SMED30020261

Overview
NameSMED30020261
Smed IDSMED30020261
Length (bp)522
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30020261 (SMED30020261) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30020261 (SMED30020261) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Alignments
SMED30020261 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.003258:8570..9092 +2598
v31.014158:502..1024 -2553
Homology
BLAST of SMED30020261 vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 47.3654 bits (111), Expect = 9.500e-7
Identity = 24/54 (44.44%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKH 301
            + T +YV FTDTE LIG A KN+   N  +  FD KRLIG    + ++ +++KH
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKH 89          
BLAST of SMED30020261 vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 47.3654 bits (111), Expect = 9.909e-7
Identity = 24/54 (44.44%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKH 301
            + T +YV FTDTE LIG A KN+   N  +  FD KRLIG    + ++ +++KH
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKH 89          
BLAST of SMED30020261 vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 47.3654 bits (111), Expect = 1.595e-6
Identity = 24/54 (44.44%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKH 301
            + T +YV FTDTE LIG A KN+   N  +  FD KRLIG    + ++ +++KH
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKH 89          
BLAST of SMED30020261 vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 47.3654 bits (111), Expect = 1.600e-6
Identity = 24/54 (44.44%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKH 301
            + T +YV FTDTE LIG A KN+   N  +  FD KRLIG    + ++ +++KH
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKH 89          
BLAST of SMED30020261 vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 47.3654 bits (111), Expect = 1.822e-6
Identity = 24/54 (44.44%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKH 301
            + T +YV FTDTE LIG A KN+   N  +  FD KRLIG    + ++ +++KH
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKH 89          
BLAST of SMED30020261 vs. Ensembl Celegans
Match: hsp-70 (Heat Shock Protein [Source:UniProtKB/TrEMBL;Acc:O45246])

HSP 1 Score: 46.9802 bits (110), Expect = 1.939e-6
Identity = 25/55 (45.45%), Postives = 36/55 (65.45%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIG--INKNTIIVTEIKH 301
            K T +YV FTDTE L+G A K++  +N  +  FD KRLIG   ++ T + ++IKH
Sbjct:   36 KTTPSYVAFTDTERLVGDAAKDQAARNPENTVFDAKRLIGRRFDEET-VQSDIKH 89          
BLAST of SMED30020261 vs. Ensembl Celegans
Match: F44E5.5 (pep chromosome:WBcel235:II:11759681:11761808:1 gene:WBGene00009692.1 transcript:F44E5.5.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.5)

HSP 1 Score: 46.2098 bits (108), Expect = 4.412e-6
Identity = 21/40 (52.50%), Postives = 27/40 (67.50%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIG 262
            K T +YV FTDTE L+G A K++  +N  +  FD KRLIG
Sbjct:   36 KTTPSYVAFTDTERLVGDAAKDQAARNPENTVFDAKRLIG 75          
BLAST of SMED30020261 vs. Ensembl Celegans
Match: F44E5.5 (pep chromosome:WBcel235:II:11759640:11761853:1 gene:WBGene00009692.1 transcript:F44E5.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.5)

HSP 1 Score: 46.2098 bits (108), Expect = 4.412e-6
Identity = 21/40 (52.50%), Postives = 27/40 (67.50%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIG 262
            K T +YV FTDTE L+G A K++  +N  +  FD KRLIG
Sbjct:   36 KTTPSYVAFTDTERLVGDAAKDQAARNPENTVFDAKRLIG 75          
BLAST of SMED30020261 vs. Ensembl Celegans
Match: F44E5.4 (pep chromosome:WBcel235:II:11757106:11759323:-1 gene:WBGene00009691.1 transcript:F44E5.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.4)

HSP 1 Score: 46.2098 bits (108), Expect = 4.412e-6
Identity = 21/40 (52.50%), Postives = 27/40 (67.50%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIG 262
            K T +YV FTDTE L+G A K++  +N  +  FD KRLIG
Sbjct:   36 KTTPSYVAFTDTERLVGDAAKDQAARNPENTVFDAKRLIG 75          
BLAST of SMED30020261 vs. Ensembl Celegans
Match: hsp-1 (Heat shock 70 kDa protein A [Source:UniProtKB/Swiss-Prot;Acc:P09446])

HSP 1 Score: 45.8246 bits (107), Expect = 6.014e-6
Identity = 24/54 (44.44%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKH 301
            + T +YV FTDTE LIG A KN+   N ++  FD KRLIG    +  + +++KH
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVAMNPHNTVFDAKRLIGRKFDDPAVQSDMKH 89          
BLAST of SMED30020261 vs. Ensembl Fly
Match: Hsp68 (gene:FBgn0001230 transcript:FBtr0084589)

HSP 1 Score: 45.8246 bits (107), Expect = 7.067e-6
Identity = 25/54 (46.30%), Postives = 33/54 (61.11%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKH 301
            + T +YV FTD+E LIG A KN+   N  +  FD KRLIG    ++ I  +IKH
Sbjct:   33 RTTPSYVAFTDSERLIGDAAKNQVAMNPKNSVFDAKRLIGRRFDDSKIQEDIKH 86          
BLAST of SMED30020261 vs. Ensembl Fly
Match: Hsc70-1 (gene:FBgn0001216 transcript:FBtr0075762)

HSP 1 Score: 45.4394 bits (106), Expect = 9.394e-6
Identity = 23/54 (42.59%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKH 301
            + T +YV FT++E LIG A KN+   N N+  FD KRLIG    +  + +++KH
Sbjct:   36 RTTPSYVAFTESERLIGDAAKNQVAMNPNNTIFDAKRLIGRRFDDATVQSDMKH 89          
BLAST of SMED30020261 vs. Ensembl Zebrafish
Match: hsp70.1 (heat shock cognate 70-kd protein, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-990415-91])

HSP 1 Score: 49.6766 bits (117), Expect = 4.568e-7
Identity = 25/54 (46.30%), Postives = 35/54 (64.81%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKH 301
            + T +YV FTDTE LIG A KN+   N N+  FD KRLIG    + ++ +++KH
Sbjct:   38 RTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFDDPVVQSDMKH 91          
BLAST of SMED30020261 vs. Ensembl Zebrafish
Match: hsp70.2 (heat shock cognate 70-kd protein, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-110405-1])

HSP 1 Score: 49.6766 bits (117), Expect = 4.568e-7
Identity = 25/54 (46.30%), Postives = 35/54 (64.81%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKH 301
            + T +YV FTDTE LIG A KN+   N N+  FD KRLIG    + ++ +++KH
Sbjct:   38 RTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFDDPVVQSDMKH 91          
BLAST of SMED30020261 vs. Ensembl Zebrafish
Match: hsp70.3 (heat shock cognate 70-kd protein, tandem duplicate 3 [Source:ZFIN;Acc:ZDB-GENE-110713-1])

HSP 1 Score: 49.6766 bits (117), Expect = 4.568e-7
Identity = 25/54 (46.30%), Postives = 35/54 (64.81%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKH 301
            + T +YV FTDTE LIG A KN+   N N+  FD KRLIG    + ++ +++KH
Sbjct:   38 RTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFDDPVVQSDMKH 91          
BLAST of SMED30020261 vs. Ensembl Zebrafish
Match: hsp70l (heat shock cognate 70-kd protein, like [Source:ZFIN;Acc:ZDB-GENE-050321-1])

HSP 1 Score: 49.6766 bits (117), Expect = 4.568e-7
Identity = 25/54 (46.30%), Postives = 35/54 (64.81%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKH 301
            + T +YV FTDTE LIG A KN+   N N+  FD KRLIG    + ++ +++KH
Sbjct:   38 RTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFDDPVVQSDMKH 91          
BLAST of SMED30020261 vs. Ensembl Zebrafish
Match: hsp70.1 (heat shock cognate 70-kd protein, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-990415-91])

HSP 1 Score: 48.9062 bits (115), Expect = 6.291e-7
Identity = 25/54 (46.30%), Postives = 35/54 (64.81%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKH 301
            + T +YV FTDTE LIG A KN+   N N+  FD KRLIG    + ++ +++KH
Sbjct:   38 RTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFDDPVVQSDMKH 91          
BLAST of SMED30020261 vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 47.7506 bits (112), Expect = 2.949e-6
Identity = 24/54 (44.44%), Postives = 35/54 (64.81%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKH 301
            + T +YV FTDTE LIG A KN+   N  +  FD KRLIG   ++ ++ +++KH
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKH 89          
BLAST of SMED30020261 vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 47.3654 bits (111), Expect = 4.242e-6
Identity = 24/54 (44.44%), Postives = 35/54 (64.81%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKH 301
            + T +YV FTDTE LIG A KN+   N  +  FD KRLIG   ++ ++ +++KH
Sbjct:   37 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKH 90          
BLAST of SMED30020261 vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 46.9802 bits (110), Expect = 4.540e-6
Identity = 24/54 (44.44%), Postives = 35/54 (64.81%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKH 301
            + T +YV FTDTE LIG A KN+   N  +  FD KRLIG   ++ ++ +++KH
Sbjct:   44 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKH 97          
BLAST of SMED30020261 vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 46.9802 bits (110), Expect = 4.750e-6
Identity = 24/54 (44.44%), Postives = 35/54 (64.81%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKH 301
            + T +YV FTDTE LIG A KN+   N  +  FD KRLIG   ++ ++ +++KH
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKH 89          
BLAST of SMED30020261 vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 46.9802 bits (110), Expect = 4.986e-6
Identity = 24/54 (44.44%), Postives = 35/54 (64.81%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKH 301
            + T +YV FTDTE LIG A KN+   N  +  FD KRLIG   ++ ++ +++KH
Sbjct:   41 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKH 94          
BLAST of SMED30020261 vs. Ensembl Mouse
Match: Hspa8 (heat shock protein 8 [Source:MGI Symbol;Acc:MGI:105384])

HSP 1 Score: 46.9802 bits (110), Expect = 6.591e-7
Identity = 24/54 (44.44%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKH 301
            + T +YV FTDTE LIG A KN+   N  +  FD KRLIG    + ++ +++KH
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKH 89          
BLAST of SMED30020261 vs. Ensembl Mouse
Match: Hspa1a (heat shock protein 1A [Source:MGI Symbol;Acc:MGI:96244])

HSP 1 Score: 47.3654 bits (111), Expect = 3.394e-6
Identity = 26/63 (41.27%), Postives = 37/63 (58.73%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKHTYMQ*IKCG 328
            + T +YV FTDTE LIG A KN+   N  +  FD KRLIG    + ++ +++KH   Q +  G
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDAVVQSDMKHWPFQVVNDG 98          
BLAST of SMED30020261 vs. Ensembl Mouse
Match: Hspa1b (heat shock protein 1B [Source:MGI Symbol;Acc:MGI:99517])

HSP 1 Score: 47.3654 bits (111), Expect = 3.395e-6
Identity = 26/63 (41.27%), Postives = 37/63 (58.73%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKHTYMQ*IKCG 328
            + T +YV FTDTE LIG A KN+   N  +  FD KRLIG    + ++ +++KH   Q +  G
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDAVVQSDMKHWPFQVVNDG 98          
BLAST of SMED30020261 vs. Ensembl Mouse
Match: Hspa8 (heat shock protein 8 [Source:MGI Symbol;Acc:MGI:105384])

HSP 1 Score: 46.595 bits (109), Expect = 5.122e-6
Identity = 24/54 (44.44%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKH 301
            + T +YV FTDTE LIG A KN+   N  +  FD KRLIG    + ++ +++KH
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKH 89          
BLAST of SMED30020261 vs. Ensembl Mouse
Match: Hspa8 (heat shock protein 8 [Source:MGI Symbol;Acc:MGI:105384])

HSP 1 Score: 46.595 bits (109), Expect = 5.150e-6
Identity = 24/54 (44.44%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKH 301
            + T +YV FTDTE LIG A KN+   N  +  FD KRLIG    + ++ +++KH
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKH 89          
BLAST of SMED30020261 vs. UniProt/SwissProt
Match: sp|Q91233|HSP70_ONCTS (Heat shock 70 kDa protein OS=Oncorhynchus tshawytscha OX=74940 GN=hsp70 PE=2 SV=1)

HSP 1 Score: 50.447 bits (119), Expect = 2.088e-6
Identity = 27/54 (50.00%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGINKNTIIV-TEIKH 301
            + T +YV FTDTE LIG A KN+   N N+  FD KRLIG   N  +V  ++KH
Sbjct:   38 RTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFNDQVVQADMKH 91          
BLAST of SMED30020261 vs. UniProt/SwissProt
Match: sp|Q07437|HSP70_LEIAM (Heat shock 70 kDa protein OS=Leishmania amazonensis OX=5659 GN=HSP70 PE=2 SV=1)

HSP 1 Score: 49.2914 bits (116), Expect = 4.816e-6
Identity = 25/54 (46.30%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGINKNTIIV-TEIKH 301
            + T +YV FTD+E LIG A KN+   N ++  FD KRLIG   N ++V +++KH
Sbjct:   36 RTTPSYVAFTDSERLIGDAAKNQVAMNPHNTVFDAKRLIGRKFNDLVVQSDMKH 89          
BLAST of SMED30020261 vs. UniProt/SwissProt
Match: sp|P16019|HSP70_THEAN (Heat shock 70 kDa protein OS=Theileria annulata OX=5874 GN=TA11610 PE=3 SV=2)

HSP 1 Score: 48.9062 bits (115), Expect = 6.035e-6
Identity = 26/54 (48.15%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGINKNTIIVTE-IKH 301
            + T +YV FTDTE LIG A KN++ +N  +  FD KRLIG   +   V E +KH
Sbjct:   35 RTTPSYVAFTDTERLIGDAAKNQEARNPENTIFDAKRLIGRKFDDRTVQEDMKH 88          
BLAST of SMED30020261 vs. UniProt/SwissProt
Match: sp|Q27031|HSP70_THEPA (Heat shock 70 kDa protein OS=Theileria parva OX=5875 GN=TP02_0148 PE=2 SV=2)

HSP 1 Score: 48.9062 bits (115), Expect = 6.036e-6
Identity = 26/54 (48.15%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGINKNTIIVTE-IKH 301
            + T +YV FTDTE LIG A KN++ +N  +  FD KRLIG   +   V E +KH
Sbjct:   35 RTTPSYVAFTDTERLIGDAAKNQEARNPENTIFDAKRLIGRKFDDRTVQEDMKH 88          
BLAST of SMED30020261 vs. Ensembl Cavefish
Match: ENSAMXT00000032722.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001455.1:155723:156505:1 gene:ENSAMXG00000042801.1 transcript:ENSAMXT00000032722.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 3.587e-8
Identity = 27/63 (42.86%), Postives = 39/63 (61.90%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKHTYMQ*IKCG 328
            + T +YV FTDTE LIG A KN+   N N+  FD KRLIG   ++ ++ +++KH   Q +  G
Sbjct:   38 RTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFEDPVVQSDMKHWPFQVVSDG 100          
BLAST of SMED30020261 vs. Ensembl Cavefish
Match: ENSAMXT00000055474.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001455.1:150188:156169:-1 gene:ENSAMXG00000043809.1 transcript:ENSAMXT00000055474.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 3.113e-7
Identity = 27/63 (42.86%), Postives = 38/63 (60.32%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKHTYMQ*IKCG 328
            + T +YV FTDTE LIG A KN+   N N+  FD KRLIG    + ++ +++KH   Q +  G
Sbjct:   38 RTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDDPVVQSDMKHWPFQVVSDG 100          
BLAST of SMED30020261 vs. Ensembl Cavefish
Match: ENSAMXT00000031477.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001455.1:148482:152871:-1 gene:ENSAMXG00000043809.1 transcript:ENSAMXT00000031477.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 3.113e-7
Identity = 27/63 (42.86%), Postives = 38/63 (60.32%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKHTYMQ*IKCG 328
            + T +YV FTDTE LIG A KN+   N N+  FD KRLIG    + ++ +++KH   Q +  G
Sbjct:   38 RTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDDPVVQSDMKHWPFQVVSDG 100          
BLAST of SMED30020261 vs. Ensembl Cavefish
Match: ENSAMXT00000037064.1 (heat shock 70 kDa protein [Source:NCBI gene;Acc:111193176])

HSP 1 Score: 50.0618 bits (118), Expect = 3.143e-7
Identity = 27/63 (42.86%), Postives = 38/63 (60.32%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKHTYMQ*IKCG 328
            + T +YV FTDTE LIG A KN+   N N+  FD KRLIG    + ++ +++KH   Q +  G
Sbjct:   38 RTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDDPVVQSDMKHWPFQVVSDG 100          
BLAST of SMED30020261 vs. Ensembl Cavefish
Match: hsc70 (heat shock cognate 71 kDa protein-like [Source:NCBI gene;Acc:103045816])

HSP 1 Score: 49.2914 bits (116), Expect = 5.774e-7
Identity = 25/54 (46.30%), Postives = 35/54 (64.81%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKH 301
            + T +YV FTDTE LIG A KN+   N N+  FD KRLIG    + ++ +++KH
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFDDAVVQSDMKH 89          
BLAST of SMED30020261 vs. Ensembl Yeast
Match: SSA1 (ATPase involved in protein folding and NLS-directed nuclear transport; member of HSP70 family; required for ubiquitin-dependent degradation of short-lived proteins; forms chaperone complex with Ydj1p; localized to nucleus, cytoplasm, cell wall; 98% identical to paralog Ssa2p with different functional specificity in propagation of yeast [URE3] prions, vacuolar-mediated degradations of gluconeogenesis enzymes; general targeting factor of Hsp104p to prion fibrils [Source:SGD;Acc:S000000004])

HSP 1 Score: 46.9802 bits (110), Expect = 4.627e-7
Identity = 26/54 (48.15%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGINKNTIIV-TEIKH 301
            + T ++V FTDTE LIG A KN+   N ++  FD KRLIG N N   V  ++KH
Sbjct:   34 RTTPSFVAFTDTERLIGDAAKNQAAMNPSNTVFDAKRLIGRNFNDPEVQADMKH 87          
BLAST of SMED30020261 vs. Ensembl Yeast
Match: SSA3 (ATPase involved in protein folding and the response to stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the heat shock protein 70 (HSP70) family; localized to the cytoplasm; SSA3 has a paralog, SSA4, that arose from the whole genome duplication [Source:SGD;Acc:S000000171])

HSP 1 Score: 46.595 bits (109), Expect = 6.096e-7
Identity = 25/54 (46.30%), Postives = 33/54 (61.11%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKH 301
            + T +YV FTDTE LIG A KN+   N ++  FD KRLIG    +  + T+ KH
Sbjct:   34 RTTPSYVAFTDTERLIGDAAKNQAAINPHNTVFDAKRLIGRKFDDPEVTTDAKH 87          
BLAST of SMED30020261 vs. Ensembl Yeast
Match: SSA4 (Heat shock protein that is highly induced upon stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the HSP70 family; cytoplasmic protein that concentrates in nuclei upon starvation; SSA4 has a paralog, SSA3, that arose from the whole genome duplication [Source:SGD;Acc:S000000905])

HSP 1 Score: 46.595 bits (109), Expect = 6.142e-7
Identity = 22/40 (55.00%), Postives = 27/40 (67.50%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIG 262
            + T +YV FTDTE LIG A KN+   N ++  FD KRLIG
Sbjct:   34 RTTPSYVAFTDTERLIGDAAKNQAAMNPHNTVFDAKRLIG 73          
BLAST of SMED30020261 vs. Ensembl Yeast
Match: SSA2 (HSP70 family ATP-binding protein; involved in protein folding, vacuolar import of proteins; required for ubiquitin-dependent degradation of short-lived proteins; associated with chaperonin-containing T-complex; 98% identical to paralog Ssa1p with distinct functional specificity in propagation of yeast [URE3] prions and vacuolar-mediated degradation of gluconeogenesis enzymes; binds tRNA, has role in tRNA nuclear import during starvation [Source:SGD;Acc:S000003947])

HSP 1 Score: 45.8246 bits (107), Expect = 1.101e-6
Identity = 23/44 (52.27%), Postives = 28/44 (63.64%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGINKN 274
            + T ++V FTDTE LIG A KN+   N  +  FD KRLIG N N
Sbjct:   34 RTTPSFVGFTDTERLIGDAAKNQAAMNPANTVFDAKRLIGRNFN 77          
BLAST of SMED30020261 vs. Ensembl Yeast
Match: KAR2 (ATPase involved in protein import into the ER; also acts as a chaperone to mediate protein folding in the ER and may play a role in ER export of soluble proteins; regulates the unfolded protein response via interaction with Ire1p [Source:SGD;Acc:S000003571])

HSP 1 Score: 45.0542 bits (105), Expect = 1.655e-6
Identity = 26/52 (50.00%), Postives = 31/52 (59.62%), Query Frame = 2
Query:  149 TSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGINKNTIIV-TEIKH 301
            T +YV FTD E LIG A KN+   N  +  FD KRLIG+  N   V  +IKH
Sbjct:   84 TPSYVAFTDDERLIGDAAKNQVAANPQNTIFDIKRLIGLKYNDRSVQKDIKH 135          
BLAST of SMED30020261 vs. Ensembl Medaka
Match: hspa8b (heat shock cognate 70 kDa protein [Source:NCBI gene;Acc:100125490])

HSP 1 Score: 48.9062 bits (115), Expect = 6.735e-7
Identity = 25/54 (46.30%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKH 301
            + T +YV FTDTE LIG A KN+   N N+  FD KRLIG    ++++ +++KH
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVALNPNNTVFDAKRLIGRRFDDSVVQSDMKH 89          
BLAST of SMED30020261 vs. Ensembl Medaka
Match: hspa8b (heat shock cognate 70 kDa protein [Source:NCBI gene;Acc:100125490])

HSP 1 Score: 48.521 bits (114), Expect = 8.515e-7
Identity = 25/54 (46.30%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKH 301
            + T +YV FTDTE LIG A KN+   N N+  FD KRLIG    ++++ +++KH
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVALNPNNTVFDAKRLIGRRFDDSVVQSDMKH 89          
BLAST of SMED30020261 vs. Ensembl Medaka
Match: hsp70-5 (Oryzias latipes heat shock protein 70 (hsp70-5), mRNA. [Source:RefSeq mRNA;Acc:NM_001104914])

HSP 1 Score: 47.7506 bits (112), Expect = 1.779e-6
Identity = 25/48 (52.08%), Postives = 30/48 (62.50%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGINKNTIIV 286
            + T +YV FTD E LIG A KN+   N ++  FD KRLIG N N  IV
Sbjct:   36 RTTPSYVAFTDAERLIGDAAKNQVAMNPSNTVFDAKRLIGRNFNDPIV 83          
BLAST of SMED30020261 vs. Ensembl Medaka
Match: hsc70 (heat shock protein 70 cognate [Source:NCBI gene;Acc:100049425])

HSP 1 Score: 46.2098 bits (108), Expect = 5.859e-6
Identity = 24/54 (44.44%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKH 301
            + T +YV FTDTE LIG A KN+   N  +  FD KRLIG    + ++ +++KH
Sbjct:   86 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDHVVQSDMKH 139          
BLAST of SMED30020261 vs. Ensembl Medaka
Match: hsc70 (heat shock protein 70 cognate [Source:NCBI gene;Acc:100049425])

HSP 1 Score: 46.2098 bits (108), Expect = 5.943e-6
Identity = 24/54 (44.44%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKH 301
            + T +YV FTDTE LIG A KN+   N  +  FD KRLIG    + ++ +++KH
Sbjct:   86 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDHVVQSDMKH 139          
BLAST of SMED30020261 vs. Planmine SMEST
Match: SMESG000040632.1 (SMESG000040632.1)

HSP 1 Score: 48.521 bits (114), Expect = 6.244e-7
Identity = 25/54 (46.30%), Postives = 35/54 (64.81%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGIN-KNTIIVTEIKH 301
            + T +YV FTDTE LIG A KN+   N N+  FD KRLIG   ++  + +++KH
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKH 89          
BLAST of SMED30020261 vs. Planmine SMEST
Match: SMESG000051815.1 (SMESG000051815.1)

HSP 1 Score: 47.7506 bits (112), Expect = 1.292e-6
Identity = 23/40 (57.50%), Postives = 27/40 (67.50%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIG 262
            + T +YV FTDTE LIG A KN+   N N+  FD KRLIG
Sbjct:   35 RTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIG 74          
BLAST of SMED30020261 vs. Planmine SMEST
Match: SMESG000051570.1 (SMESG000051570.1)

HSP 1 Score: 46.9802 bits (110), Expect = 2.325e-6
Identity = 23/40 (57.50%), Postives = 27/40 (67.50%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIG 262
            + T +YV FTDTE LIG A KN+   N N+  FD KRLIG
Sbjct:   35 RTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIG 74          
BLAST of SMED30020261 vs. Planmine SMEST
Match: SMESG000051567.1 (SMESG000051567.1)

HSP 1 Score: 46.9802 bits (110), Expect = 2.325e-6
Identity = 23/40 (57.50%), Postives = 27/40 (67.50%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIG 262
            + T +YV FTDTE LIG A KN+   N N+  FD KRLIG
Sbjct:   35 RTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIG 74          
BLAST of SMED30020261 vs. Planmine SMEST
Match: SMESG000051541.1 (SMESG000051541.1)

HSP 1 Score: 46.9802 bits (110), Expect = 2.325e-6
Identity = 23/40 (57.50%), Postives = 27/40 (67.50%), Query Frame = 2
Query:  143 KKTSTYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIG 262
            + T +YV FTDTE LIG A KN+   N N+  FD KRLIG
Sbjct:   35 RTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIG 74          
The following BLAST results are available for this feature:
BLAST of SMED30020261 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HSPA89.500e-744.44heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA89.909e-744.44heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA81.595e-644.44heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA81.600e-644.44heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA81.822e-644.44heat shock protein family A (Hsp70) member 8 [Sour... [more]
back to top
BLAST of SMED30020261 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp-701.939e-645.45Heat Shock Protein [Source:UniProtKB/TrEMBL;Acc:O... [more]
F44E5.54.412e-652.50pep chromosome:WBcel235:II:11759681:11761808:1 gen... [more]
F44E5.54.412e-652.50pep chromosome:WBcel235:II:11759640:11761853:1 gen... [more]
F44E5.44.412e-652.50pep chromosome:WBcel235:II:11757106:11759323:-1 ge... [more]
hsp-16.014e-644.44Heat shock 70 kDa protein A [Source:UniProtKB/Swi... [more]
back to top
BLAST of SMED30020261 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Hsp687.067e-646.30gene:FBgn0001230 transcript:FBtr0084589[more]
Hsc70-19.394e-642.59gene:FBgn0001216 transcript:FBtr0075762[more]
back to top
BLAST of SMED30020261 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp70.14.568e-746.30heat shock cognate 70-kd protein, tandem duplicate... [more]
hsp70.24.568e-746.30heat shock cognate 70-kd protein, tandem duplicate... [more]
hsp70.34.568e-746.30heat shock cognate 70-kd protein, tandem duplicate... [more]
hsp70l4.568e-746.30heat shock cognate 70-kd protein, like [Source:ZFI... [more]
hsp70.16.291e-746.30heat shock cognate 70-kd protein, tandem duplicate... [more]
back to top
BLAST of SMED30020261 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr262.949e-644.44WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
wdr264.242e-644.44WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
wdr264.540e-644.44WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
wdr264.750e-644.44WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
wdr264.986e-644.44WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
back to top
BLAST of SMED30020261 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hspa86.591e-744.44heat shock protein 8 [Source:MGI Symbol;Acc:MGI:10... [more]
Hspa1a3.394e-641.27heat shock protein 1A [Source:MGI Symbol;Acc:MGI:9... [more]
Hspa1b3.395e-641.27heat shock protein 1B [Source:MGI Symbol;Acc:MGI:9... [more]
Hspa85.122e-644.44heat shock protein 8 [Source:MGI Symbol;Acc:MGI:10... [more]
Hspa85.150e-644.44heat shock protein 8 [Source:MGI Symbol;Acc:MGI:10... [more]
back to top
BLAST of SMED30020261 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q91233|HSP70_ONCTS2.088e-650.00Heat shock 70 kDa protein OS=Oncorhynchus tshawyts... [more]
sp|Q07437|HSP70_LEIAM4.816e-646.30Heat shock 70 kDa protein OS=Leishmania amazonensi... [more]
sp|P16019|HSP70_THEAN6.035e-648.15Heat shock 70 kDa protein OS=Theileria annulata OX... [more]
sp|Q27031|HSP70_THEPA6.036e-648.15Heat shock 70 kDa protein OS=Theileria parva OX=58... [more]
back to top
BLAST of SMED30020261 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020261 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000032722.13.587e-842.86pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000055474.13.113e-742.86pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000031477.13.113e-742.86pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000037064.13.143e-742.86heat shock 70 kDa protein [Source:NCBI gene;Acc:11... [more]
hsc705.774e-746.30heat shock cognate 71 kDa protein-like [Source:NCB... [more]
back to top
BLAST of SMED30020261 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020261 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SSA14.627e-748.15ATPase involved in protein folding and NLS-directe... [more]
SSA36.096e-746.30ATPase involved in protein folding and the respons... [more]
SSA46.142e-755.00Heat shock protein that is highly induced upon str... [more]
SSA21.101e-652.27HSP70 family ATP-binding protein; involved in prot... [more]
KAR21.655e-650.00ATPase involved in protein import into the ER; als... [more]
back to top
BLAST of SMED30020261 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020261 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa8b6.735e-746.30heat shock cognate 70 kDa protein [Source:NCBI gen... [more]
hspa8b8.515e-746.30heat shock cognate 70 kDa protein [Source:NCBI gen... [more]
hsp70-51.779e-652.08Oryzias latipes heat shock protein 70 (hsp70-5), m... [more]
hsc705.859e-644.44heat shock protein 70 cognate [Source:NCBI gene;Ac... [more]
hsc705.943e-644.44heat shock protein 70 cognate [Source:NCBI gene;Ac... [more]
back to top
BLAST of SMED30020261 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040632.16.244e-746.30SMESG000040632.1[more]
SMESG000051815.11.292e-657.50SMESG000051815.1[more]
SMESG000051570.12.325e-657.50SMESG000051570.1[more]
SMESG000051567.12.325e-657.50SMESG000051567.1[more]
SMESG000051541.12.325e-657.50SMESG000051541.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020261 ID=SMED30020261|Name=SMED30020261|organism=Schmidtea mediterranea sexual|type=transcript|length=522bp
CTTTCTTGTGAATTGTAAATTTTGGTCTTCGATAAATAAAAATTTGGAAT
TAATTATCGCATTATTGTTGTTTTCTATTATCGAAAAAATTTGGATGTAT
TGTTCAATTGAGAAATATTCGCTGAGATTATGGCTAATGACCAAAAAAAC
CTCAACTTATGTTGAATTTACAGATACAGAACTATTGATCGGGTATGCCA
CAAAAAATCGAGACACGAAGAACTCAAACGATAAGAATTTTGATCCAAAG
AGACTGATCGGAATCAATAAAAATACAATAATAGTGACAGAAATTAAACA
TACTTATATGCAGTAAATAAAATGTGGATGAAAATAAATAAAAATCTAAA
TTGCAAAAAATATATACAACAATCGAATAGCCGCTTTCATAGTGTGTTTG
AAGAAAGGATGTTTTTAAAGATAAGGAAAACTGGCTTGTGAATATTTCAA
TACAGGGATATAAGATAGATACCAAATATGTTATGTCGCCAATTTAGAAA
GTATATAGTGATTTACTTTCAC
back to top

protein sequence of SMED30020261-orf-1

>SMED30020261-orf-1 ID=SMED30020261-orf-1|Name=SMED30020261-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=105bp
FLVNCKFWSSINKNLELIIALLLFSIIEKIWMYCSIEKYSLRLWLMTKKT
STYVEFTDTELLIGYATKNRDTKNSNDKNFDPKRLIGINKNTIIVTEIKH
TYMQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR013126Hsp_70_fam
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm