect = 5.904e-24
Identity = 77/256 (30.08%), Postives = 138/256 (53.91%), Query Frame = 2
Query: 1778 TIENFVKKYEIIETKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFL-NIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMT--CTLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKE 2536
            + E+ V K +  +TK+  I   + + ++K++FFG  S+GKS V+N+++ + +  S +  TT+CF++V  ++  + YL  EGSE    S+  +      L  H+ ++    L     V VF    +  +++++  + D PG++   E+   I +  LD+D+F+ V     TL N EK FF   ++  SKP+IF+L N+WD S  +   + +  +  ++R    L+ +     S EA KRIFFVSA E+   R+ + +
Sbjct:   65 STEDDVNKVKASKTKLAGIGEVLARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGDKAYLMTEGSEEK-KSVKTVNQLAHAL--HMDKD----LGAGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHMERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMHKAQ 313          

HSP 2 Score: 108.997 bits (271), Expect = 1.780e-23
Identity = 80/272 (29.41%), Postives = 132/272 (48.53%), Query Frame = 2
Query:  143 TFDEEKYDKIFTLNESCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIE---GRFVDWFKDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINE 943
            TF EE +      N S E  +++++A + K+  I E+L +  + V F G  S+GKS +INS+L +++LPS IG T    + + G+    + +     E K       ++ +    + D      L+ V     K  +L D   L+D+PG +        + + C  +D+ V V        + EK  F  ++EK SK N+FIL N+WD S S+  +   + K  +E      VD  K  +  E   A+ RIFF+SAKE +++ M   +G+ E
Sbjct:   50 TFVEETFQNPELKNVSTEDDVNKVKASKTKLAGIGEVLARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGDKAYLMTEGSEEKKSVKTVNQLAHALHMDKDLGAG-CLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHMERCQSFLVDELKVVDSLE---AQKRIFFVSAKEVLNARMHKAQGMPE 317          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Match: Mfn2 (mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230])

HSP 1 Score: 114.775 bits (286), Expect = 1.260e-25
Identity = 74/242 (30.58%), Postives = 126/242 (52.07%), Query Frame = 2
Query: 1817 TKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFLNIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTC--TLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKE 2536
            +KVR I   + +  +K++FFG  S GKS V+N ++ + +  S +  TT+CF+ V  +D    +L  EGSE      T     V +L   L ++      +  +V ++ N +  ++K++  + D PG +   E+   I +  LD+D+F+ V     TL   EK FF   S+  S+P+IF+L N+WD S  +   + E  R  ++R    L+ + G     +A  RIFFVSA E+   R+++ +
Sbjct:   83 SKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEKKSVKT-----VNQLAHALHQDEQLHAGSMVSV-MWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQ 318          

HSP 2 Score: 108.612 bits (270), Expect = 1.114e-23
Identity = 71/243 (29.22%), Postives = 125/243 (51.44%), Query Frame = 2
Query:  230 KINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTS-CIKGCDKEFKDKEAMYEEVMNVSTDE-LDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKD-YNDTERNTAKSRIFFISAKEQMDSFMEAKEGINE 943
            K+  I E+L +  + V F G  S GKS +IN++L +++LPS IG T    +R+ G++   +  +    +E K  + + +    +  DE L      +++ V+  N K P+L D   L+D+PG +        + + C  +D+ V V          EK+ F  +SE+ S+ N+FIL N+WD S S+  +  ++ +  +E R   +  D     +R  A  RIFF+SAKE + + ++  +G+ E
Sbjct:   84 KVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEKKSVKTVNQLAHALHQDEQLHAG---SMVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHME-RCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPE 322          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Match: Mfn2 (mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230])

HSP 1 Score: 114.775 bits (286), Expect = 2.145e-25
Identity = 74/242 (30.58%), Postives = 126/242 (52.07%), Query Frame = 2
Query: 1817 TKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFLNIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTC--TLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKE 2536
            +KVR I   + +  +K++FFG  S GKS V+N ++ + +  S +  TT+CF+ V  +D    +L  EGSE      T     V +L   L ++      +  +V ++ N +  ++K++  + D PG +   E+   I +  LD+D+F+ V     TL   EK FF   S+  S+P+IF+L N+WD S  +   + E  R  ++R    L+ + G     +A  RIFFVSA E+   R+++ +
Sbjct:   83 SKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEKKSVKT-----VNQLAHALHQDEQLHAGSMVSV-MWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQ 318          

HSP 2 Score: 108.612 bits (270), Expect = 1.954e-23
Identity = 71/243 (29.22%), Postives = 125/243 (51.44%), Query Frame = 2
Query:  230 KINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTS-CIKGCDKEFKDKEAMYEEVMNVSTDE-LDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKD-YNDTERNTAKSRIFFISAKEQMDSFMEAKEGINE 943
            K+  I E+L +  + V F G  S GKS +IN++L +++LPS IG T    +R+ G++   +  +    +E K  + + +    +  DE L      +++ V+  N K P+L D   L+D+PG +        + + C  +D+ V V          EK+ F  +SE+ S+ N+FIL N+WD S S+  +  ++ +  +E R   +  D     +R  A  RIFF+SAKE + + ++  +G+ E
Sbjct:   84 KVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEKKSVKTVNQLAHALHQDEQLHAG---SMVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHME-RCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPE 322          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Match: Mfn2 (mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230])

HSP 1 Score: 114.775 bits (286), Expect = 2.145e-25
Identity = 74/242 (30.58%), Postives = 126/242 (52.07%), Query Frame = 2
Query: 1817 TKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFLNIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTC--TLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKE 2536
            +KVR I   + +  +K++FFG  S GKS V+N ++ + +  S +  TT+CF+ V  +D    +L  EGSE      T     V +L   L ++      +  +V ++ N +  ++K++  + D PG +   E+   I +  LD+D+F+ V     TL   EK FF   S+  S+P+IF+L N+WD S  +   + E  R  ++R    L+ + G     +A  RIFFVSA E+   R+++ +
Sbjct:   83 SKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEKKSVKT-----VNQLAHALHQDEQLHAGSMVSV-MWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQ 318          

HSP 2 Score: 108.612 bits (270), Expect = 1.954e-23
Identity = 71/243 (29.22%), Postives = 125/243 (51.44%), Query Frame = 2
Query:  230 KINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTS-CIKGCDKEFKDKEAMYEEVMNVSTDE-LDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKD-YNDTERNTAKSRIFFISAKEQMDSFMEAKEGINE 943
            K+  I E+L +  + V F G  S GKS +IN++L +++LPS IG T    +R+ G++   +  +    +E K  + + +    +  DE L      +++ V+  N K P+L D   L+D+PG +        + + C  +D+ V V          EK+ F  +SE+ S+ N+FIL N+WD S S+  +  ++ +  +E R   +  D     +R  A  RIFF+SAKE + + ++  +G+ E
Sbjct:   84 KVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEKKSVKTVNQLAHALHQDEQLHAG---SMVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHME-RCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPE 322          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Match: Mfn2 (mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230])

HSP 1 Score: 114.775 bits (286), Expect = 2.145e-25
Identity = 74/242 (30.58%), Postives = 126/242 (52.07%), Query Frame = 2
Query: 1817 TKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFLNIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTC--TLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKE 2536
            +KVR I   + +  +K++FFG  S GKS V+N ++ + +  S +  TT+CF+ V  +D    +L  EGSE      T     V +L   L ++      +  +V ++ N +  ++K++  + D PG +   E+   I +  LD+D+F+ V     TL   EK FF   S+  S+P+IF+L N+WD S  +   + E  R  ++R    L+ + G     +A  RIFFVSA E+   R+++ +
Sbjct:   83 SKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEKKSVKT-----VNQLAHALHQDEQLHAGSMVSV-MWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQ 318          

HSP 2 Score: 108.612 bits (270), Expect = 1.954e-23
Identity = 71/243 (29.22%), Postives = 125/243 (51.44%), Query Frame = 2
Query:  230 KINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTS-CIKGCDKEFKDKEAMYEEVMNVSTDE-LDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKD-YNDTERNTAKSRIFFISAKEQMDSFMEAKEGINE 943
            K+  I E+L +  + V F G  S GKS +IN++L +++LPS IG T    +R+ G++   +  +    +E K  + + +    +  DE L      +++ V+  N K P+L D   L+D+PG +        + + C  +D+ V V          EK+ F  +SE+ S+ N+FIL N+WD S S+  +  ++ +  +E R   +  D     +R  A  RIFF+SAKE + + ++  +G+ E
Sbjct:   84 KVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEKKSVKTVNQLAHALHQDEQLHAG---SMVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHME-RCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPE 322          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Match: Mfn1 (mitofusin 1 [Source:MGI Symbol;Acc:MGI:1914664])

HSP 1 Score: 108.227 bits (269), Expect = 2.777e-23
Identity = 72/239 (30.13%), Postives = 127/239 (53.14%), Query Frame = 2
Query: 1820 KVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSE--TNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFL-NIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMT--CTLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCR 2521
            K+  I   + +  +K++FFG  S+GKS V+N ++ + +  S +  TT+CF++V  +D  + YL  EGS+   +  ++  L + +     H+ ++    L     V VF    +  +++++  + D PG++   E+   I +  LD+D+F+ V     TL N EK FF   ++  SKP+IF+L N+WD S  +   + +  R  ++R +  L+ +    S  EA  RIFFVSA E+   R
Sbjct:   63 KLAVIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHTTNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHAL-----HMDKD----LKAGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDIWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVVSPSEARNRIFFVSAKEVLNSR 292          

HSP 2 Score: 98.5969 bits (244), Expect = 2.558e-20
Identity = 77/291 (26.46%), Postives = 139/291 (47.77%), Query Frame = 2
Query:  143 TFDEEKYDKIFTLNESCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCI--KGCDKEFKDKEA-MYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINE----------YRKEEFKRF 970
            T+   + D+I     + E  L  I+  + K+  I E+L++  + V F G  S+GKS +IN++L +++LPS IG T    + + G++   + +  +G D++   K        +++  D   G     L+ V     K  +L D   L+D+PG +        + + C  +D+ V V        + EK  F  ++E+ SK N+FIL N+WD S S+  +   + +  +E       ++      + A++RIFF+SAKE ++S     +G+ E           R +EF+ F
Sbjct:   39 TYRNPELDRI-----ASEDDLVEIQGYRNKLAVIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHTTNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAG----CLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDIWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVVSPSEARNRIFFVSAKEVLNSRKHKAQGMPEGGGALAEGFQARLQEFQNF 320          
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7YU24|MARF_DROME (Transmembrane GTPase Marf OS=Drosophila melanogaster OX=7227 GN=Marf PE=1 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 1.119e-28
Identity = 86/262 (32.82%), Postives = 140/262 (53.44%), Query Frame = 2
Query: 1820 KVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFLNIEN-EIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTC--TLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSE-EASKRIFFVSALEMFKCRIERKEIFGNQRTRRAI----EMRY 2581
            KV  I   +++D +K++FFG  S GKS V+N ++ E +  S +  TT+CF  V  S+ G  YL  EGSE   + +      +K+L   L +    +L  +  V++F   E   +++++    D PG +    + + I    L++D+F+ V+    T+T  EK FF   S+  SKP+IF+L N+WD S  ++    E  + +     ++ LTK+   S+E EA++R+FFVSA E  + RIE  E  GN     AI    ++RY
Sbjct:  125 KVAAIREVLQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVVN-----IKQLANALCQE---KLCESSLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDAS-ANEPECQESVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETLQARIE--EAKGNPPHMGAIAEGFQIRY 375          

HSP 2 Score: 104.76 bits (260), Expect = 2.421e-21
Identity = 69/238 (28.99%), Postives = 118/238 (49.58%), Query Frame = 2
Query:  230 KINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTY--VFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWF-KDYNDTERNTAKSRIFFISAKEQMDSFMEAKEG 934
            K+  IRE+L +  + V F G  S GKS +IN++L E+ILPS IG T     ++ GSN G + +     E K      +++ N    E       +L+ +     +  +L D    +D+PG + +    + +   C  +D+ V V+      +  EK+ F  +S+K SK N+FIL N+WD S ++      +     E R +D+  K+   +    A  R+FF+SA+E + + +E  +G
Sbjct:  125 KVAAIREVLQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVVNIKQLANALCQEKLCES--SLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEPECQESVKSQHTE-RCIDFLTKELKVSNEKEAAERVFFVSARETLQARIEEAKG 359          
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|O95140|MFN2_HUMAN (Mitofusin-2 OS=Homo sapiens OX=9606 GN=MFN2 PE=1 SV=3)

HSP 1 Score: 117.472 bits (293), Expect = 2.202e-25
Identity = 75/242 (30.99%), Postives = 127/242 (52.48%), Query Frame = 2
Query: 1817 TKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFLNIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTC--TLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKE 2536
            +KVR I   + +  +K++FFG  S GKS V+N ++ + +  S +  TT+CF+ V  +D    +L  EGSE    + T     V +L   L ++      +  +V ++ N +  ++K++  + D PG +   E+   I +  LD+D+F+ V     TL   EK FF   S+  S+P+IF+L N+WD S  +   + E  R  ++R    L+ + G     +A  RIFFVSA E+   RI++ +
Sbjct:   83 SKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKT-----VNQLAHALHQDKQLHAGSLVSV-MWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRSQAGDRIFFVSAKEVLNARIQKAQ 318          

HSP 2 Score: 109.768 bits (273), Expect = 7.099e-23
Identity = 69/241 (28.63%), Postives = 123/241 (51.04%), Query Frame = 2
Query:  230 KINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKD-YNDTERNTAKSRIFFISAKEQMDSFMEAKEGINE 943
            K+  I E+L +  + V F G  S GKS +IN++L +++LPS IG T    +R+ G++   + +     E K       ++ +    +   +   +L+ V+  N K P+L D   L+D+PG +        + + C  +D+ V V          EK  F  +SE+ S+ N+FIL N+WD S S+  +  ++ +  +E R   +  D     +R+ A  RIFF+SAKE +++ ++  +G+ E
Sbjct:   84 KVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAG-SLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHME-RCTSFLVDELGVVDRSQAGDRIFFVSAKEVLNARIQKAQGMPE 322          
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|Q80U63|MFN2_MOUSE (Mitofusin-2 OS=Mus musculus OX=10090 GN=Mfn2 PE=1 SV=3)

HSP 1 Score: 114.775 bits (286), Expect = 1.501e-24
Identity = 74/242 (30.58%), Postives = 126/242 (52.07%), Query Frame = 2
Query: 1817 TKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFLNIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTC--TLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKE 2536
            +KVR I   + +  +K++FFG  S GKS V+N ++ + +  S +  TT+CF+ V  +D    +L  EGSE      T     V +L   L ++      +  +V ++ N +  ++K++  + D PG +   E+   I +  LD+D+F+ V     TL   EK FF   S+  S+P+IF+L N+WD S  +   + E  R  ++R    L+ + G     +A  RIFFVSA E+   R+++ +
Sbjct:   83 SKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEKKSVKT-----VNQLAHALHQDEQLHAGSMVSV-MWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQ 318          

HSP 2 Score: 108.612 bits (270), Expect = 1.367e-22
Identity = 71/243 (29.22%), Postives = 125/243 (51.44%), Query Frame = 2
Query:  230 KINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTS-CIKGCDKEFKDKEAMYEEVMNVSTDE-LDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKD-YNDTERNTAKSRIFFISAKEQMDSFMEAKEGINE 943
            K+  I E+L +  + V F G  S GKS +IN++L +++LPS IG T    +R+ G++   +  +    +E K  + + +    +  DE L      +++ V+  N K P+L D   L+D+PG +        + + C  +D+ V V          EK+ F  +SE+ S+ N+FIL N+WD S S+  +  ++ +  +E R   +  D     +R  A  RIFF+SAKE + + ++  +G+ E
Sbjct:   84 KVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEKKSVKTVNQLAHALHQDEQLHAG---SMVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHME-RCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPE 322          
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8R500|MFN2_RAT (Mitofusin-2 OS=Rattus norvegicus OX=10116 GN=Mfn2 PE=1 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 1.679e-24
Identity = 74/242 (30.58%), Postives = 125/242 (51.65%), Query Frame = 2
Query: 1817 TKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFLNIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTC--TLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKE 2536
            +KVR I   + +  +K++FFG  S GKS V+N ++ + +  S +  TT+CF+ V  +D    +L  EGSE      T     V +L   L ++      +  +V ++ N +  ++K+   + D PG +   E+   I +  LD+D+F+ V     TL   EK FF   S+  S+P+IF+L N+WD S  +   + E  R  ++R    L+ + G     +A  RIFFVSA E+   R+++ +
Sbjct:   83 SKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEKKSVKT-----VNQLAHALHQDEQLHAGSLVSV-MWPNSKCPLLKDGLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQ 318          

HSP 2 Score: 109.383 bits (272), Expect = 7.285e-23
Identity = 72/243 (29.63%), Postives = 125/243 (51.44%), Query Frame = 2
Query:  230 KINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTS-CIKGCDKEFKDKEAMYEEVMNVSTDE-LDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKD-YNDTERNTAKSRIFFISAKEQMDSFMEAKEGINE 943
            K+  I E+L +  + V F G  S GKS +IN++L +++LPS IG T    +R+ G++   +  +    +E K  + + +    +  DE L      +L+ V+  N K P+L D   L+D+PG +        + + C  +D+ V V          EK+ F  +SE+ S+ N+FIL N+WD S S+  +  ++ +  +E R   +  D     +R  A  RIFF+SAKE + + ++  +G+ E
Sbjct:   84 KVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEKKSVKTVNQLAHALHQDEQLHAG---SLVSVMWPNSKCPLLKDGLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHME-RCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPE 322          
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|O18412|FZO_DROME (Transmembrane GTPase fzo OS=Drosophila melanogaster OX=7227 GN=fzo PE=1 SV=2)

HSP 1 Score: 109.768 bits (273), Expect = 6.335e-23
Identity = 69/241 (28.63%), Postives = 130/241 (53.94%), Query Frame = 2
Query: 1817 TKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGR-HYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFLNIEN-EIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTC--TLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKD-GNFS-SEEASKRIFFVSALEMFKCR 2521
            ++V  I   + +D +K++FFG  S GKS V+N ++ E +  SA+  TTSCF  V+ +      +++VE  + + +        +  L+   S ++ G L  +  +QV +      I+  +  + D PG +   ++ +C+    +D+D+FI V+    T++  E+ FF+  +   S+P++F+L N+WDK+   +  + +K + +     VNLL  + G +S ++EA +RI+ VSALE    R
Sbjct:   73 SRVEAIAKVLSRDRMKVAFFGRTSNGKSAVINALLHEKILPSAMGHTTSCFCQVQANGSNETEHVKVEQEDEHME--------LSALSQLASAHSPGALKPSTLLQVNMAKNRCSILDYDVVLMDTPGVDVTAQLDDCLDSYCMDADVFILVLNAESTVSRVERQFFKDVASKLSRPNLFILNNRWDKASSLEPEMEQKVKDQHMERCVNLLVDELGVYSTAQEAWERIYHVSALEALHIR 305          

HSP 2 Score: 95.1301 bits (235), Expect = 2.260e-18
Identity = 73/276 (26.45%), Postives = 137/276 (49.64%), Query Frame = 2
Query:  200 LLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGN-DNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTY--VFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKD----YNDTERNTAKSRIFFISAKEQM---DSFMEAKEGINEYRKEEFKRFITELNKSLS 997
            +L  + A   ++  I ++L++  + V F G  S GKS +IN++L E+ILPS++G T +   ++    NG++  +    E +D+      +  +++    G      L++V ++  +  IL+    L+DTPG +   +  + +   C  +D+ + V+      S  E++ FK ++ K S+ NLFIL N+WD++ S E    +  KD    R V+   D    Y+  +   A  RI+ +SA E +   +  +    G  + R +EF RF  + +  L+
Sbjct:   64 MLEHLCAFSSRVEAIAKVLSRDRMKVAFFGRTSNGKSAVINALLHEKILPSAMGHTTSCFCQVQA--NGSNETEHVKVEQEDEHMELSALSQLASAHSPGALKPSTLLQVNMAKNRCSILDYDVVLMDTPGVDVTAQLDDCLDSYCMDADVFILVLNAESTVSRVERQFFKDVASKLSRPNLFILNNRWDKASSLEPEMEQKVKDQHMERCVNLLVDELGVYSTAQE--AWERIYHVSALEALHIRNGQITNPSGQTQQRYQEFLRFENDFSNCLA 335          
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Match: B4R5L5 (GD16797 OS=Drosophila simulans OX=7240 GN=Dsim\GD16797 PE=3 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 4.202e-28
Identity = 86/262 (32.82%), Postives = 140/262 (53.44%), Query Frame = 2
Query: 1820 KVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFLNIEN-EIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTC--TLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSE-EASKRIFFVSALEMFKCRIERKEIFGNQRTRRAI----EMRY 2581
            KV  I   +++D +K++FFG  S GKS V+N ++ E +  S +  TT+CF  V  S+ G  YL  EGSE   + +      +K+L   L +    +L  +  V++F   E   +++++    D PG +    + + I    L++D+F+ V+    T+T  EK FF   S+  SKP+IF+L N+WD S  ++    E  + +     ++ LTK+   S+E EA++R+FFVSA E  + RIE  E  GN     AI    ++RY
Sbjct:   81 KVAAIREVLQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVVN-----IKQLANALCQE---KLCESSLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDAS-ANEPECQESVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETLQARIE--EAKGNPPHMGAIAEGFQIRY 331          

HSP 2 Score: 105.916 bits (263), Expect = 1.436e-20
Identity = 70/238 (29.41%), Postives = 119/238 (50.00%), Query Frame = 2
Query:  230 KINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTY--VFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWF-KDYNDTERNTAKSRIFFISAKEQMDSFMEAKEG 934
            K+  IRE+L +  + V F G  S GKS +IN++L E+ILPS IG T     ++ GSN G + +     E K      +++ N    E       +L+ +     +  +L D    +D+PG + +    + +   C  +D+ V V+      +  EK+ F  +S+K SK N+FIL N+WD S ++E    +  K     R +D+  K+   +    A  R+FF+SA+E + + +E  +G
Sbjct:   81 KVAAIREVLQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVVNIKQLANALCQEKLCES--SLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDAS-ANEPECQESVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETLQARIEEAKG 315          
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Match: A0A0R1E9R8 (Uncharacterized protein, isoform B OS=Drosophila yakuba OX=7245 GN=Dyak\GE16751 PE=3 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.649e-26
Identity = 87/265 (32.83%), Postives = 145/265 (54.72%), Query Frame = 2
Query: 1820 KVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFLNIEN-EIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTC--TLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKS-DQDKTAVTEKSRIKIKR--EIVNLLTKDGNFSSE-EASKRIFFVSALEMFKCRIERKEIFGNQRTRRAI----EMRY 2581
            KV  I   +++D +K++FFG  S GKS V+N ++ E +  S +  TT+CF  V  S+ G  YL  EGSE   + +      +K+L   L +    +L  +  V++F   E   +++++    D PG +    + + I    L++D+F+ V+    T+T  EK FF   S+  SKP+IF+L N+WD S ++ +   +E +++K +     ++ LTK+   S+E EA++R+FFVSA E  + RIE  E  GN     AI    ++RY
Sbjct:  125 KVAAIREVLQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVVN-----IKQLANALCQE---KLCESSLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEPECQESELAKVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETLQARIE--EAKGNPPHMGAIAEGFQIRY 379          

HSP 2 Score: 105.145 bits (261), Expect = 5.081e-19
Identity = 71/242 (29.34%), Postives = 120/242 (49.59%), Query Frame = 2
Query:  230 KINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTY--VFSDEEKEMFKLISEKTSKLNLFILVNKWD----ESDSDETFTVKMSKDMIEGRFVDWF-KDYNDTERNTAKSRIFFISAKEQMDSFMEAKEG 934
            K+  IRE+L +  + V F G  S GKS +IN++L E+ILPS IG T     ++ GSN G + +     E K      +++ N    E       +L+ +     +  +L D    +D+PG + +    + +   C  +D+ V V+      +  EK+ F  +S+K SK N+FIL N+WD    E +  E+   K+     E R +D+  K+   +    A  R+FF+SA+E + + +E  +G
Sbjct:  125 KVAAIREVLQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVVNIKQLANALCQEKLCES--SLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEPECQESELAKVKSQHTE-RCIDFLTKELKVSNEKEAAERVFFVSARETLQARIEEAKG 363          
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Match: A0A0Q5T5B2 (Uncharacterized protein, isoform C OS=Drosophila erecta OX=7220 GN=Dere\GG19591 PE=3 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 1.917e-26
Identity = 87/265 (32.83%), Postives = 145/265 (54.72%), Query Frame = 2
Query: 1820 KVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFLNIEN-EIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTC--TLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKS-DQDKTAVTEKSRIKIKR--EIVNLLTKDGNFSSE-EASKRIFFVSALEMFKCRIERKEIFGNQRTRRAI----EMRY 2581
            KV  I   +++D +K++FFG  S GKS V+N ++ E +  S +  TT+CF  V  S+ G  YL  EGSE   + +      +K+L   L +    +L  +  V++F   E   +++++    D PG +    + + I    L++D+F+ V+    T+T  EK FF   S+  SKP+IF+L N+WD S ++ +   +E +++K +     ++ LTK+   S+E EA++R+FFVSA E  + RIE  E  GN     AI    ++RY
Sbjct:  123 KVAAIREVLQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVVN-----IKQLANALCQE---KLCESSLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEPECQESELAKVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETLQARIE--EAKGNPPHMGAIAEGFQIRY 377          

HSP 2 Score: 105.145 bits (261), Expect = 6.012e-19
Identity = 71/242 (29.34%), Postives = 120/242 (49.59%), Query Frame = 2
Query:  230 KINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTY--VFSDEEKEMFKLISEKTSKLNLFILVNKWD----ESDSDETFTVKMSKDMIEGRFVDWF-KDYNDTERNTAKSRIFFISAKEQMDSFMEAKEG 934
            K+  IRE+L +  + V F G  S GKS +IN++L E+ILPS IG T     ++ GSN G + +     E K      +++ N    E       +L+ +     +  +L D    +D+PG + +    + +   C  +D+ V V+      +  EK+ F  +S+K SK N+FIL N+WD    E +  E+   K+     E R +D+  K+   +    A  R+FF+SA+E + + +E  +G
Sbjct:  123 KVAAIREVLQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVVNIKQLANALCQEKLCES--SLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEPECQESELAKVKSQHTE-RCIDFLTKELKVSNEKEAAERVFFVSARETLQARIEEAKG 361          
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Match: A0A1I8P3X4 (Dynamin-type G domain-containing protein OS=Stomoxys calcitrans OX=35570 GN=106083566 PE=3 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 1.918e-26
Identity = 89/257 (34.63%), Postives = 139/257 (54.09%), Query Frame = 2
Query: 1820 KVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFLNIENEIMKNNTEIF-DCPGSNNKREVTECIMQQSLDSDIFIFVMTC--TLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKS---DQDKTAVTEKSRIKIKREIVNLLTKDGNFSSE-EASKRIFFVSALEMFKCRIERKEIFGNQRTRRAI 2569
            KV  I   + +D +K++FFG  S GKS V+N ++ E +  S +  TT+CF  V  SD    YL  EGS    D   N+ N +K+L   L +    +L  +  V++F   E  ++  +  +F D PG +    + + I    L++D+F+ V+    T+T  EK FF   S+  SKP+IF+L N+WD S    + + +  EK + +     ++ LTK+   SSE EA++R+FFVSA E  + RIE  E  GN  ++ AI
Sbjct:   98 KVAGIREVLARDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSDSSEAYLVKEGS----DEKLNVVN-IKQLANALCQE---KLSESSLVRIFWPRERCMLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEPESQESELEKVKSQHTERCIDFLTKELKVSSEKEAAERVFFVSAREALQARIE--EAKGNSPSQGAI 344          

HSP 2 Score: 102.834 bits (255), Expect = 2.722e-18
Identity = 72/251 (28.69%), Postives = 128/251 (51.00%), Query Frame = 2
Query:  227 LKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCI--KGCDKEF------KDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTY--VFSDEEKEMFKLISEKTSKLNLFILVNKWD----ESDSDETFTVKMSKDMIEGRFVDWF-KDYNDTERNTAKSRIFFISAKEQMDSFMEAKEG 934
            LK+  IRE+L +  + V F G  S GKS +IN++L E+ILPS IG T     ++ GS++  + +  +G D++       +   A+ +E ++ S+          L+ +     +  +L D    +D+PG + +    + +   C  +D+ V V+      +  EK+ F  +S+K SK N+FIL N+WD    E +S E+   K+     E R +D+  K+   +    A  R+FF+SA+E + + +E  +G
Sbjct:   97 LKVAGIREVLARDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSDSSEAYLVKEGSDEKLNVVNIKQLANALCQEKLSESS----------LVRIFWPRERCMLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEPESQESELEKVKSQHTE-RCIDFLTKELKVSSEKEAAERVFFVSAREALQARIEEAKG 336          
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Match: A0A1I8P3Z4 (Dynamin-type G domain-containing protein OS=Stomoxys calcitrans OX=35570 GN=106083566 PE=3 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 1.981e-26
Identity = 89/257 (34.63%), Postives = 139/257 (54.09%), Query Frame = 2
Query: 1820 KVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFLNIENEIMKNNTEIF-DCPGSNNKREVTECIMQQSLDSDIFIFVMTC--TLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKS---DQDKTAVTEKSRIKIKREIVNLLTKDGNFSSE-EASKRIFFVSALEMFKCRIERKEIFGNQRTRRAI 2569
            KV  I   + +D +K++FFG  S GKS V+N ++ E +  S +  TT+CF  V  SD    YL  EGS    D   N+ N +K+L   L +    +L  +  V++F   E  ++  +  +F D PG +    + + I    L++D+F+ V+    T+T  EK FF   S+  SKP+IF+L N+WD S    + + +  EK + +     ++ LTK+   SSE EA++R+FFVSA E  + RIE  E  GN  ++ AI
Sbjct:  108 KVAGIREVLARDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSDSSEAYLVKEGS----DEKLNVVN-IKQLANALCQE---KLSESSLVRIFWPRERCMLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEPESQESELEKVKSQHTERCIDFLTKELKVSSEKEAAERVFFVSAREALQARIE--EAKGNSPSQGAI 354          

HSP 2 Score: 102.834 bits (255), Expect = 2.816e-18
Identity = 72/251 (28.69%), Postives = 128/251 (51.00%), Query Frame = 2
Query:  227 LKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCI--KGCDKEF------KDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTY--VFSDEEKEMFKLISEKTSKLNLFILVNKWD----ESDSDETFTVKMSKDMIEGRFVDWF-KDYNDTERNTAKSRIFFISAKEQMDSFMEAKEG 934
            LK+  IRE+L +  + V F G  S GKS +IN++L E+ILPS IG T     ++ GS++  + +  +G D++       +   A+ +E ++ S+          L+ +     +  +L D    +D+PG + +    + +   C  +D+ V V+      +  EK+ F  +S+K SK N+FIL N+WD    E +S E+   K+     E R +D+  K+   +    A  R+FF+SA+E + + +E  +G
Sbjct:  107 LKVAGIREVLARDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSDSSEAYLVKEGSDEKLNVVNIKQLANALCQEKLSESS----------LVRIFWPRERCMLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEPESQESELEKVKSQHTE-RCIDFLTKELKVSSEKEAAERVFFVSAREALQARIEEAKG 346          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000043809.1 (mitofusin-1-like [Source:NCBI gene;Acc:103034819])

HSP 1 Score: 115.931 bits (289), Expect = 8.525e-26
Identity = 89/304 (29.28%), Postives = 156/304 (51.32%), Query Frame = 2
Query: 1820 KVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFL-NIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMT--CTLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKEIFGNQRTRRAIEMRYXXXXXXXXXXXR----YIDNPEI-NKLERHDREVRETTRNLESIIES 2707
            K+  I   + +  +K++FFG  S GKS V+N ++ E +  S +  TT+CF++V  +D  + +L  E SE    S+  +      L  H+  N    LD+   V+VF    +  +++++  + D PG++   E+   I +  LD+D+F+ V     TL N EK FF   S+  SKP+IF+L N+WD S+ +   +    +  + R +  L+ +    S ++A  RIFFVSA E    RI R +  G   T  A+   +++ L   +S  R    +I +  +  K E+H     + T +L++I+++
Sbjct:   64 KLEAIWEVLARRQMKVAFFGRTSNGKSTVINAMLRERVLPSGIGHTTNCFISVEGTDGDQAFLTTENSEER-KSIKTVNQLAHAL--HMDRN----LDSGCLVRVFWPKTKCALLRDDLVLMDSPGTDVTSELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVSERISKPNIFILNNRWDASETEPEYLDGVRKQHMDRCVSFLVDELKVVSPDQAPNRIFFVSAKEALSARIHRAQ--GMPETGAALADGFQDRLQEFQSFERTFEEFISHSSVKTKFEQHTIRAWQITESLKTIMDA 358          

HSP 2 Score: 102.834 bits (255), Expect = 8.883e-22
Identity = 73/261 (27.97%), Postives = 127/261 (48.66%), Query Frame = 2
Query:  230 KINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGN-DNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKD-YNDTERNTAKSRIFFISAKEQMDSFMEAKEGINEY----------RKEEFKRF 970
            K+  I E+L + ++ V F G  S GKS +IN++L E +LPS IG T    + + G++   + +   + E +       ++ +     +D N D+  L+ V     K  +L D   L+D+PG +        + + C  +D+ V V        + EK  F  +SE+ SK N+FIL N+WD S+++  +   + K  ++ R V +  D       + A +RIFF+SAKE + + +   +G+ E           R +EF+ F
Sbjct:   64 KLEAIWEVLARRQMKVAFFGRTSNGKSTVINAMLRERVLPSGIGHTTNCFISVEGTDGDQAFLTTENSEERKSIKTVNQLAHAL--HMDRNLDSGCLVRVFWPKTKCALLRDDLVLMDSPGTDVTSELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVSERISKPNIFILNNRWDASETEPEYLDGVRKQHMD-RCVSFLVDELKVVSPDQAPNRIFFVSAKEALSARIHRAQGMPETGAALADGFQDRLQEFQSF 321          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Cavefish
Match: mfn1b (mitofusin-1 [Source:NCBI gene;Acc:103030239])

HSP 1 Score: 115.546 bits (288), Expect = 1.140e-25
Identity = 81/264 (30.68%), Postives = 139/264 (52.65%), Query Frame = 2
Query: 1757 SDSPILCTIENFVKKYEIIETKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFL-NIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMT--CTLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGN-FSSEEASKRIFFVSALEMFKCRIERKE 2536
            +DS  L  IE++ +K  +I+  +        +  +K++FFG  S GKS V+N ++ + +  S +  TT+CF++V  +D  + YL+ EGSE    S+  +      L  H+ E+    LD    V+VF    +  +++++  + D PG++   ++   I +  LD+D+F+ V     TL N EK FF   ++  SKP+IF+L N+WD S  +   + +  +    R  VN L ++      EEA   IFFVSA E+   R++R +
Sbjct:   50 ADSTQLQEIESYTEKLAVIKEVL-------ARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAYLKTEGSEEE-KSIKTVNQLAHAL--HMDES----LDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTQLDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMDDVRKQHTDR-CVNFLVEELKVVDREEAPNHIFFVSAKEVLNSRMQRAQ 298          

HSP 2 Score: 105.145 bits (261), Expect = 1.774e-22
Identity = 74/252 (29.37%), Postives = 130/252 (51.59%), Query Frame = 2
Query:  203 LSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIK--GCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWF-KDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINE 943
            L  I +   K+  I+E+L +  + V F G  S GKS +IN++L + +LPS IG T    + + G++   + +K  G ++E K  + + +    +  DE    D   L++V     K  +L D   L+D+PG +   +    + + C  +D+ V V        + EK  F  ++E+ SK N+FIL N+WD S S+  +   + K   + R V++  ++    +R  A + IFF+SAKE ++S M+  +G+ E
Sbjct:   55 LQEIESYTEKLAVIKEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAYLKTEGSEEE-KSIKTVNQLAHALHMDE--SLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTQLDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMDDVRKQHTD-RCVNFLVEELKVVDREEAPNHIFFVSAKEVLNSRMQRAQGMPE 302          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Cavefish
Match: mfn1b (mitofusin-1 [Source:NCBI gene;Acc:103030239])

HSP 1 Score: 115.161 bits (287), Expect = 1.303e-25
Identity = 81/264 (30.68%), Postives = 139/264 (52.65%), Query Frame = 2
Query: 1757 SDSPILCTIENFVKKYEIIETKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFL-NIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMT--CTLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGN-FSSEEASKRIFFVSALEMFKCRIERKE 2536
            +DS  L  IE++ +K  +I+  +        +  +K++FFG  S GKS V+N ++ + +  S +  TT+CF++V  +D  + YL+ EGSE    S+  +      L  H+ E+    LD    V+VF    +  +++++  + D PG++   ++   I +  LD+D+F+ V     TL N EK FF   ++  SKP+IF+L N+WD S  +   + +  +    R  VN L ++      EEA   IFFVSA E+   R++R +
Sbjct:   50 ADSTQLQEIESYTEKLAVIKEVL-------ARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAYLKTEGSEEE-KSIKTVNQLAHAL--HMDES----LDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTQLDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMDDVRKQHTDR-CVNFLVEELKVVDREEAPNHIFFVSAKEVLNSRMQRAQ 298          

HSP 2 Score: 105.145 bits (261), Expect = 2.090e-22
Identity = 74/252 (29.37%), Postives = 130/252 (51.59%), Query Frame = 2
Query:  203 LSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIK--GCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWF-KDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINE 943
            L  I +   K+  I+E+L +  + V F G  S GKS +IN++L + +LPS IG T    + + G++   + +K  G ++E K  + + +    +  DE    D   L++V     K  +L D   L+D+PG +   +    + + C  +D+ V V        + EK  F  ++E+ SK N+FIL N+WD S S+  +   + K   + R V++  ++    +R  A + IFF+SAKE ++S M+  +G+ E
Sbjct:   55 LQEIESYTEKLAVIKEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAYLKTEGSEEE-KSIKTVNQLAHALHMDE--SLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTQLDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMDDVRKQHTD-RCVNFLVEELKVVDREEAPNHIFFVSAKEVLNSRMQRAQGMPE 302          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Cavefish
Match: mfn2 (mitofusin 2 [Source:ZFIN;Acc:ZDB-GENE-081105-44])

HSP 1 Score: 107.071 bits (266), Expect = 4.572e-23
Identity = 77/274 (28.10%), Postives = 136/274 (49.64%), Query Frame = 2
Query:  143 TFDEEKYDKIFTLNESCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSN-NGTSCIKGCDKEFKDKEAMYEEVMNVSTDE-LDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSK---DMIEGRFVDWFKDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINE 943
            T+  E+ D + T     E  ++ +R    K+  I E+L++  + V+F G  S GKS +IN++L +++LPS IG T    +R+ G++ N    +    +E K+ + + +    +  DE LD     +L+ V+    K  +L D   L+D+PG +        + + C  +D+ V V          EK  F  ++E+ S  N+FIL N+WD S S+  +  ++ +   D      VD   +    +R  A  RIFF+SAKE + + ++  +G+ E
Sbjct:   60 TYSNEELDPVTT-----EEQVAEVRGYLSKVAGIGEVLSRRHMKVVFFGRTSNGKSSVINAMLWDKVLPSGIGHTTNCFLRVEGTDGNEAFLLTEGSEERKNVKTVNQLAHALHQDEDLDAG---SLVCVMWPKAKCALLRDDLVLVDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKSFFHKVNERLSSPNIFILNNRWDASASEPEYMEEVRRQHMDRCSSFLVD---ELGVVDRAQASDRIFFVSAKEVLQARVQKAQGMPE 322          

HSP 2 Score: 107.071 bits (266), Expect = 4.732e-23
Identity = 75/243 (30.86%), Postives = 125/243 (51.44%), Query Frame = 2
Query: 1817 TKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQV-FLNIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTC--TLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKE 2536
            +KV  I   + +  +K+ FFG  S GKS V+N ++ + +  S +  TT+CF+ V  +D    +L  EGSE       N+K  V +L   L ++    LD    V V +   +  +++++  + D PG +   E+   I +  LD+D+F+ V     TL   EK FF   ++  S P+IF+L N+WD S  +   + E  R  + R    L+ + G     +AS RIFFVSA E+ + R+++ +
Sbjct:   83 SKVAGIGEVLSRRHMKVVFFGRTSNGKSSVINAMLWDKVLPSGIGHTTNCFLRVEGTDGNEAFLLTEGSEER----KNVKT-VNQLAHALHQDED--LDAGSLVCVMWPKAKCALLRDDLVLVDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKSFFHKVNERLSSPNIFILNNRWDASASEPEYMEEVRRQHMDRCSSFLVDELGVVDRAQASDRIFFVSAKEVLQARVQKAQ 318          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Nematostella
Match: EDO42379 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1L1])

HSP 1 Score: 99.3673 bits (246), Expect = 4.828e-21
Identity = 96/391 (24.55%), Postives = 174/391 (44.50%), Query Frame = 2
Query:   56 NKIQEKSSNLCKFVESIHGFEKELRETCRTFDEEKYDKIFTLNESCESLLSRIRARQL-------KINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCI--------KGCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTY--VFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETF-TVKMSKDMIEGRFVDWF-KDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINE-----------YRKEEFKRFITELNKSLSDPKFCKCLKHEQDITNMENDMKADIDITINDLEEIIHSRSKSISELR 1138
            N + E SS L  FV++     + + E  +  DE   ++     E  E   S I+           ++ +I E++ + ++ V F G  S GKS ++N++L++ ILP  IG T    + + GS++    I        +      +   A++EE +          D+ +L++V     +  +L++   L+D+PG + +      + + C  +D+ V V          EK  F  +++K SK N+FIL N+WD S  +     +++ K     R VD+  K+    ++  A+ R+FF+SAKE + S M+  +G+ E            RK EF+ F         + KF +C+      T  E+     I I +N ++ I+   +    E R
Sbjct:   20 NGVGEHSSPLHNFVKAKKKINETVSEIGKYLDEA--NRFICGCEIAEDYKSNIKGFACDVAGFLGQVASITEVIARDQMKVAFFGRTSNGKSTVVNAMLQDRILPMGIGHTTNCFLSVNGSDSADPYILIPESDERRNVKTLGQIAHALFEEKL----------DHSSLVQVYWPKSRCKMLSEDVVLVDSPGIDVSPDLDLWIDKHCLDADVFVLVCNAESTLMVTEKNFFHKVNQKLSKPNIFILNNRWDASAGEPDVEMMELVKKQHLQRNVDFLSKELKCVDKKQAEDRVFFVSAKETLMSRMQKHQGMPEEGGAIHVDGFHGRKLEFENF---------EHKFEECISKSAIQTKFESHAGTGIGI-VNAVQNILEQIAGCAYEHR 388          

HSP 2 Score: 96.6709 bits (239), Expect = 2.780e-20
Identity = 69/239 (28.87%), Postives = 125/239 (52.30%), Query Frame = 2
Query: 1844 VKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFLNIEN-EIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTC--TLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKS----DQDKTAVTEKSRIKIKREIVNLLTKDGN-FSSEEASKRIFFVSALEMFKCRIERKE 2536
            + +D +K++FFG  S GKS V+N ++ + +    +  TT+CF++V  SD    Y+ +  S    D   N+K  + ++   L E    +LD +  VQV+      +++  +  + D PG +   ++   I +  LD+D+F+ V     TL   EK+FF   ++  SKP+IF+L N+WD S    D +   + +K  ++     V+ L+K+      ++A  R+FFVSA E    R+++ +
Sbjct:   91 IARDQMKVAFFGRTSNGKSTVVNAMLQDRILPMGIGHTTNCFLSVNGSDSADPYILIPES----DERRNVKT-LGQIAHALFEE---KLDHSSLVQVYWPKSRCKMLSEDVVLVDSPGIDVSPDLDLWIDKHCLDADVFVLVCNAESTLMVTEKNFFHKVNQKLSKPNIFILNNRWDASAGEPDVEMMELVKKQHLQRN---VDFLSKELKCVDKKQAEDRVFFVSAKETLMSRMQKHQ 318          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000009003.2 (pep primary_assembly:ASM223467v1:17:11595384:11602171:-1 gene:ENSORLG00000007178.2 transcript:ENSORLT00000009003.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.005 bits (284), Expect = 8.040e-27
Identity = 79/243 (32.51%), Postives = 127/243 (52.26%), Query Frame = 2
Query: 1817 TKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFLNIEN-EIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFV--MTCTLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKE 2536
            TK+  I   + +  +K++FFG  S GKS V+N ++ + +  S +  TT+CF++V  +D    YL  E SE      T     V +L   L  + T  LD++  V+VF       +++N+  + D PG++   E+   I +  LD+D+F+ V     TL N EK FF   S+  SKP+IF+L N+WD S  +   + E  +  + R +  L  + G     EA  RIFF+SA E+   R++R +
Sbjct:   61 TKLYTIRDVLLRRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDGDEAYLTSEASEERRSIST-----VNQLAHALHMDPT--LDSSCLVKVFWPKSRCALLRNDLVLMDSPGTDVTLELDSWIDKFCLDADVFVLVGNAESTLMNTEKLFFHKVSERISKPNIFILHNRWDASVTEPDYIQEVRKQHLDRCVGFLAEELGVVGPNEAPGRIFFISAKEVLSSRMQRAQ 296          

HSP 2 Score: 96.6709 bits (239), Expect = 5.641e-21
Identity = 76/267 (28.46%), Postives = 128/267 (47.94%), Query Frame = 2
Query:  230 KINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGN-------DNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFV--MTYVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWF-KDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINEY----------RKEEFKRF 970
            K+  IR++L +  + V F G  S GKS +IN++L + +LPS IG T    + + G++         D+ +   EA  E     + ++L          D+  L++V     +  +L +   L+D+PG +        + + C  +D+ V V        + EK  F  +SE+ SK N+FIL N+WD S ++  +  ++ K  ++ R V +  ++      N A  RIFFISAKE + S M+  +G+ E           R  EF+RF
Sbjct:   62 KLYTIRDVLLRRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDG--------DEAYLTSEASEERRSISTVNQLAHALHMDPTLDSSCLVKVFWPKSRCALLRNDLVLMDSPGTDVTLELDSWIDKFCLDADVFVLVGNAESTLMNTEKLFFHKVSERISKPNIFILHNRWDASVTEPDYIQEVRKQHLD-RCVGFLAEELGVVGPNEAPGRIFFISAKEVLSSRMQRAQGMPETGGALAEGFHERLTEFQRF 319          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Medaka
Match: mfn1b (mitofusin 1 [Source:NCBI gene;Acc:101158009])

HSP 1 Score: 114.005 bits (284), Expect = 3.049e-25
Identity = 75/245 (30.61%), Postives = 133/245 (54.29%), Query Frame = 2
Query: 1820 KVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGS--ETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFL-NIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMT--CTLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGN-FSSEEASKRIFFVSALEMFKCRIERKE 2536
            K+  I+  + +  +K++FFG  S GKS V+N ++ + +  S +  TT+CF++V  +D  R YL+ EGS  E +  ++  + + +     H+ E+    LD    V+VF    +  +++++  + D PG++   ++   I +  LD+D+F+ V     TL N EK FF   ++  SKP+IF+L N+WD S  ++    E  R +     VN L ++      E+A  RIFF+SA E+   R++R +
Sbjct:   75 KLAVIKEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDDDRSYLKTEGSDEEKSIKTVNQMAHAL-----HMDES----LDAGCLVRVFWPKTKCALLRDDLVLVDSPGTDVTTQLDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDAS-ANEPEYMEDVRKQHTDRCVNFLVEELKVVDREQAPNRIFFISAKEVLNSRMQRAQ 309          

HSP 2 Score: 112.464 bits (280), Expect = 1.142e-24
Identity = 91/308 (29.55%), Postives = 152/308 (49.35%), Query Frame = 2
Query:   35 DTYLETLNKIQEKSSNLCKFVESIHGFEKELRETCRTFDEEKYDKIFTLNESCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIK--GCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWF-KDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINE 943
            D + + LN ++E S    +FVE I G      E   T D++                S I+A   K+  I+E+L +  + V F G  S GKS +IN++L + +LPS IG T    + + G+++  S +K  G D+E K  + + +    +  DE    D   L+ V     K  +L D   L+D+PG +   +    + + C  +D+ V V        + EK  F  ++E+ SK N+FIL N+WD S ++  +   + K   + R V++  ++    +R  A +RIFFISAKE ++S M+  +G+ E
Sbjct:   32 DVFEQLLNYVKETS----EFVEDISG--NTALENVATPDQK----------------SEIQAYADKLAVIKEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDDDRSYLKTEGSDEE-KSIKTVNQMAHALHMDE--SLDAGCLVRVFWPKTKCALLRDDLVLVDSPGTDVTTQLDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASANEPEYMEDVRKQHTD-RCVNFLVEELKVVDREQAPNRIFFISAKEVLNSRMQRAQGMPE 313          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Medaka
Match: mfn1b (mitofusin 1 [Source:NCBI gene;Acc:101158009])

HSP 1 Score: 114.005 bits (284), Expect = 3.232e-25
Identity = 75/245 (30.61%), Postives = 133/245 (54.29%), Query Frame = 2
Query: 1820 KVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGS--ETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFL-NIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMT--CTLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGN-FSSEEASKRIFFVSALEMFKCRIERKE 2536
            K+  I+  + +  +K++FFG  S GKS V+N ++ + +  S +  TT+CF++V  +D  R YL+ EGS  E +  ++  + + +     H+ E+    LD    V+VF    +  +++++  + D PG++   ++   I +  LD+D+F+ V     TL N EK FF   ++  SKP+IF+L N+WD S  ++    E  R +     VN L ++      E+A  RIFF+SA E+   R++R +
Sbjct:   75 KLAVIKEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDDDRSYLKTEGSDEEKSIKTVNQMAHAL-----HMDES----LDAGCLVRVFWPKTKCALLRDDLVLVDSPGTDVTTQLDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDAS-ANEPEYMEDVRKQHTDRCVNFLVEELKVVDREQAPNRIFFISAKEVLNSRMQRAQ 309          

HSP 2 Score: 111.694 bits (278), Expect = 1.738e-24
Identity = 78/251 (31.08%), Postives = 132/251 (52.59%), Query Frame = 2
Query:  206 SRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIK--GCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWF-KDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINE 943
            S I+A   K+  I+E+L +  + V F G  S GKS +IN++L + +LPS IG T    + + G+++  S +K  G D+E K  + + +    +  DE    D   L+ V     K  +L D   L+D+PG +   +    + + C  +D+ V V        + EK  F  ++E+ SK N+FIL N+WD S ++  +   + K   + R V++  ++    +R  A +RIFFISAKE ++S M+  +G+ E
Sbjct:   67 SEIQAYADKLAVIKEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDDDRSYLKTEGSDEE-KSIKTVNQMAHALHMDE--SLDAGCLVRVFWPKTKCALLRDDLVLVDSPGTDVTTQLDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASANEPEYMEDVRKQHTD-RCVNFLVEELKVVDREQAPNRIFFISAKEVLNSRMQRAQGMPE 313          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Medaka
Match: mfn2 (mitofusin 2 [Source:NCBI gene;Acc:101170481])

HSP 1 Score: 107.842 bits (268), Expect = 2.491e-23
Identity = 78/254 (30.71%), Postives = 130/254 (51.18%), Query Frame = 2
Query: 1778 TIENFVKKYEIIETKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQV-FLNIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTC--TLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIER 2530
            T E  V++     +KV  I   + +  +K+ FFG  S GKS V+N ++ + +  S +  TT+CF+ V  +D    +L  EGSE       ++K  V +L   L ++    LD    V V +  ++  +++++  + D PG +   E+   I +  LD+D+F+ V     TL   EK FF   ++  S P+IF+L N+WD S  +   + E  R  + R    L+ + G     +AS RIFFVSA E+ + R++R
Sbjct:   70 TAEEQVQEVRGFLSKVAGIGEVLARRHMKVVFFGRTSNGKSTVINAMLCDKVLPSGIGHTTNCFLRVEGTDGSEGFLLTEGSEEK----KSIKT-VNQLAHALHQDQD--LDAGSLVCVMWPKVKCALLRDDLVLVDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKSFFHKVNERLSSPNIFILNNRWDASASEPEYMDEVRRQHMDRCSNFLVEELGVVDRAQASDRIFFVSAKEVLQARMQR 316          

HSP 2 Score: 100.908 bits (250), Expect = 4.378e-21
Identity = 68/254 (26.77%), Postives = 123/254 (48.43%), Query Frame = 2
Query:  188 SCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMT--YVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINE 943
            + E  +  +R    K+  I E+L +  + V+F G  S GKS +IN++L +++LPS IG T    +R+ G++     +     E K       ++ +    + D  D  +L+ V+    K  +L D   L+D+PG +        + + C  +D+ V V          EK  F  ++E+ S  N+FIL N+WD S S+  +  ++ +  ++       ++    +R  A  RIFF+SAKE + + M+  +G+ E
Sbjct:   70 TAEEQVQEVRGFLSKVAGIGEVLARRHMKVVFFGRTSNGKSTVINAMLCDKVLPSGIGHTTNCFLRVEGTDGSEGFLLTEGSEEKKSIKTVNQLAHALHQDQD-LDAGSLVCVMWPKVKCALLRDDLVLVDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKSFFHKVNERLSSPNIFILNNRWDASASEPEYMDEVRRQHMDRCSNFLVEELGVVDRAQASDRIFFVSAKEVLQARMQRVQGMPE 322          
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000014754.1 (SMESG000014754.1)

HSP 1 Score: 762.296 bits (1967), Expect = 0.000e+0
Identity = 378/378 (100.00%), Postives = 378/378 (100.00%), Query Frame = 2
Query:   26 MPEDTYLETLNKIQEKSSNLCKFVESIHGFEKELRETCRTFDEEKYDKIFTLNESCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTYVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINEYRKEEFKRFITELNKSLSDPKFCKCLKHEQDITNMENDMKADIDITINDLEEIIHSRSKSISELRNIKSSLK 1159
            MPEDTYLETLNKIQEKSSNLCKFVESIHGFEKELRETCRTFDEEKYDKIFTLNESCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTYVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINEYRKEEFKRFITELNKSLSDPKFCKCLKHEQDITNMENDMKADIDITINDLEEIIHSRSKSISELRNIKSSLK
Sbjct:    1 MPEDTYLETLNKIQEKSSNLCKFVESIHGFEKELRETCRTFDEEKYDKIFTLNESCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTYVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINEYRKEEFKRFITELNKSLSDPKFCKCLKHEQDITNMENDMKADIDITINDLEEIIHSRSKSISELRNIKSSLK 378          

HSP 2 Score: 108.612 bits (270), Expect = 9.677e-25
Identity = 76/254 (29.92%), Postives = 129/254 (50.79%), Query Frame = 2
Query: 1778 TIENFVKKYEIIETKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFL-NIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTCTLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKE 2536
            + E+ + +    + K+  I   + K  I + F G VS GKSK++N+I+ E +  S++  T +  V +  S+ G   ++  G +  F      K  + E   ++S +     D    ++V + N +  I+ + T + D PG N      E +M+    SDI +FVMT   ++EEK+ F+  S+ +SK ++F+LVNKWD+SD D+T   + S+  I+   V+      +     A  RIFF+SA E     +E KE
Sbjct:   55 SCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIK--GCDKEFKD----KEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTYVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKDYNDTERNTAKSRIFFISAKEQMDSFMEAKE 302          
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000014754.1 (SMESG000014754.1)

HSP 1 Score: 762.296 bits (1967), Expect = 0.000e+0
Identity = 378/378 (100.00%), Postives = 378/378 (100.00%), Query Frame = 2
Query:   26 MPEDTYLETLNKIQEKSSNLCKFVESIHGFEKELRETCRTFDEEKYDKIFTLNESCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTYVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINEYRKEEFKRFITELNKSLSDPKFCKCLKHEQDITNMENDMKADIDITINDLEEIIHSRSKSISELRNIKSSLK 1159
            MPEDTYLETLNKIQEKSSNLCKFVESIHGFEKELRETCRTFDEEKYDKIFTLNESCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTYVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINEYRKEEFKRFITELNKSLSDPKFCKCLKHEQDITNMENDMKADIDITINDLEEIIHSRSKSISELRNIKSSLK
Sbjct:    1 MPEDTYLETLNKIQEKSSNLCKFVESIHGFEKELRETCRTFDEEKYDKIFTLNESCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTYVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINEYRKEEFKRFITELNKSLSDPKFCKCLKHEQDITNMENDMKADIDITINDLEEIIHSRSKSISELRNIKSSLK 378          

HSP 2 Score: 108.612 bits (270), Expect = 9.632e-25
Identity = 76/254 (29.92%), Postives = 129/254 (50.79%), Query Frame = 2
Query: 1778 TIENFVKKYEIIETKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFL-NIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTCTLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKE 2536
            + E+ + +    + K+  I   + K  I + F G VS GKSK++N+I+ E +  S++  T +  V +  S+ G   ++  G +  F      K  + E   ++S +     D    ++V + N +  I+ + T + D PG N      E +M+    SDI +FVMT   ++EEK+ F+  S+ +SK ++F+LVNKWD+SD D+T   + S+  I+   V+      +     A  RIFF+SA E     +E KE
Sbjct:   55 SCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIK--GCDKEFKD----KEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTYVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKDYNDTERNTAKSRIFFISAKEQMDSFMEAKE 302          
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000014761.1 (SMESG000014761.1)

HSP 1 Score: 698.353 bits (1801), Expect = 0.000e+0
Identity = 345/381 (90.55%), Postives = 363/381 (95.28%), Query Frame = 2
Query:    2 LTFVFI*TMPEDTYLETLNKIQEKSSNLCKFVESIHGFEKELRETCRTFDEEKYDKIFTLNESCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTYVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINEYRKEEFKRFITELNKSLSDPKFCKCLKHEQDITNMENDMKADIDITINDLEEIIHSRSKSISELRNI 1144
            + F +  TM  + Y+E L KI++KSSNLCKF+ESIHGFEKELRETC+TFDEEKYDKIFTLNESCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEIL SSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKD +A+Y+EVMNVSTDELDGNDNEALIEVVISNPKK ILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTYVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKDYNDTERNTAKSRIFFISA+EQMDSFME KEGINEYRK EF+RFITELNKSLSDPKFCKCLKHEQDI NMEND+KADIDITINDL EII+SR+KS  +L+NI
Sbjct:    6 IAFDYFQTMSVNKYVERLEKIEKKSSNLCKFIESIHGFEKELRETCKTFDEEKYDKIFTLNESCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILSSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDNKALYKEVMNVSTDELDGNDNEALIEVVISNPKKTILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTYVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKDYNDTERNTAKSRIFFISAEEQMDSFMEGKEGINEYRKGEFERFITELNKSLSDPKFCKCLKHEQDIINMENDVKADIDITINDLTEIINSRTKSSEKLQNI 386          

HSP 2 Score: 108.227 bits (269), Expect = 9.529e-24
Identity = 78/255 (30.59%), Postives = 130/255 (50.98%), Query Frame = 2
Query: 1778 TIENFVKKYEIIETKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTT-HLSENTTGRLDTTKTVQVFL-NIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTCTLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKE 2536
            + E+ + +    + K+  I   + K  I + F G VS GKSK++N+I+ E +  S++  T +  V +  S+ G   ++  G +  F     L  +V  ++T  L  N     D    ++V + N +  I+ + T + D PG N      E +M+    SDI +FVMT   ++EEK+ F+  S+ +SK ++F+LVNKWD+SD D+T   + S+  I+   V+      +     A  RIFF+SA E     +E KE
Sbjct:   68 SCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILSSSIGVTNTKVVRLTGSNNGTSCIK--GCDKEFKDNKALYKEVMNVSTDELDGN-----DNEALIEVVISNPKKTILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTYVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKDYNDTERNTAKSRIFFISAEEQMDSFMEGKE 315          
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000014761.1 (SMESG000014761.1)

HSP 1 Score: 694.115 bits (1790), Expect = 0.000e+0
Identity = 343/373 (91.96%), Postives = 359/373 (96.25%), Query Frame = 2
Query:   26 MPEDTYLETLNKIQEKSSNLCKFVESIHGFEKELRETCRTFDEEKYDKIFTLNESCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTYVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINEYRKEEFKRFITELNKSLSDPKFCKCLKHEQDITNMENDMKADIDITINDLEEIIHSRSKSISELRNI 1144
            M  + Y+E L KI++KSSNLCKF+ESIHGFEKELRETC+TFDEEKYDKIFTLNESCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEIL SSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKD +A+Y+EVMNVSTDELDGNDNEALIEVVISNPKK ILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTYVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKDYNDTERNTAKSRIFFISA+EQMDSFME KEGINEYRK EF+RFITELNKSLSDPKFCKCLKHEQDI NMEND+KADIDITINDL EII+SR+KS  +L+NI
Sbjct:    1 MSVNKYVERLEKIEKKSSNLCKFIESIHGFEKELRETCKTFDEEKYDKIFTLNESCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILSSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDNKALYKEVMNVSTDELDGNDNEALIEVVISNPKKTILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTYVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKDYNDTERNTAKSRIFFISAEEQMDSFMEGKEGINEYRKGEFERFITELNKSLSDPKFCKCLKHEQDIINMENDVKADIDITINDLTEIINSRTKSSEKLQNI 373          

HSP 2 Score: 108.227 bits (269), Expect = 9.583e-24
Identity = 78/255 (30.59%), Postives = 130/255 (50.98%), Query Frame = 2
Query: 1778 TIENFVKKYEIIETKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTT-HLSENTTGRLDTTKTVQVFL-NIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTCTLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKE 2536
            + E+ + +    + K+  I   + K  I + F G VS GKSK++N+I+ E +  S++  T +  V +  S+ G   ++  G +  F     L  +V  ++T  L  N     D    ++V + N +  I+ + T + D PG N      E +M+    SDI +FVMT   ++EEK+ F+  S+ +SK ++F+LVNKWD+SD D+T   + S+  I+   V+      +     A  RIFF+SA E     +E KE
Sbjct:   55 SCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILSSSIGVTNTKVVRLTGSNNGTSCIK--GCDKEFKDNKALYKEVMNVSTDELDGN-----DNEALIEVVISNPKKTILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTYVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKDYNDTERNTAKSRIFFISAEEQMDSFMEGKE 302          
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000014761.1 (SMESG000014761.1)

HSP 1 Score: 694.115 bits (1790), Expect = 0.000e+0
Identity = 343/373 (91.96%), Postives = 359/373 (96.25%), Query Frame = 2
Query:   26 MPEDTYLETLNKIQEKSSNLCKFVESIHGFEKELRETCRTFDEEKYDKIFTLNESCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMNVSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTYVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKDYNDTERNTAKSRIFFISAKEQMDSFMEAKEGINEYRKEEFKRFITELNKSLSDPKFCKCLKHEQDITNMENDMKADIDITINDLEEIIHSRSKSISELRNI 1144
            M  + Y+E L KI++KSSNLCKF+ESIHGFEKELRETC+TFDEEKYDKIFTLNESCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEIL SSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKD +A+Y+EVMNVSTDELDGNDNEALIEVVISNPKK ILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTYVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKDYNDTERNTAKSRIFFISA+EQMDSFME KEGINEYRK EF+RFITELNKSLSDPKFCKCLKHEQDI NMEND+KADIDITINDL EII+SR+KS  +L+NI
Sbjct:    1 MSVNKYVERLEKIEKKSSNLCKFIESIHGFEKELRETCKTFDEEKYDKIFTLNESCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILSSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDNKALYKEVMNVSTDELDGNDNEALIEVVISNPKKTILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTYVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKDYNDTERNTAKSRIFFISAEEQMDSFMEGKEGINEYRKGEFERFITELNKSLSDPKFCKCLKHEQDIINMENDVKADIDITINDLTEIINSRTKSSEKLQNI 373          

HSP 2 Score: 108.227 bits (269), Expect = 8.895e-24
Identity = 78/255 (30.59%), Postives = 130/255 (50.98%), Query Frame = 2
Query: 1778 TIENFVKKYEIIETKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTT-HLSENTTGRLDTTKTVQVFL-NIENEIMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTCTLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKE 2536
            + E+ + +    + K+  I   + K  I + F G VS GKSK++N+I+ E +  S++  T +  V +  S+ G   ++  G +  F     L  +V  ++T  L  N     D    ++V + N +  I+ + T + D PG N      E +M+    SDI +FVMT   ++EEK+ F+  S+ +SK ++F+LVNKWD+SD D+T   + S+  I+   V+      +     A  RIFF+SA E     +E KE
Sbjct:   55 SCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINSILEEEILSSSIGVTNTKVVRLTGSNNGTSCIK--GCDKEFKDNKALYKEVMNVSTDELDGN-----DNEALIEVVISNPKKTILNDKTFLIDTPGYNGNERAKELVMRTCQVSDIIVFVMTYVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSDETFTVKMSKDMIEGRFVDWFKDYNDTERNTAKSRIFFISAEEQMDSFMEGKE 302          
The following BLAST results are available for this feature:
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MFN24.586e-2630.99mitofusin 2 [Source:HGNC Symbol;Acc:HGNC:16877][more]
MFN24.586e-2630.99mitofusin 2 [Source:HGNC Symbol;Acc:HGNC:16877][more]
MFN17.066e-2429.34mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262][more]
MFN18.712e-2328.69mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262][more]
MFN18.712e-2328.69mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262][more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fzo-13.723e-2026.77Transmembrane GTPase fzo-1 [Source:UniProtKB/Swis... [more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Marf5.950e-3032.83gene:FBgn0029870 transcript:FBtr0343373[more]
Marf1.116e-2932.82gene:FBgn0029870 transcript:FBtr0070910[more]
Marf1.116e-2932.82gene:FBgn0029870 transcript:FBtr0070909[more]
fzo6.320e-2428.63gene:FBgn0011596 transcript:FBtr0084399[more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfn1b1.951e-2630.53mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553... [more]
mfn1b1.954e-2630.53mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553... [more]
mfn1b8.155e-2529.92mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553... [more]
mfn1b8.155e-2529.92mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553... [more]
mfn1b8.775e-2529.92mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553... [more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfn14.240e-2430.31mitofusin 1 [Source:NCBI gene;Acc:548943][more]
mfn15.502e-2430.08mitofusin 1 [Source:NCBI gene;Acc:548943][more]
mfn15.691e-2430.08mitofusin 1 [Source:NCBI gene;Acc:548943][more]
mfn15.730e-2430.08mitofusin 1 [Source:NCBI gene;Acc:548943][more]
mfn15.904e-2430.08mitofusin 1 [Source:NCBI gene;Acc:548943][more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mfn21.260e-2530.58mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230][more]
Mfn22.145e-2530.58mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230][more]
Mfn22.145e-2530.58mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230][more]
Mfn22.145e-2530.58mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230][more]
Mfn12.777e-2330.13mitofusin 1 [Source:MGI Symbol;Acc:MGI:1914664][more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7YU24|MARF_DROME1.119e-2832.82Transmembrane GTPase Marf OS=Drosophila melanogast... [more]
sp|O95140|MFN2_HUMAN2.202e-2530.99Mitofusin-2 OS=Homo sapiens OX=9606 GN=MFN2 PE=1 S... [more]
sp|Q80U63|MFN2_MOUSE1.501e-2430.58Mitofusin-2 OS=Mus musculus OX=10090 GN=Mfn2 PE=1 ... [more]
sp|Q8R500|MFN2_RAT1.679e-2430.58Mitofusin-2 OS=Rattus norvegicus OX=10116 GN=Mfn2 ... [more]
sp|O18412|FZO_DROME6.335e-2328.63Transmembrane GTPase fzo OS=Drosophila melanogaste... [more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B4R5L54.202e-2832.82GD16797 OS=Drosophila simulans OX=7240 GN=Dsim\GD1... [more]
A0A0R1E9R81.649e-2632.83Uncharacterized protein, isoform B OS=Drosophila y... [more]
A0A0Q5T5B21.917e-2632.83Uncharacterized protein, isoform C OS=Drosophila e... [more]
A0A1I8P3X41.918e-2634.63Dynamin-type G domain-containing protein OS=Stomox... [more]
A0A1I8P3Z41.981e-2634.63Dynamin-type G domain-containing protein OS=Stomox... [more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSAMXT00000043809.18.525e-2629.28mitofusin-1-like [Source:NCBI gene;Acc:103034819][more]
mfn1b1.140e-2530.68mitofusin-1 [Source:NCBI gene;Acc:103030239][more]
mfn1b1.303e-2530.68mitofusin-1 [Source:NCBI gene;Acc:103030239][more]
mfn24.572e-2328.10mitofusin 2 [Source:ZFIN;Acc:ZDB-GENE-081105-44][more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO423794.828e-2124.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSORLT00000009003.28.040e-2732.51pep primary_assembly:ASM223467v1:17:11595384:11602... [more]
mfn1b3.049e-2530.61mitofusin 1 [Source:NCBI gene;Acc:101158009][more]
mfn1b3.232e-2530.61mitofusin 1 [Source:NCBI gene;Acc:101158009][more]
mfn22.491e-2330.71mitofusin 2 [Source:NCBI gene;Acc:101170481][more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014754.19.677e-25100.00SMESG000014754.1[more]
SMESG000014754.19.632e-25100.00SMESG000014754.1[more]
SMESG000014761.19.529e-2490.55SMESG000014761.1[more]
SMESG000014761.19.583e-2491.96SMESG000014761.1[more]
SMESG000014761.18.895e-2491.96SMESG000014761.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020268 ID=SMED30020268|Name=Dynamin-type G domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3959bp
CTTGACATTTGTGTTCATTTAAACTATGCCTGAGGATACATATTTAGAAA
CCTTAAATAAAATACAAGAGAAATCTTCAAATTTGTGCAAATTTGTTGAA
AGTATTCACGGATTCGAGAAAGAACTCAGGGAGACCTGCAGAACCTTTGA
TGAAGAAAAATATGATAAAATTTTCACGCTCAATGAATCTTGTGAAAGCC
TTTTGAGTAGGATCCGGGCCCGTCAGCTGAAAATAAATAACATCCGGGAA
ATCTTGAACAAATCTGAAATCAACGTGATTTTTGTCGGTGGCGTTTCGAC
TGGGAAAAGCAAAATTATTAACTCAATTTTGGAAGAGGAGATCTTGCCAT
CTTCTATAGGAGTCACCAACACTAAGGTCGTACGATTGACCGGATCAAAT
AACGGCACAAGTTGTATCAAGGGTTGTGACAAGGAATTCAAGGATAAAGA
AGCAATGTATGAAGAAGTCATGAATGTATCAACGGATGAGTTGGATGGTA
ATGACAATGAGGCCTTGATTGAAGTGGTGATATCAAACCCGAAGAAACCC
ATTCTGAATGATAAAACCTTCCTGATCGACACTCCTGGATATAACGGGAA
TGAGAGAGCAAAGGAGCTTGTAATGAGAACGTGCCAGGTATCCGATATCA
TTGTATTCGTCATGACTTACGTTTTCAGTGATGAGGAAAAAGAAATGTTC
AAATTGATTTCTGAGAAAACGTCGAAATTAAATTTATTTATTTTGGTGAA
CAAATGGGACGAGTCAGACAGTGATGAAACCTTCACAGTGAAAATGTCCA
AGGATATGATTGAAGGGCGATTTGTAGATTGGTTTAAGGATTACAATGAT
ACAGAGAGAAATACGGCTAAAAGTAGGATATTCTTCATTTCAGCCAAGGA
GCAAATGGATTCCTTCATGGAAGCTAAGGAAGGAATAAATGAATATAGGA
AGGAAGAATTTAAAAGATTTATTACGGAATTGAATAAAAGTTTGAGCGAT
CCAAAATTTTGCAAATGCCTCAAACATGAACAGGACATTACTAACATGGA
AAATGATATGAAAGCCGACATTGATATTACTATAAATGATCTAGAGGAAA
TTATACATTCAAGATCTAAGTCAATAAGTGAATTACGTAATATAAAGTCG
TCTTTAAAAGAACAAGAAAACGTTATTAACGAAAACTTAATAATTGAGAA
AAATAATAAAATTCTAGAAATTAGAAGTCACCAGAAACGTAAAGGTCTTT
TTGATTTCAAACCTTTTAATATGAAGTCTACAAAAGAATTAGATATTTTG
AAGATTGATGCAATTGCTCTTAGATTCGATGACATGCTGAATATTCTCGA
GTTTCAAATCGAGGAAAGAACTCGCAGAATTGTCGGTCATTTGCAAAGGC
CCCAATTGGTGAAAAGAGATTTGAATGATTCTGCATTACAATGTTCAGGC
AAACTTCCAGGTTCCAATGTTCATTCTTTTTCAGCTACTTCTAAGGTCTC
CAGTTATACTTGTTATTGCTAATAATATCATTCAGACTCACGCAAGCAAA
ACGCCGACAGTTTTAGAAAATCAAGTGCTAAAAACCTTTGATGATTTCAA
ACAAACGATTATAGTCCGATGTCAAAAATTGCACTCAAAGACTGACAAAC
TTCTGAAAGTGATTGAGGAGGTCACAAACGGATTAATTAAAATTCAACAG
AAGATTCAGCTACAAAAAAATAAAAAGAGCGAATCGAATATTACGGTTTC
AGGGCGAGTGACTCCCCAATTTTGTGCACGATTGAAAACTTTGTTAAGAA
ATATGAAATAATCGAAACGAAAGTTCGATTCATTGAAGGGAAAGTGAAAA
AGGATTCGATTAAAATCTCCTTTTTTGGAACGGTCTCTGCTGGTAAAAGT
AAAGTGCTTAATACGATTATCGGAGAAAATTTGTTTTTATCCGCCGTCGC
AGATACGACTTCTTGTTTTGTTGCGGTTCGCAAATCCGATAGGGGTCGTC
ATTATTTACGGGTGGAAGGCTCGGAGACGAATTTCGATTCCTTGACCAAT
TTGAAGAATAAGGTTAAAGAATTGACAACTCATCTGAGTGAGAATACTAC
TGGACGATTGGATACTACGAAAACCGTCCAAGTATTCCTCAACATTGAAA
ATGAGATAATGAAGAACAATACCGAAATTTTCGACTGCCCAGGCAGCAAT
AACAAAAGAGAAGTGACAGAATGTATCATGCAACAATCACTAGATTCAGA
TATCTTTATTTTTGTCATGACATGCACTCTTACTAATGAAGAAAAAGATT
TCTTTGAATACCAATCCAAGCTGTCGTCAAAACCAGACATTTTCGTGTTG
GTTAACAAATGGGATAAATCCGATCAGGATAAAACGGCAGTTACAGAAAA
AAGTAGAATTAAGATAAAAAGAGAAATTGTTAATCTTCTCACAAAAGATG
GCAACTTTAGCTCAGAAGAAGCTTCGAAAAGAATATTTTTCGTGTCGGCT
TTGGAAATGTTTAAATGTCGCATAGAGAGAAAAGAAATTTTTGGGAATCA
AAGGACTCGGAGAGCAATAGAAATGAGATATGAAGAATTTCTTTCATTCG
AAGAATCGTTATCAAGGTATATCGACAATCCAGAAATAAACAAATTGGAA
CGCCACGACAGGGAAGTGAGAGAAACGACCAGGAACTTGGAGAGCATCAT
AGAATCTTTTAAAACCGAATTATTTAAACATAAGGATCTGTCAGGCATTA
TATTGAAATTGAGTTGTCAACCATTCTAATTTCAGGAGAGAGCTTAAAAC
GTATGACATGAAAGACTTGTCCGGCCGTCTTGACAAAGCTTATGAGTGTA
TATTGAAGGATCTTTTACGAGAAACTAAAGAAATTCATATGAATTTAAGT
ACAAATTGTCATGATCTACGAACATTTCTTACAAGAAACAATATACAAGG
CACATGTTCAATGTTAAATACAGTTACAACAAGAGTCAGCAATGACTTGA
TGAATATCCAAAGGTATTTATAAAAAAGAACTGAAAAAGATAGAAGTTTC
ATTTAGTAATTTGAATAAGAAACTTCAAACAATGAAAAAAGACTTTAAAA
GAGTGATGGGAAAACATAAATTTATAAAAAAGGTTATCCAATTTTGTAAG
CATTTTTATTACTAACAATTAAGGAAGAAAAGCCAACTCTGAAAGTAGGT
TATTTTGTTTTAGATGATATTTTAGAGATGCATCCGGAAGGAATATATTT
ACACTTTTAAAAGTACACAGTAAGGGCCTATTGTGACATAGAAAGGATCA
AAAGTTGCGTAACATATATCCAATTTGCTCCAACATTTGTCCTTCAGTAT
ATAATGTCATCCGTTATATTTATTTCGGCTCATTGTCTGAAAATGTCACT
AATTTCATCTTTTTGACTAAATATTCCTTATGAAATTATTTAAGTCAAAC
TTCCTGAATAATTATAAATTCAAAATAAAATAATAGTTTTCAAGAAAATT
TAATTTTTAACTTCTTCAAAGTATTTTATAACATTTAAGCAGAAAAAACC
AAAGAAATTATCTTACAGCCTTTGAAAAAAGCTTCATTGCCTGATATTTC
AATTATTATGTTATTGCAAATTTATTTCAATATTTGGCCATATACAATAT
TTTTAATCTCTTCTTGTTTAGCGATGATGGACAATTCTGAGAGATCCTTC
GACCTTCTCATTCTCACATACATAGAGAAGTCCTCTTTTAAATTAAATTC
AAATTTGTGACTTTGAGTAAAAGAAAATTTCAAATTTCAAAAAAGCAGCA
ATGACATGTGCAAATTTCACGATACTACTGTTCACCGTTTGGATGTTCCA
ATCAGAAACATGCAAATAGAAATACACATGAAGATATCAAAAAAGTAAGG
GTTTATTTAATTATCTTCTTTTTTATTTATTTTCTCCTTCAGAATATAGT
TTTACAATT
back to top

protein sequence of SMED30020268-orf-1

>SMED30020268-orf-1 ID=SMED30020268-orf-1|Name=SMED30020268-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=207bp
MKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTCTLTNEEKDFFE
YQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNF
SSEEASKRIFFVSALEMFKCRIERKEIFGNQRTRRAIEMRYEEFLSFEES
LSRYIDNPEINKLERHDREVRETTRNLESIIESFKTELFKHKDLSGIILK
LSCQPF*
back to top

protein sequence of SMED30020268-orf-2

>SMED30020268-orf-2 ID=SMED30020268-orf-2|Name=SMED30020268-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=129bp
MILHYNVQANFQVPMFILFQLLLRSPVILVIANNIIQTHASKTPTVLENQ
VLKTFDDFKQTIIVRCQKLHSKTDKLLKVIEEVTNGLIKIQQKIQLQKNK
KSESNITVSGRVTPQFCARLKTLLRNMK*
back to top

protein sequence of SMED30020268-orf-3

>SMED30020268-orf-3 ID=SMED30020268-orf-3|Name=SMED30020268-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=499bp
MPEDTYLETLNKIQEKSSNLCKFVESIHGFEKELRETCRTFDEEKYDKIF
TLNESCESLLSRIRARQLKINNIREILNKSEINVIFVGGVSTGKSKIINS
ILEEEILPSSIGVTNTKVVRLTGSNNGTSCIKGCDKEFKDKEAMYEEVMN
VSTDELDGNDNEALIEVVISNPKKPILNDKTFLIDTPGYNGNERAKELVM
RTCQVSDIIVFVMTYVFSDEEKEMFKLISEKTSKLNLFILVNKWDESDSD
ETFTVKMSKDMIEGRFVDWFKDYNDTERNTAKSRIFFISAKEQMDSFMEA
KEGINEYRKEEFKRFITELNKSLSDPKFCKCLKHEQDITNMENDMKADID
ITINDLEEIIHSRSKSISELRNIKSSLKEQENVINENLIIEKNNKILEIR
SHQKRKGLFDFKPFNMKSTKELDILKIDAIALRFDDMLNILEFQIEERTR
RIVGHLQRPQLVKRDLNDSALQCSGKLPGSNVHSFSATSKVSSYTCYC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR027094Mitofusin_fam
IPR022812Dynamin_SF
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0090140regulation of mitochondrial fission
GO:0006697ecdysone biosynthetic process
GO:0007005mitochondrion organization
GO:0007029endoplasmic reticulum organization
GO:0008053mitochondrial fusion
GO:0008344adult locomotory behavior
GO:0010636positive regulation of mitochondrial fusion
GO:0019896axonal transport of mitochondrion
GO:0034389lipid particle organization
GO:0034976response to endoplasmic reticulum stress
GO:0070584mitochondrion morphogenesis
Vocabulary: cellular component
TermDefinition
GO:1904115axon cytoplasm
GO:0005739mitochondrion
GO:0005740mitochondrial envelope
GO:0005741mitochondrial outer membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0031306intrinsic component of mitochondrial outer membrane
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 84..345
e-value: 2.7E-23
score: 84.7
IPR022812Dynamin superfamilyPFAMPF00350Dynamin_Ncoord: 84..242
e-value: 8.3E-19
score: 68.3
IPR027094Mitofusin familyPANTHERPTHR10465TRANSMEMBRANE GTPASE FZO1coord: 10..387
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 72..294