DUF3421 domain-containing protein

Overview
NameDUF3421 domain-containing protein
Smed IDSMED30020257
Length (bp)672
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DUF3421 domain-containing protein (SMED30020257) t-SNE clustered cells

Violin plots show distribution of expression levels for DUF3421 domain-containing protein (SMED30020257) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DUF3421 domain-containing protein (SMED30020257) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DUF3421 domain-containing protein (SMED30020257) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020257

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30020257SMESG000046742.1 dd_Smed_v4_1040_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30020257SMESG000046742.1 dd_Smed_v4_1040_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020257SMESG000046742.1 dd_Smed_v4_1040_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30020257SMESG000046742.1 dd_Smed_v4_1040_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30020257SMESG000046742.1 dd_Smed_v4_1040_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020257SMESG000046742.1 dd_Smed_v4_1040_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020257SMESG000046742.1 dd_Smed_v4_1040_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30020257SMESG000046742.1 dd_Smed_v4_1040_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020257SMESG000046742.1 Contig42829newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020257SMESG000046742.1 Contig42829uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30020257SMESG000046742.1 dd_Smed_v6_1040_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30020257SMESG000046742.1 dd_Smed_v4_1040_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG10527 (gene:FBgn0034583 transcript:FBtr0071541)

HSP 1 Score: 111.309 bits (277), Expect = 3.434e-29
Identity = 59/141 (41.84%), Postives = 80/141 (56.74%), Query Frame = 1
Query:  178 WQPGNNGQVPYNAIQ----ADGGLFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEV 588
            W P  NG+VP NA++    +   L+I RAR  GD+ PGKL   +   Y ++ G E   + YEVLC  G         W+ +  G +PPNAL  G T+  EPL+IGRA   G + VGK+  SHGC Y+PYGG+E     +E+
Sbjct:  159 WVPAANGEVPPNALEGGFDSSEQLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEHGHAEYEVLCAGGGQ-------WLPVDAGNIPPNALPAGETAEGEPLFIGRATHDGTITVGKVQPSHGCCYIPYGGEELAYKEFEI 292          

HSP 2 Score: 70.4774 bits (171), Expect = 3.969e-14
Identity = 37/66 (56.06%), Postives = 43/66 (65.15%), Query Frame = 1
Query:  397 WIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVLC 594
            W+  +NG VPPNAL GG  SS E LYI RAR  GD+  GK+  SHG  Y+ +GG EH    YEVLC
Sbjct:  159 WVPAANGEVPPNALEGGFDSS-EQLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEHGHAEYEVLC 223          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG44250 (gene:FBgn0265185 transcript:FBtr0339104)

HSP 1 Score: 98.9821 bits (245), Expect = 9.877e-25
Identity = 51/119 (42.86%), Postives = 70/119 (58.82%), Query Frame = 1
Query:  235 LFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVL 591
            +++GR+   G+  P K+       Y +Y G E   ++YEVL   G         W+  S+G VPPNA+  G T + EPLY+GR   +G + VGK+  SHGC Y+P+GGQE RIN YEVL
Sbjct:   30 IYVGRSFHEGENLPAKVVPSKGCAYVAYGGAEHTKTHYEVLVGQGF-------AWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVRINTYEVL 141          

HSP 2 Score: 86.2705 bits (212), Expect = 6.728e-20
Identity = 49/145 (33.79%), Postives = 74/145 (51.03%), Query Frame = 1
Query:  172 LSWQPGNNGQVPYNAIQADGG-----LFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVL 591
             +W P ++G VP NA+++        L++GR    G +T GK+   +   Y  + G+E  I+ YEVL            +W+  S    PP A++ GH S   P+Y GRA   G+M   K+  S G AY+ +GG E +  +YEVL
Sbjct:   75 FAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVRINTYEVLIKQQ------HDVWVPASPSYTPPGAVIAGHDSDRTPIYAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVL 213          

HSP 3 Score: 80.1073 bits (196), Expect = 1.301e-17
Identity = 50/150 (33.33%), Postives = 72/150 (48.00%), Query Frame = 1
Query:  160 RQASLSWQPGNNGQVPYNAIQA-----DGGLFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVLC 594
            +Q    W P +    P  A+ A        ++ GRA   G++ P K+     T Y  + G E    +YEVL   G        +W++  +  +PPNA+  G   + E LY GR    G +  G I  S  C Y+PYGG+E RIN+YE+LC
Sbjct:  143 KQQHDVWVPASPSYTPPGAVIAGHDSDRTPIYAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVLTGYGY-------VWMNCGH-SIPPNAVTTGRARNGELLYYGRGHYQGSLTPGLISASQRCLYIPYGGREIRINSYEILC 284          

HSP 4 Score: 63.5438 bits (153), Expect = 8.585e-12
Identity = 30/70 (42.86%), Postives = 42/70 (60.00%), Query Frame = 1
Query:  388 ETIWIHMSN-GCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVLC 594
            +  W+H S    +PP A++GGH S   P+Y+GR+   G+    K+  S GCAY+ YGG EH   +YEVL 
Sbjct:    2 DNTWVHSSPYSPLPPYAVIGGHDSDRTPIYVGRSFHEGENLPAKVVPSKGCAYVAYGGAEHTKTHYEVLV 71          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG44250 (gene:FBgn0265185 transcript:FBtr0339105)

HSP 1 Score: 99.3673 bits (246), Expect = 1.009e-24
Identity = 51/119 (42.86%), Postives = 70/119 (58.82%), Query Frame = 1
Query:  235 LFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVL 591
            +++GR+   G+  P K+       Y +Y G E   ++YEVL   G         W+  S+G VPPNA+  G T + EPLY+GR   +G + VGK+  SHGC Y+P+GGQE RIN YEVL
Sbjct:   41 IYVGRSFHEGENLPAKVVPSKGCAYVAYGGAEHTKTHYEVLVGQGF-------AWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVRINTYEVL 152          

HSP 2 Score: 86.2705 bits (212), Expect = 7.357e-20
Identity = 49/145 (33.79%), Postives = 74/145 (51.03%), Query Frame = 1
Query:  172 LSWQPGNNGQVPYNAIQADGG-----LFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVL 591
             +W P ++G VP NA+++        L++GR    G +T GK+   +   Y  + G+E  I+ YEVL            +W+  S    PP A++ GH S   P+Y GRA   G+M   K+  S G AY+ +GG E +  +YEVL
Sbjct:   86 FAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVRINTYEVLIKQQ------HDVWVPASPSYTPPGAVIAGHDSDRTPIYAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVL 224          

HSP 3 Score: 80.1073 bits (196), Expect = 1.438e-17
Identity = 50/150 (33.33%), Postives = 72/150 (48.00%), Query Frame = 1
Query:  160 RQASLSWQPGNNGQVPYNAIQA-----DGGLFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVLC 594
            +Q    W P +    P  A+ A        ++ GRA   G++ P K+     T Y  + G E    +YEVL   G        +W++  +  +PPNA+  G   + E LY GR    G +  G I  S  C Y+PYGG+E RIN+YE+LC
Sbjct:  154 KQQHDVWVPASPSYTPPGAVIAGHDSDRTPIYAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVLTGYGY-------VWMNCGH-SIPPNAVTTGRARNGELLYYGRGHYQGSLTPGLISASQRCLYIPYGGREIRINSYEILC 295          

HSP 4 Score: 63.5438 bits (153), Expect = 9.153e-12
Identity = 30/70 (42.86%), Postives = 42/70 (60.00%), Query Frame = 1
Query:  388 ETIWIHMSN-GCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVLC 594
            +  W+H S    +PP A++GGH S   P+Y+GR+   G+    K+  S GCAY+ YGG EH   +YEVL 
Sbjct:   13 DNTWVHSSPYSPLPPYAVIGGHDSDRTPIYVGRSFHEGENLPAKVVPSKGCAYVAYGGAEHTKTHYEVLV 82          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG13321 (gene:FBgn0033787 transcript:FBtr0345371)

HSP 1 Score: 97.4413 bits (241), Expect = 4.318e-24
Identity = 50/120 (41.67%), Postives = 66/120 (55.00%), Query Frame = 1
Query:  235 LFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVLC 594
            +F+GRA   G++ P K+  G    Y  + G+E    ++EVL        G    WI  S G VPP+A+  G T   EPLY+GR    G +  GK+  SH C Y+PYGGQEHR+  YEVL 
Sbjct:   31 IFVGRAYHNGEMLPAKVVPGKQQAYVPWGGQEISKHDFEVLV-------GDHFSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLV 143          

HSP 2 Score: 93.9745 bits (232), Expect = 8.705e-23
Identity = 55/126 (43.65%), Postives = 74/126 (58.73%), Query Frame = 1
Query:  220 QADGG-LFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVLC 594
             ADG  +++GRA   GD+ P K+       Y  Y G E    +YE+L   G   +G    W+H S+G VP NA++ G TS  EPL+IGRA   G +  GKI QSH C Y+P+ G+E RI++YEVL 
Sbjct:  166 DADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLAGYG---YG----WVHDSHGNVPGNAVLCGRTSDGEPLFIGRAHHHGSLTPGKIHQSHHCLYIPFDGEEVRIDHYEVLV 284          

HSP 3 Score: 93.2041 bits (230), Expect = 1.948e-22
Identity = 55/146 (37.67%), Postives = 77/146 (52.74%), Query Frame = 1
Query:  172 LSWQPGNNGQVPYNAIQADGG-----LFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVLC 594
             SW P + G VP +AIQ         L++GR    G +TPGK+   +   Y  Y G+E  +  YEVL         PET WI  S   + P  +VGGH +  + +Y+GRA   GD+   K+  + GCAY+PYGG E   ++YE+L 
Sbjct:   76 FSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLVQ-------PET-WIASSGRGIVPGTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLA 213          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG13321 (gene:FBgn0033787 transcript:FBtr0087792)

HSP 1 Score: 97.4413 bits (241), Expect = 4.318e-24
Identity = 50/120 (41.67%), Postives = 66/120 (55.00%), Query Frame = 1
Query:  235 LFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVLC 594
            +F+GRA   G++ P K+  G    Y  + G+E    ++EVL        G    WI  S G VPP+A+  G T   EPLY+GR    G +  GK+  SH C Y+PYGGQEHR+  YEVL 
Sbjct:   31 IFVGRAYHNGEMLPAKVVPGKQQAYVPWGGQEISKHDFEVLV-------GDHFSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLV 143          

HSP 2 Score: 93.9745 bits (232), Expect = 8.705e-23
Identity = 55/126 (43.65%), Postives = 74/126 (58.73%), Query Frame = 1
Query:  220 QADGG-LFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVLC 594
             ADG  +++GRA   GD+ P K+       Y  Y G E    +YE+L   G   +G    W+H S+G VP NA++ G TS  EPL+IGRA   G +  GKI QSH C Y+P+ G+E RI++YEVL 
Sbjct:  166 DADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLAGYG---YG----WVHDSHGNVPGNAVLCGRTSDGEPLFIGRAHHHGSLTPGKIHQSHHCLYIPFDGEEVRIDHYEVLV 284          

HSP 3 Score: 93.2041 bits (230), Expect = 1.948e-22
Identity = 55/146 (37.67%), Postives = 77/146 (52.74%), Query Frame = 1
Query:  172 LSWQPGNNGQVPYNAIQADGG-----LFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVLC 594
             SW P + G VP +AIQ         L++GR    G +TPGK+   +   Y  Y G+E  +  YEVL         PET WI  S   + P  +VGGH +  + +Y+GRA   GD+   K+  + GCAY+PYGG E   ++YE+L 
Sbjct:   76 FSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLVQ-------PET-WIASSGRGIVPGTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLA 213          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A1I8H2V3 (DUF3421 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 3.658e-42
Identity = 66/143 (46.15%), Postives = 94/143 (65.73%), Query Frame = 1
Query:  163 QASLSWQPGNNGQVPYNAIQADGGLFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVL 591
            Q +LSW P   GQ+P  AIQ   G+F+ RA+  G++ PGK  +G+   Y SY G+E  +S+YE+LCDT +  FG    W       VP  AL+GG+++  +P YIGR++I+G+M  GK+ + HGCAY P+GGQEHR N +E+L
Sbjct:   20 QVTLSWIPARGGQIPNGAIQVGHGVFVARAQHAGELIPGKASMGHQAAYVSYGGQEHAVSDYEILCDTHMQCFGCNYTWERCHGRSVPRGALIGGYSADRQPYYIGRSQINGEMVAGKVFEPHGCAYFPWGGQEHRSNEFEIL 162          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A267EA64 (DUF3421 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026761g1 PE=4 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 3.674e-42
Identity = 66/143 (46.15%), Postives = 94/143 (65.73%), Query Frame = 1
Query:  163 QASLSWQPGNNGQVPYNAIQADGGLFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVL 591
            Q +LSW P   GQ+P  AIQ   G+F+ RA+  G++ PGK  +G+   Y SY G+E  +S+YE+LCDT +  FG    W       VP  AL+GG+++  +P YIGR++I+G+M  GK+ + HGCAY P+GGQEHR N +E+L
Sbjct:   18 QVTLSWIPARGGQIPNGAIQVGHGVFVARAQHAGELIPGKASMGHQAAYVSYGGQEHAVSDYEILCDTHMQCFGCNYTWERCHGRSVPRGALIGGYSADRQPYYIGRSQINGEMVAGKVFEPHGCAYFPWGGQEHRSNEFEIL 160          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A1I8JBN4 (DUF3421 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020417g2 PE=4 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 4.148e-42
Identity = 66/143 (46.15%), Postives = 94/143 (65.73%), Query Frame = 1
Query:  163 QASLSWQPGNNGQVPYNAIQADGGLFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVL 591
            Q +LSW P   GQ+P  AIQ   G+F+ RA+  G++ PGK  +G+   Y SY G+E  +S+YE+LCDT +  FG    W       VP  AL+GG+++  +P YIGR++I+G+M  GK+ + HGCAY P+GGQEHR N +E+L
Sbjct:   22 QVTLSWIPARGGQIPNGAIQVGHGVFVARAQHAGELIPGKASMGHQAAYVSYGGQEHAVSDYEILCDTHMQCFGCNYTWERCHGRSVPRGALIGGYSADRQPYYIGRSQINGEMVAGKVFEPHGCAYFPWGGQEHRSNEFEIL 164          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A267GMN7 (DUF3421 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020417g1 PE=4 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 4.594e-42
Identity = 66/143 (46.15%), Postives = 95/143 (66.43%), Query Frame = 1
Query:  163 QASLSWQPGNNGQVPYNAIQADGGLFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVL 591
            Q +LSW P   GQ+P  AIQ   G+F+ RA+  G++ PGK  +G++  Y SY G+E  +S+YE+LCDT +  FG    W       VP  AL+GG+++  +P YIGR++I+G+M  GK+ + HGCAY P+GGQEHR N +E+L
Sbjct:   20 QVTLSWIPARGGQIPNGAIQVGHGVFVARAQHAGELIPGKASMGHHAAYVSYGGQEHAVSDYEILCDTHMQCFGCNYTWERCHGRSVPRGALIGGYSADRKPYYIGRSQINGEMVAGKVFEPHGCAYFPWGGQEHRSNEFEIL 162          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A267G073 (DUF3421 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007819g1 PE=4 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 1.146e-41
Identity = 66/143 (46.15%), Postives = 94/143 (65.73%), Query Frame = 1
Query:  163 QASLSWQPGNNGQVPYNAIQADGGLFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVL 591
            Q +LSW P   GQ+P  AIQ   G+F+ RA+  G++ PGK  +G+   Y SY G+E  +S+YE+LCDT +  FG    W       VP  AL+GG+++  +P YIGR++I+G+M  GK+ + HGCAY P+GGQEHR N +E+L
Sbjct:   28 QVTLSWIPARGGQIPNGAIQVGHGVFVARAQHAGELIPGKASMGHQAAYVSYGGQEHAVSDYEILCDTHMQCFGCNYTWERCHGRPVPRGALIGGYSADRQPYYIGRSQINGEMVAGKVFEPHGCAYFPWGGQEHRSNEFEIL 170          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000046742.1 (SMESG000046742.1)

HSP 1 Score: 321.242 bits (822), Expect = 1.993e-113
Identity = 155/155 (100.00%), Postives = 155/155 (100.00%), Query Frame = 1
Query:  139 MCSVGSGRQASLSWQPGNNGQVPYNAIQADGGLFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVLCYSN 603
            MCSVGSGRQASLSWQPGNNGQVPYNAIQADGGLFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVLCYSN
Sbjct:    1 MCSVGSGRQASLSWQPGNNGQVPYNAIQADGGLFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVLCYSN 155          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000046710.1 (SMESG000046710.1)

HSP 1 Score: 248.054 bits (632), Expect = 1.658e-84
Identity = 115/155 (74.19%), Postives = 134/155 (86.45%), Query Frame = 1
Query:  139 MCSVGSGRQASLSWQPGNNGQVPYNAIQADGGLFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVLCYSN 603
            M   GSGRQASLSWQPG  GQVPYNAIQAD GL+I R RTGGD+T GK KVG+N+GYF YAG+E+ ISNYEVLCDTGLHVFG E  W HM+NG VP NA+VGGHT+SNEPLYI +ARI+G+MCVGK+CQSHGCA+MPYGG EH+ ++YEVLC+S+
Sbjct:    1 MSRAGSGRQASLSWQPGQYGQVPYNAIQADAGLYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLCFSD 155          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000046697.1 (SMESG000046697.1)

HSP 1 Score: 248.054 bits (632), Expect = 1.658e-84
Identity = 115/155 (74.19%), Postives = 134/155 (86.45%), Query Frame = 1
Query:  139 MCSVGSGRQASLSWQPGNNGQVPYNAIQADGGLFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVLCYSN 603
            M   GSGRQASLSWQPG  GQVPYNAIQAD GL+I R RTGGD+T GK KVG+N+GYF YAG+E+ ISNYEVLCDTGLHVFG E  W HM+NG VP NA+VGGHT+SNEPLYI +ARI+G+MCVGK+CQSHGCA+MPYGG EH+ ++YEVLC+S+
Sbjct:    1 MSRAGSGRQASLSWQPGQYGQVPYNAIQADAGLYIVRTRTGGDLTIGKTKVGHNSGYFPYAGREDSISNYEVLCDTGLHVFGGEHHWQHMANGSVPHNAVVGGHTASNEPLYIAKARINGEMCVGKVCQSHGCAFMPYGGAEHKAHHYEVLCFSD 155          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000046732.1 (SMESG000046732.1)

HSP 1 Score: 239.58 bits (610), Expect = 4.013e-81
Identity = 113/155 (72.90%), Postives = 131/155 (84.52%), Query Frame = 1
Query:  139 MCSVGSGRQASLSWQPGNNGQVPYNAIQADGGLFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVLCYSN 603
            MCSVGSGRQASLSWQPG+NGQVPYNAIQA  G+F+GR+R G DVTPGK+  G+N G+F Y GKEE  SNYEVLCDTGLHVFGPE  WI   NG VPPNA+VGG+TSSNEPLYI R  ++G MCVGK+ QSHGC+++P+GG EHR+ NYEVLCYS+
Sbjct:    1 MCSVGSGRQASLSWQPGSNGQVPYNAIQAGAGVFVGRSRIGADVTPGKVCSGHNVGHFPYGGKEEVCSNYEVLCDTGLHVFGPEISWISAFNGSVPPNAVVGGNTSSNEPLYICRGYVNGSMCVGKVAQSHGCSFLPHGGTEHRVPNYEVLCYSH 155          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000046728.1 (SMESG000046728.1)

HSP 1 Score: 219.164 bits (557), Expect = 4.562e-73
Identity = 97/153 (63.40%), Postives = 120/153 (78.43%), Query Frame = 1
Query:  139 MCSVGSGRQASLSWQPGNNGQVPYNAIQADGGLFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNALVGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEVLCY 597
            M   G GRQA +SW PG  GQ+PYNAI A  G+FI RA+TG DVTPG +++GYN  +F + G+EE I+NYEVLCDTGLHVFGPE +W HM  GCVP  A+VGG+TS+ EPLYI RA ++G++CVGK+CQSH CAYMP   +EHRI NYE+LC+
Sbjct:    1 MSRAGKGRQACVSWLPGQYGQIPYNAISAGDGVFIARAKTGSDVTPGMVRIGYNNAFFPFDGREEFITNYEVLCDTGLHVFGPEIVWKHMGGGCVPSGAIVGGNTSNGEPLYIARAHVNGELCVGKVCQSHKCAYMPNQSKEHRIQNYEILCF 153          
The following BLAST results are available for this feature:
BLAST of DUF3421 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG105273.434e-2941.84gene:FBgn0034583 transcript:FBtr0071541[more]
CG442509.877e-2542.86gene:FBgn0265185 transcript:FBtr0339104[more]
CG442501.009e-2442.86gene:FBgn0265185 transcript:FBtr0339105[more]
CG133214.318e-2441.67gene:FBgn0033787 transcript:FBtr0345371[more]
CG133214.318e-2441.67gene:FBgn0033787 transcript:FBtr0087792[more]
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8H2V33.658e-4246.15DUF3421 domain-containing protein OS=Macrostomum l... [more]
A0A267EA643.674e-4246.15DUF3421 domain-containing protein OS=Macrostomum l... [more]
A0A1I8JBN44.148e-4246.15DUF3421 domain-containing protein OS=Macrostomum l... [more]
A0A267GMN74.594e-4246.15DUF3421 domain-containing protein OS=Macrostomum l... [more]
A0A267G0731.146e-4146.15DUF3421 domain-containing protein OS=Macrostomum l... [more]
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046742.11.993e-113100.00SMESG000046742.1[more]
SMESG000046710.11.658e-8474.19SMESG000046710.1[more]
SMESG000046697.11.658e-8474.19SMESG000046697.1[more]
SMESG000046732.14.013e-8172.90SMESG000046732.1[more]
SMESG000046728.14.562e-7363.40SMESG000046728.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020257 ID=SMED30020257|Name=DUF3421 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=672bp
GCCCGACACAAAGAAATACATACAGTTTGAAGTACACAGAAAAAATGATA
AACAATTTTCATTGGTTGCAATATAATTTGTTTGTACTTATAATGTCTAG
CCAAAAGCCAAATTCAGTAAATATTTATTCGAAAAGCAATGTGTAGTGTT
GGAAGTGGTCGTCAAGCTTCTTTATCATGGCAACCTGGAAATAATGGTCA
AGTTCCTTACAATGCTATTCAAGCTGATGGTGGGTTATTTATTGGAAGAG
CTCGAACTGGCGGTGATGTAACTCCCGGTAAGTTAAAAGTTGGTTATAAC
ACAGGCTATTTTTCTTACGCTGGAAAAGAAGAATGTATTTCTAATTATGA
AGTTTTATGTGATACAGGCCTACATGTTTTTGGTCCAGAAACTATATGGA
TACATATGAGCAATGGATGTGTCCCTCCAAACGCACTTGTTGGTGGACAT
ACTAGCAGTAATGAGCCACTTTACATAGGTAGAGCCCGAATAAGTGGGGA
TATGTGTGTTGGAAAGATTTGTCAATCTCATGGATGTGCTTATATGCCTT
ATGGTGGCCAAGAGCATCGAATCAATAACTATGAAGTTCTATGCTATAGC
AACTAACTTTAAACTTTATATCATATTTGTACTAATTGTTATTATAAACA
AACTTTCGTATTTAAAAAAAAA
back to top

protein sequence of SMED30020257-orf-1

>SMED30020257-orf-1 ID=SMED30020257-orf-1|Name=SMED30020257-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=156bp
MCSVGSGRQASLSWQPGNNGQVPYNAIQADGGLFIGRARTGGDVTPGKLK
VGYNTGYFSYAGKEECISNYEVLCDTGLHVFGPETIWIHMSNGCVPPNAL
VGGHTSSNEPLYIGRARISGDMCVGKICQSHGCAYMPYGGQEHRINNYEV
LCYSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR006616DM9_repeat
IPR024518DUF3421