SMED30020260

Overview
NameSMED30020260
Smed IDSMED30020260
Length (bp)2154
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30020260 (SMED30020260) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30020260 (SMED30020260) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30020260 (SMED30020260) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30020260 (SMED30020260) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020260

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30020260h1SMcG0014373 SmedASXL_016662SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30020260h1SMcG0014373 SmedASXL_016661SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30020260h1SMcG0014373 dd_Smed_v4_12813_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30020260h1SMcG0014373 dd_Smed_v4_12813_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30020260h1SMcG0014373 dd_Smed_v4_12813_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020260h1SMcG0014373 dd_Smed_v4_12813_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020260h1SMcG0014373 dd_Smed_v4_12813_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30020260h1SMcG0014373 dd_Smed_v6_12813_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30020260 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000036:19840..34471 +10310
Homology
BLAST of SMED30020260 vs. TrEMBL
Match: A0A1S3KRG0 (leucine-rich repeat and IQ domain-containing protein 1 isoform X2 OS=Salmo salar OX=8030 GN=lrriq1 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 9.926e-11
Identity = 50/130 (38.46%), Postives = 75/130 (57.69%), Query Frame = 1
Query:  652 LTHLSVSGNHIKSWSLRNKFPNLVELDISHNSLTSLQAWSNTPLMVNLNLSYNLLTDIQSFQYSWMPCLSVLILDCNKLTSIPELC-FLSLQKISIQRNFLSESIN-CENLFQHCPLLSLINLKDNPTSQ 1035
            L HL +S NH+ S    +    L  LD++ N+LT L +  N  L+V L+L  N ++ ++     W+P + +L    N +T +P LC F+SL+K+ I+ N LSE  N CE+L Q CPLL  ++L  NP  Q
Sbjct:   41 LLHLDLSHNHLSSVEGLDNCALLNTLDLTGNNLTELPSLRNQVLLVELHLEDNSISSLEGLTACWLPLMQLLSGAQNSITQLPSLCHFVSLEKLDIRDNCLSELQNLCESL-QGCPLLREVHLTGNPLQQ 169          
BLAST of SMED30020260 vs. TrEMBL
Match: A0A1S3KS86 (leucine-rich repeat and IQ domain-containing protein 1 isoform X1 OS=Salmo salar OX=8030 GN=lrriq1 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.152e-10
Identity = 50/130 (38.46%), Postives = 75/130 (57.69%), Query Frame = 1
Query:  652 LTHLSVSGNHIKSWSLRNKFPNLVELDISHNSLTSLQAWSNTPLMVNLNLSYNLLTDIQSFQYSWMPCLSVLILDCNKLTSIPELC-FLSLQKISIQRNFLSESIN-CENLFQHCPLLSLINLKDNPTSQ 1035
            L HL +S NH+ S    +    L  LD++ N+LT L +  N  L+V L+L  N ++ ++     W+P + +L    N +T +P LC F+SL+K+ I+ N LSE  N CE+L Q CPLL  ++L  NP  Q
Sbjct:  266 LLHLDLSHNHLSSVEGLDNCALLNTLDLTGNNLTELPSLRNQVLLVELHLEDNSISSLEGLTACWLPLMQLLSGAQNSITQLPSLCHFVSLEKLDIRDNCLSELQNLCESL-QGCPLLREVHLTGNPLQQ 394          
BLAST of SMED30020260 vs. TrEMBL
Match: A0A4W5P738 (Leucine-rich repeats and IQ motif containing 1 OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.688e-10
Identity = 49/130 (37.69%), Postives = 74/130 (56.92%), Query Frame = 1
Query:  652 LTHLSVSGNHIKSWSLRNKFPNLVELDISHNSLTSLQAWSNTPLMVNLNLSYNLLTDIQSFQYSWMPCLSVLILDCNKLTSIPELC-FLSLQKISIQRNFLSESIN-CENLFQHCPLLSLINLKDNPTSQ 1035
            L HL +S NH+ S    +    L  LD++ N+LT L +  N  L++ L L  N ++ ++     W+P + +L    N +T +P LC F+SL+K+ I+ N LSE  N CE+L Q CPLL  ++L  NP  Q
Sbjct:  728 LLHLDLSHNHLSSVEGLDNCALLNTLDLTGNNLTELPSLRNQVLLLELRLEDNSISSLEGLTACWLPLMQLLSGAQNSITQLPSLCYFVSLEKLDIRDNCLSELQNLCESL-QGCPLLREVHLTGNPLQQ 856          
BLAST of SMED30020260 vs. TrEMBL
Match: A0A3P8Y2I8 (Uncharacterized protein OS=Esox lucius OX=8010 PE=3 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 2.093e-7
Identity = 44/134 (32.84%), Postives = 69/134 (51.49%), Query Frame = 1
Query:  652 LTHLSVSGNHIKSWSLRNKFPNLVELDISHNSLTSLQAWSNTPLMVNLNLSYNLLTDIQSFQYSWMPCLSVLILDCNKLTSIPELC-FLSLQKISIQRNFLSESINCENLFQHCPLLSLINLKDNPTSQNISKR 1050
            L HL +S NH+ S         L  LD++ N+LT   +  N  L+  L+L  N ++ I+     W+P + +L +  N +T +P L  F+SL+++ I+ N LSE  N  +    C LL  ++L  NP  Q  S R
Sbjct:  876 LLHLDLSHNHLSSVDGLENCALLSVLDLTGNNLTEPPSLKNQVLLKELHLQDNSISSIEDLTDCWLPLMQLLCVAQNSITQLPPLSDFVSLERLDIRHNCLSELQNLCDGLAGCLLLREVHLTGNPLQQEPSWR 1009          
BLAST of SMED30020260 vs. TrEMBL
Match: A0A3P8Y2R5 (Uncharacterized protein OS=Esox lucius OX=8010 PE=3 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 2.104e-7
Identity = 44/134 (32.84%), Postives = 69/134 (51.49%), Query Frame = 1
Query:  652 LTHLSVSGNHIKSWSLRNKFPNLVELDISHNSLTSLQAWSNTPLMVNLNLSYNLLTDIQSFQYSWMPCLSVLILDCNKLTSIPELC-FLSLQKISIQRNFLSESINCENLFQHCPLLSLINLKDNPTSQNISKR 1050
            L HL +S NH+ S         L  LD++ N+LT   +  N  L+  L+L  N ++ I+     W+P + +L +  N +T +P L  F+SL+++ I+ N LSE  N  +    C LL  ++L  NP  Q  S R
Sbjct:  946 LLHLDLSHNHLSSVDGLENCALLSVLDLTGNNLTEPPSLKNQVLLKELHLQDNSISSIEDLTDCWLPLMQLLCVAQNSITQLPPLSDFVSLERLDIRHNCLSELQNLCDGLAGCLLLREVHLTGNPLQQEPSWR 1079          
BLAST of SMED30020260 vs. Ensembl Sea Lamprey
Match: lrguk (leucine-rich repeats and guanylate kinase domain containing [Source:ZFIN;Acc:ZDB-GENE-050419-232])

HSP 1 Score: 50.0618 bits (118), Expect = 1.388e-6
Identity = 34/123 (27.64%), Postives = 64/123 (52.03%), Query Frame = 1
Query:  658 HLSVSGNHIKSWSLRNKFPNLVELDISHNSLTSLQAWSNTPLMVNLNLSYNLLTDIQSFQYSWMPCLSVLILDCNKLTSIPEL-CFLSLQKISIQRNFLSESINCENLFQHCPLLSLINLKDN 1023
            HL++ G  +K   + + + ++ +LD+SHN +  L    N P +V L +S+N LT +  F++S +  L       N ++ + ++  + SL K+ +  N +SE I  E     C  L+ ++L  N
Sbjct:   27 HLALPGYGLKDIGILSGYVHIQKLDLSHNKIKELSVLGNMPYLVELKVSHNQLTKL--FEFSILRFLKEADFSYNTISEMKDMSVYKSLTKLVLDNNNISEIIGLEE----CGSLAYLSLAHN 143          
BLAST of SMED30020260 vs. Planmine SMEST
Match: SMESG000005697.1 (SMESG000005697.1)

HSP 1 Score: 1163.67 bits (3009), Expect = 0.000e+0
Identity = 628/636 (98.74%), Postives = 634/636 (99.69%), Query Frame = 1
Query:  229 CKSLFISKSQMDSVTKLKTSFSILEHLVLNETSTNYFHMDDLPESIKSXXXXXXXXEWAYFGQNIESNLSILSCSSNELADLPFNAFRXXXXXXXXXXXXXXXXXXXXXXHGNIPXXXXXXXXXXXXXXXXXXXXXTYCPNLTHLSVSGNHIKSWSLRNKFPNLVELDISHNSLTSLQAWSNTPLMVNLNLSYNLLTDIQSFQYSWMPCLSVLILDCNKLTSIPELCFLSLQKISIQRNFLSESINCENLFQHCPLLSLINLKDNPTSQNISKRYMKNQGTDKEIICPDGEFANGCYDFSDSIQQKSARFXXXXXXXXXXXXAYKHQIHYYRFIREMVEDYSVWSEEILFNEKSNNKKYEKIHCESAIKIQSLWRGYKTKKWYKSILSYVRFDMEENFDELGLVDVSEYEKPDLINNWNDFQEIPTVTEAWINPSENLKGESAKMNFTSPVDTYTNEIVISGNGSTHRSNSTSTLNRKELEIMKEWGFEDPNSALWMLERAKKFHKKPIKNSKRQILSQIQKPTLQTVKISNINLPKAEMNLQKNSFHMVPLNTVTIHPPESVHNSNFKSKIDQWLNDSDFMPNVPSSVNPDKRSFLPAIELENQFKIISKVPLNCSHPKSSTTKLPAINYVPGNV 2136
            CKSLFISKSQMDSVTKLKTSFSILEHLVLNETSTNYFHMDDLPESIKSININQNQIEWAYFGQNIESNLSILSCSSNELADLPFNAFRNCSNIIHINFSNNNFV ID+IFHGNIPLKKLCSLNLNNNVLSSLDNLDTYCPNLTHLSVSGNHIK+WSLRNKFPNLVELDISHNSLTSLQAWSNTPLMVNLNLSYNLLTDIQSFQYSWMPCLSVLILDCNKLTSIPELCFLSLQKISIQRNFLSESINCENLFQHCPLLSLINLKDNPTSQNISKRYMKNQGTDKEIICPDGEFANGCYDFSDSIQQKSARFDKLLKSTSDLDLAYKHQIHYYRFIREMVEDYSVWSEEILFNEKSNNKKYEKIHCESAIKIQSLWRGYKT+KWYKSILSYVRFDMEENFDELGLVDVSEYEKPDLINNWNDFQEIPT+TEAWINPSENLKGESAKMNFTSPVDTYTNEIVISGNGSTHRSNSTSTLNRKELEIMKEWGFEDPNSALWMLERAKKFHKKPIKNSKRQILSQIQKPTLQTVKISNINLPKAEMNLQKNSFHMVPLNTVTIHPPESVHNSNFKSKIDQWLNDSDFMPN+ SSVNPDKRSFLPAIELENQFKIISKVPLNCSHPK+STTKLPAINYVPGNV
Sbjct:  942 CKSLFISKSQMDSVTKLKTSFSILEHLVLNETSTNYFHMDDLPESIKSININQNQIEWAYFGQNIESNLSILSCSSNELADLPFNAFRNCSNIIHINFSNNNFVKIDNIFHGNIPLKKLCSLNLNNNVLSSLDNLDTYCPNLTHLSVSGNHIKNWSLRNKFPNLVELDISHNSLTSLQAWSNTPLMVNLNLSYNLLTDIQSFQYSWMPCLSVLILDCNKLTSIPELCFLSLQKISIQRNFLSESINCENLFQHCPLLSLINLKDNPTSQNISKRYMKNQGTDKEIICPDGEFANGCYDFSDSIQQKSARFDKLLKSTSDLDLAYKHQIHYYRFIREMVEDYSVWSEEILFNEKSNNKKYEKIHCESAIKIQSLWRGYKTRKWYKSILSYVRFDMEENFDELGLVDVSEYEKPDLINNWNDFQEIPTITEAWINPSENLKGESAKMNFTSPVDTYTNEIVISGNGSTHRSNSTSTLNRKELEIMKEWGFEDPNSALWMLERAKKFHKKPIKNSKRQILSQIQKPTLQTVKISNINLPKAEMNLQKNSFHMVPLNTVTIHPPESVHNSNFKSKIDQWLNDSDFMPNISSSVNPDKRSFLPAIELENQFKIISKVPLNCSHPKTSTTKLPAINYVPGNV 1577          
The following BLAST results are available for this feature:
BLAST of SMED30020260 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020260 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020260 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020260 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020260 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020260 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020260 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020260 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3KRG09.926e-1138.46leucine-rich repeat and IQ domain-containing prote... [more]
A0A1S3KS861.152e-1038.46leucine-rich repeat and IQ domain-containing prote... [more]
A0A4W5P7381.688e-1037.69Leucine-rich repeats and IQ motif containing 1 OS=... [more]
A0A3P8Y2I82.093e-732.84Uncharacterized protein OS=Esox lucius OX=8010 PE=... [more]
A0A3P8Y2R52.104e-732.84Uncharacterized protein OS=Esox lucius OX=8010 PE=... [more]
back to top
BLAST of SMED30020260 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020260 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lrguk1.388e-627.64leucine-rich repeats and guanylate kinase domain c... [more]
back to top
BLAST of SMED30020260 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020260 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020260 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020260 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000005697.10.000e+098.74SMESG000005697.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020260 ID=SMED30020260|Name=SMED30020260|organism=Schmidtea mediterranea sexual|type=transcript|length=2154bp
GTTTCTTCTTCACTTTGTGAACCTTTTAATAATTGATTTGAGGGGGCGTA
AATATGATCCTCGTCCACGGACGCCAAAGTCGCTAGCTACGACTCTGGTA
TCAATTACAATACAAAAGCTTGGAAATCGATAAACGAAACATCATTAGAC
GTGCAAAGGGTTAAATTGTTTTCCTTGTTAATTGAATTTTAATGTGCTTT
TATTGATAAAAATATATCCATATTTTAGTGTAAGTCGTTGTTCATATCTA
AATCGCAAATGGATTCCGTAACGAAACTGAAAACTTCATTCTCCATATTG
GAACATTTAGTTTTAAATGAAACTTCCACAAACTATTTTCACATGGATGA
TTTACCAGAATCCATTAAATCTATCAATATCAATCAAAATCAAATTGAGT
GGGCTTATTTTGGGCAAAATATAGAGTCAAATCTTTCAATTCTGTCATGC
TCGTCAAATGAATTGGCAGATTTACCTTTCAATGCCTTTAGAAATTGTTC
TAATATTATCCACATCAATTTTTCTAACAACAATTTTGTAAATATTGATA
GCATATTCCATGGAAATATCCCATTGAAAAAGTTATGTTCTTTAAATTTG
AATAACAACGTCCTTTCAAGTCTTGATAATCTTGACACGTATTGTCCGAA
TTTGACTCACCTATCGGTATCGGGAAATCACATTAAGAGTTGGTCGCTTC
GTAATAAATTTCCGAATTTGGTCGAATTAGACATATCTCACAATTCATTG
ACTTCGTTACAAGCTTGGTCAAATACCCCTCTGATGGTCAATTTAAATTT
ATCATATAACTTACTTACGGACATTCAATCATTTCAATATTCATGGATGC
CGTGTCTATCAGTTTTGATTCTCGATTGCAACAAGCTGACTTCTATTCCT
GAACTGTGTTTCTTGTCTTTGCAGAAGATAAGTATTCAGAGAAACTTTTT
ATCAGAATCTATAAATTGTGAGAATTTGTTTCAGCACTGCCCACTTCTTT
CTCTTATCAATTTGAAAGATAATCCGACATCACAAAATATTTCAAAAAGA
TATATGAAAAATCAAGGAACTGATAAAGAAATCATTTGTCCAGATGGGGA
ATTTGCAAATGGCTGTTATGATTTCTCTGACAGCATTCAGCAGAAATCAG
CTAGATTTGACAAACTTTTGAAATCTACAAGTGATCTCGATCTTGCCTAT
AAGCATCAAATTCATTATTATCGCTTTATTAGAGAAATGGTCGAAGATTA
TTCTGTTTGGTCTGAAGAAATTTTATTTAATGAAAAATCTAATAATAAAA
AATACGAAAAGATCCATTGTGAATCAGCAATAAAAATTCAGTCACTGTGG
AGAGGCTATAAGACTAAAAAATGGTATAAAAGCATTCTGTCCTATGTTAG
ATTTGATATGGAGGAAAATTTTGATGAATTAGGTTTGGTCGATGTTTCGG
AATATGAGAAACCCGATTTAATAAACAATTGGAATGATTTCCAAGAAATT
CCAACTGTAACAGAAGCTTGGATAAATCCTTCTGAGAATTTGAAAGGCGA
AAGTGCAAAAATGAATTTTACATCGCCTGTCGATACATATACTAATGAAA
TCGTTATATCTGGGAATGGTTCCACACATAGATCCAATTCGACATCGACG
CTAAACAGAAAGGAACTAGAAATAATGAAAGAATGGGGTTTTGAAGATCC
AAATAGTGCATTGTGGATGTTAGAAAGGGCTAAGAAATTTCACAAAAAAC
CCATCAAAAATTCAAAGCGACAAATATTAAGTCAGATACAAAAACCAACT
TTACAAACTGTCAAAATTAGTAATATCAATCTTCCTAAAGCAGAAATGAA
TCTACAGAAAAATTCTTTCCATATGGTCCCACTGAATACAGTAACAATCC
ACCCCCCTGAAAGTGTGCATAATTCCAATTTCAAATCAAAAATCGACCAG
TGGTTGAATGACAGTGATTTCATGCCCAATGTTCCCTCATCGGTAAATCC
CGACAAAAGATCATTTTTACCAGCGATAGAATTAGAAAACCAGTTCAAAA
TCATTTCAAAGGTCCCTTTGAATTGTTCTCACCCGAAGAGCTCAACGACA
AAGCTGCCTGCGATTAATTATGTTCCTGGAAACGTCTAATTGGATATGTT
ACTG
back to top

protein sequence of SMED30020260-orf-1

>SMED30020260-orf-1 ID=SMED30020260-orf-1|Name=SMED30020260-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=627bp
MDSVTKLKTSFSILEHLVLNETSTNYFHMDDLPESIKSININQNQIEWAY
FGQNIESNLSILSCSSNELADLPFNAFRNCSNIIHINFSNNNFVNIDSIF
HGNIPLKKLCSLNLNNNVLSSLDNLDTYCPNLTHLSVSGNHIKSWSLRNK
FPNLVELDISHNSLTSLQAWSNTPLMVNLNLSYNLLTDIQSFQYSWMPCL
SVLILDCNKLTSIPELCFLSLQKISIQRNFLSESINCENLFQHCPLLSLI
NLKDNPTSQNISKRYMKNQGTDKEIICPDGEFANGCYDFSDSIQQKSARF
DKLLKSTSDLDLAYKHQIHYYRFIREMVEDYSVWSEEILFNEKSNNKKYE
KIHCESAIKIQSLWRGYKTKKWYKSILSYVRFDMEENFDELGLVDVSEYE
KPDLINNWNDFQEIPTVTEAWINPSENLKGESAKMNFTSPVDTYTNEIVI
SGNGSTHRSNSTSTLNRKELEIMKEWGFEDPNSALWMLERAKKFHKKPIK
NSKRQILSQIQKPTLQTVKISNINLPKAEMNLQKNSFHMVPLNTVTIHPP
ESVHNSNFKSKIDQWLNDSDFMPNVPSSVNPDKRSFLPAIELENQFKIIS
KVPLNCSHPKSSTTKLPAINYVPGNV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR003591Leu-rich_rpt_typical-subtyp
IPR025875Leu-rich_rpt_4
IPR032675LRR_dom_sf
IPR000048IQ_motif_EF-hand-BS
IPR001611Leu-rich_rpt
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003591Leucine-rich repeat, typical subtypeSMARTSM00369LRR_typ_2coord: 151..174
e-value: 9.3
score: 13.5
coord: 106..129
e-value: 35.0
score: 8.8
coord: 197..220
e-value: 1.6
score: 17.7
coord: 57..79
e-value: 120.0
score: 4.3
IPR025875Leucine rich repeat 4PFAMPF12799LRR_4coord: 130..168
e-value: 6.7E-8
score: 32.7
IPR000048IQ motif, EF-hand binding sitePFAMPF00612IQcoord: 356..374
e-value: 3.5E-7
score: 29.4
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 353..381
score: 10.219
NoneNo IPR availableGENE3DG3DSA:1.20.5.190coord: 340..372
e-value: 3.8E-5
score: 25.4
NoneNo IPR availablePANTHERPTHR24373SLIT RELATED LEUCINE-RICH REPEAT NEURONAL PROTEINcoord: 129..575
coord: 8..168
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 11..264
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 2..282
e-value: 4.8E-34
score: 119.3
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 153..174
score: 7.435
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 131..152
score: 6.526
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 175..196
score: 5.895
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 58..79
score: 5.717
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 199..220
score: 8.336
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 108..129
score: 8.189
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 82..103
score: 5.317