RAB5 interacting factor

Overview
NameRAB5 interacting factor
Smed IDSMED30020245
Length (bp)882
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RAB5 interacting factor (SMED30020245) t-SNE clustered cells

Violin plots show distribution of expression levels for RAB5 interacting factor (SMED30020245) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RAB5 interacting factor (SMED30020245) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RAB5 interacting factor (SMED30020245) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020245

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30020245h1SMcG0019273 dd_Smed_v4_4780_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020245h1SMcG0019273 dd_Smed_v4_4780_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020245h1SMcG0019273 dd_Smed_v4_4780_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RAB5 interacting factor vs. Ensembl Human
Match: RAB5IF (RAB5 interacting factor [Source:HGNC Symbol;Acc:HGNC:15870])

HSP 1 Score: 103.219 bits (256), Expect = 7.736e-27
Identity = 52/106 (49.06%), Postives = 80/106 (75.47%), Query Frame = 1
Query:  100 VDTFKKAITAKSQWHDKDEFLDVIYWFKQIIGVILGLLWGFIPLKGFLGLVLFAGXXXXXXXXXXXVFQQIDEDDFGGYGDIFKEGFLSAFASFVVVWILIYDMLY 417
            V  + K + + + W DKDEFLDVIYWF+QII V+LG++WG +PL+GFLG+  F  I+  ++YLY S + QIDE+++GG  ++ KEGF+++FA F+V+WI+ Y  ++
Sbjct:   22 VSVWSKVLRSDAAWEDKDEFLDVIYWFRQIIAVVLGVIWGVLPLRGFLGIAGFCLINAGVLYLYFSNYLQIDEEEYGGTWELTKEGFMTSFALFMVIWIIFYTAIH 127          
BLAST of RAB5 interacting factor vs. Ensembl Human
Match: RAB5IF (RAB5 interacting factor [Source:HGNC Symbol;Acc:HGNC:15870])

HSP 1 Score: 95.5153 bits (236), Expect = 7.592e-24
Identity = 49/97 (50.52%), Postives = 73/97 (75.26%), Query Frame = 1
Query:  100 VDTFKKAITAKSQWHDKDEFLDVIYWFKQIIGVILGLLWGFIPLKGFLGLVLFAGXXXXXXXXXXXVFQQIDEDDFGGYGDIFKEGFLSAFASFVVV 390
            V  + K + + + W DKDEFLDVIYWF+QII V+LG++WG +PL+GFLG+  F  I+  ++YLY S + QIDE+++GG  ++ KEGF+++FA F+V 
Sbjct:   22 VSVWSKVLRSDAAWEDKDEFLDVIYWFRQIIAVVLGVIWGVLPLRGFLGIAGFCLINAGVLYLYFSNYLQIDEEEYGGTWELTKEGFMTSFALFMVC 118          
BLAST of RAB5 interacting factor vs. Ensembl Human
Match: TGIF2-RAB5IF (TGIF2-RAB5IF readthrough [Source:HGNC Symbol;Acc:HGNC:44664])

HSP 1 Score: 91.2781 bits (225), Expect = 5.377e-22
Identity = 47/90 (52.22%), Postives = 72/90 (80.00%), Query Frame = 1
Query:  148 KDEFLDVIYWFKQIIGVILGLLWGFIPLKGFLGLVLFAGXXXXXXXXXXXVFQQIDEDDFGGYGDIFKEGFLSAFASFVVVWILIYDMLY 417
            +DEFLDVIYWF+QII V+LG++WG +PL+GFLG+  F  I+  ++YLY S + QIDE+++GG  ++ KEGF+++FA F+V+WI+ Y  ++
Sbjct:   64 QDEFLDVIYWFRQIIAVVLGVIWGVLPLRGFLGIAGFCLINAGVLYLYFSNYLQIDEEEYGGTWELTKEGFMTSFALFMVIWIIFYTAIH 153          
BLAST of RAB5 interacting factor vs. Ensembl Human
Match: RAB5IF (RAB5 interacting factor [Source:HGNC Symbol;Acc:HGNC:15870])

HSP 1 Score: 89.7373 bits (221), Expect = 7.541e-22
Identity = 50/98 (51.02%), Postives = 71/98 (72.45%), Query Frame = 1
Query:   82 KKHSGVVDTFKKAITAKSQWHDKDEFLDVIYWFKQIIGVILGLLWGFIPLKGFLGLVLFAGXXXXXXXXXXXVFQQIDEDDFGGYGDIFKEGFLSAFA 375
            K  SGV    ++A      W DKDEFLDVIYWF+QII V+LG++WG +PL+GFLG+  F  I+  ++YLY S + QIDE+++GG  ++ KEGF+++FA
Sbjct:    6 KSPSGVRCCGRRA------WEDKDEFLDVIYWFRQIIAVVLGVIWGVLPLRGFLGIAGFCLINAGVLYLYFSNYLQIDEEEYGGTWELTKEGFMTSFA 97          
BLAST of RAB5 interacting factor vs. Ensembl Human
Match: RAB5IF (RAB5 interacting factor [Source:HGNC Symbol;Acc:HGNC:15870])

HSP 1 Score: 72.7886 bits (177), Expect = 8.104e-16
Identity = 29/50 (58.00%), Postives = 40/50 (80.00%), Query Frame = 1
Query:  100 VDTFKKAITAKSQWHDKDEFLDVIYWFKQIIGVILGLLWGFIPLKGFLGL 249
            V  + K + + + W DKDEFLDVIYWF+QII V+LG++WG +PL+GFLG+
Sbjct:   22 VSVWSKVLRSDAAWEDKDEFLDVIYWFRQIIAVVLGVIWGVLPLRGFLGI 71          
BLAST of RAB5 interacting factor vs. Ensembl Celegans
Match: F44E7.9 (pep chromosome:WBcel235:V:5791230:5792122:1 gene:WBGene00018431.1 transcript:F44E7.9.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E7.9)

HSP 1 Score: 96.2857 bits (238), Expect = 1.239e-24
Identity = 45/102 (44.12%), Postives = 71/102 (69.61%), Query Frame = 1
Query:  100 VDTFKKAITAKSQWHDKDEFLDVIYWFKQIIGVILGLLWGFIPLKGFLGLVLFAGXXXXXXXXXXXVFQQIDEDDFGGYGDIFKEGFLSAFASFVVVWILIY 405
             +T  K +T +S+W DKDE LDV+YW KQ+I ++LG ++G   L G L LV + G S ++ + + + FQ++DE++ GG+ ++ KEGF +AFA+F+V WI  Y
Sbjct:   14 TETLAKGLTPRSEWPDKDELLDVVYWGKQVISLLLGFIFGITSLTGVLVLVCYVGTSSVIAHHFVTKFQRVDEEEVGGFWELSKEGFGAAFATFMVTWITTY 115          
BLAST of RAB5 interacting factor vs. Ensembl Fly
Match: CG12107 (gene:FBgn0033209 transcript:FBtr0088924)

HSP 1 Score: 117.472 bits (293), Expect = 1.868e-32
Identity = 64/121 (52.89%), Postives = 90/121 (74.38%), Query Frame = 1
Query:   73 NTMKK--HSGVVDTFK----KAITAKSQWHDKDEFLDVIYWFKQIIGVILGLLWGFIPLKGFLGLVLFAGXXXXXXXXXXXVFQQIDEDDFGGYGDIFKEGFLSAFASFVVVWILIYDMLY 417
            NT+++  HS    T +    +AIT KS+W DK+EFLDVIYW +Q+ G+ LG++WG +PLKGFLGLVLFAGIS  ++YLY+  FQ +DED +GG  ++ KEGF+++FA F+V WI+ Y  L+
Sbjct:    6 NTIERNGHSAKSSTLREICARAIT-KSEWEDKEEFLDVIYWSRQVFGIFLGVIWGIVPLKGFLGLVLFAGISCGIVYLYAINFQNVDEDAYGGVWELIKEGFMTSFAGFLVTWIIFYTGLH 125          
BLAST of RAB5 interacting factor vs. Ensembl Zebrafish
Match: rab5if (RAB5 interacting factor [Source:ZFIN;Acc:ZDB-GENE-030131-5938])

HSP 1 Score: 114.775 bits (286), Expect = 1.537e-31
Identity = 56/105 (53.33%), Postives = 83/105 (79.05%), Query Frame = 1
Query:  103 DTFKKAITAKSQWHDKDEFLDVIYWFKQIIGVILGLLWGFIPLKGFLGLVLFAGXXXXXXXXXXXVFQQIDEDDFGGYGDIFKEGFLSAFASFVVVWILIYDMLY 417
             T+ KAI+ K+ W +KDEFLDV+YWF+QII +ILG++WG  PLKGFLG+ +F  I+  ++Y+Y S FQQ+DE+++GG  ++ KEGF+++FA F+VVWI+ Y  L+
Sbjct:   21 STWSKAISCKAVWEEKDEFLDVVYWFRQIIAIILGVIWGVAPLKGFLGIAIFCIINAGVLYVYFSSFQQVDEEEYGGTWELTKEGFMTSFALFLVVWIIFYTALH 125          
BLAST of RAB5 interacting factor vs. Ensembl Xenopus
Match: rab5if (RAB5 interacting factor [Source:NCBI gene;Acc:549216])

HSP 1 Score: 110.923 bits (276), Expect = 6.789e-30
Identity = 54/102 (52.94%), Postives = 80/102 (78.43%), Query Frame = 1
Query:  112 KKAITAKSQWHDKDEFLDVIYWFKQIIGVILGLLWGFIPLKGFLGLVLFAGXXXXXXXXXXXVFQQIDEDDFGGYGDIFKEGFLSAFASFVVVWILIYDMLY 417
             KA+   S W DKDEFLDVIYWF+QI+ +ILG++WG +PLKGF+G+++F  I+   +YLY S FQQ+DE+++GG  ++ KEGF+++FA F+VVWI+ Y  ++
Sbjct:   25 SKALRGHSTWEDKDEFLDVIYWFRQILAIILGVIWGVVPLKGFIGIIIFCVINAGALYLYFSSFQQVDEEEYGGTWELTKEGFMTSFALFMVVWIIFYTAIH 126          
BLAST of RAB5 interacting factor vs. Ensembl Mouse
Match: Rab5if (RAB5 interacting factor [Source:MGI Symbol;Acc:MGI:1914638])

HSP 1 Score: 101.293 bits (251), Expect = 2.940e-26
Identity = 51/106 (48.11%), Postives = 80/106 (75.47%), Query Frame = 1
Query:  100 VDTFKKAITAKSQWHDKDEFLDVIYWFKQIIGVILGLLWGFIPLKGFLGLVLFAGXXXXXXXXXXXVFQQIDEDDFGGYGDIFKEGFLSAFASFVVVWILIYDMLY 417
            V  + K + + + W DKDEFLDVIYWF+QII ++LG++WG +PL+GFLG+  F  I+  ++YLY S + QIDE+++GG  ++ KEGF+++FA F+V+WI+ Y  ++
Sbjct:   22 VSVWSKVLRSDAAWDDKDEFLDVIYWFRQIIALVLGVIWGVLPLRGFLGIAGFCLINAGVLYLYFSNYLQIDEEEYGGTWELTKEGFMTSFALFMVIWIIFYTAIH 127          
BLAST of RAB5 interacting factor vs. UniProt/SwissProt
Match: sp|Q9CQT9|RCAF1_MOUSE (Respirasome Complex Assembly Factor 1 OS=Mus musculus OX=10090 GN=Rab5if PE=1 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 2.057e-25
Identity = 51/106 (48.11%), Postives = 80/106 (75.47%), Query Frame = 1
Query:  100 VDTFKKAITAKSQWHDKDEFLDVIYWFKQIIGVILGLLWGFIPLKGFLGLVLFAGXXXXXXXXXXXVFQQIDEDDFGGYGDIFKEGFLSAFASFVVVWILIYDMLY 417
            V  + K + + + W DKDEFLDVIYWF+QII ++LG++WG +PL+GFLG+  F  I+  ++YLY S + QIDE+++GG  ++ KEGF+++FA F+V+WI+ Y  ++
Sbjct:   22 VSVWSKVLRSDAAWDDKDEFLDVIYWFRQIIALVLGVIWGVLPLRGFLGIAGFCLINAGVLYLYFSNYLQIDEEEYGGTWELTKEGFMTSFALFMVIWIIFYTAIH 127          
BLAST of RAB5 interacting factor vs. UniProt/SwissProt
Match: sp|Q9BUV8|RCAF1_HUMAN (Respirasome Complex Assembly Factor 1 OS=Homo sapiens OX=9606 GN=RAB5IF PE=1 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.646e-23
Identity = 49/97 (50.52%), Postives = 73/97 (75.26%), Query Frame = 1
Query:  100 VDTFKKAITAKSQWHDKDEFLDVIYWFKQIIGVILGLLWGFIPLKGFLGLVLFAGXXXXXXXXXXXVFQQIDEDDFGGYGDIFKEGFLSAFASFVVV 390
            V  + K + + + W DKDEFLDVIYWF+QII V+LG++WG +PL+GFLG+  F  I+  ++YLY S + QIDE+++GG  ++ KEGF+++FA F+V 
Sbjct:   22 VSVWSKVLRSDAAWEDKDEFLDVIYWFRQIIAVVLGVIWGVLPLRGFLGIAGFCLINAGVLYLYFSNYLQIDEEEYGGTWELTKEGFMTSFALFMVC 118          
BLAST of RAB5 interacting factor vs. TrEMBL
Match: A0A0L0CBG6 (Uncharacterized protein OS=Lucilia cuprina OX=7375 GN=FF38_11531 PE=4 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 2.035e-32
Identity = 63/111 (56.76%), Postives = 87/111 (78.38%), Query Frame = 1
Query:   85 KHSGVVDTFKKAITAKSQWHDKDEFLDVIYWFKQIIGVILGLLWGFIPLKGFLGLVLFAGXXXXXXXXXXXVFQQIDEDDFGGYGDIFKEGFLSAFASFVVVWILIYDMLY 417
            K S + +   +A+TAKS+W DKDEFLDVIYW +QI G+ILG++WG +PLKGFLGLVLFAGIS  ++Y+Y+  FQ IDE+ +GG  ++ KEGF+++FA F+V WI+ Y  L+
Sbjct:   17 KSSSMKEICNRALTAKSEWPDKDEFLDVIYWSRQIFGIILGVIWGIVPLKGFLGLVLFAGISCAVVYIYAINFQNIDEEAYGGAWELIKEGFMTSFAGFLVTWIIFYTGLH 127          
BLAST of RAB5 interacting factor vs. TrEMBL
Match: W6UE55 (Uncharacterized protein OS=Echinococcus granulosus OX=6210 GN=EGR_05462 PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 9.466e-32
Identity = 57/112 (50.89%), Postives = 88/112 (78.57%), Query Frame = 1
Query:   82 KKHSGVVDTFKKAITAKSQWHDKDEFLDVIYWFKQIIGVILGLLWGFIPLKGFLGLVLFAGXXXXXXXXXXXVFQQIDEDDFGGYGDIFKEGFLSAFASFVVVWILIYDMLY 417
            +  SG++ TF+K+I  +S W DKDEFLD +YW +Q +G+I+G LWG +P+KG LG+  F  I+   +YLY++VFQ++DE+++GGY +I KEG ++ FA+F+VVW+++YDMLY
Sbjct:   46 RSQSGLLATFQKSIRPQSSWTDKDEFLDTVYWMRQFVGLIIGTLWGALPIKGALGISSFFFINCTFVYLYAAVFQRVDEEEYGGYSEIIKEGLMTTFATFLVVWVVVYDMLY 157          
BLAST of RAB5 interacting factor vs. TrEMBL
Match: A0A0K8TNV6 (Putative rab5-interacting protein OS=Tabanus bromius OX=304241 PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 1.465e-31
Identity = 63/116 (54.31%), Postives = 89/116 (76.72%), Query Frame = 1
Query:   70 KNTMKKHSGVVDTFKKAITAKSQWHDKDEFLDVIYWFKQIIGVILGLLWGFIPLKGFLGLVLFAGXXXXXXXXXXXVFQQIDEDDFGGYGDIFKEGFLSAFASFVVVWILIYDMLY 417
            KN   K   +   + +A+TAK++W DK+EFLDVIYW +Q++G+ILG++WG +PLKGFLGLVLFAGIS  ++YLYS  FQ +DE+ +GG  ++ KEGF+++FA F+V WI+ Y  LY
Sbjct:   10 KNGSLKSGSLKSVWCRALTAKAEWPDKEEFLDVIYWSRQVLGIILGVIWGIVPLKGFLGLVLFAGISCGIVYLYSINFQSVDEEAYGGAWELVKEGFMTSFAGFLVTWIIFYTGLY 125          
BLAST of RAB5 interacting factor vs. TrEMBL
Match: A0A068WP73 (Rab5 interacting OS=Echinococcus granulosus OX=6210 GN=EgrG_000075100 PE=4 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 1.671e-31
Identity = 57/111 (51.35%), Postives = 87/111 (78.38%), Query Frame = 1
Query:   85 KHSGVVDTFKKAITAKSQWHDKDEFLDVIYWFKQIIGVILGLLWGFIPLKGFLGLVLFAGXXXXXXXXXXXVFQQIDEDDFGGYGDIFKEGFLSAFASFVVVWILIYDMLY 417
              SG++ TF+K+I  +S W DKDEFLD +YW +Q +G+I+G LWG +P+KG LG+  F  I+   +YLY++VFQ++DE+++GGY +I KEG ++ FA+F+VVW+++YDMLY
Sbjct:   11 SQSGLLATFQKSIRPQSSWTDKDEFLDTVYWMRQFVGLIIGTLWGALPIKGALGISSFFFINCTFVYLYAAVFQRVDEEEYGGYSEIIKEGLMTTFATFLVVWVVVYDMLY 121          
BLAST of RAB5 interacting factor vs. TrEMBL
Match: A0A5K3EIQ0 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 9.863e-31
Identity = 61/121 (50.41%), Postives = 90/121 (74.38%), Query Frame = 1
Query:   67 MKNTMK-KHSG---VVDTFKKAITAKSQWHDKDEFLDVIYWFKQIIGVILGLLWGFIPLKGFLGLVLFAGXXXXXXXXXXXVFQQIDEDDFGGYGDIFKEGFLSAFASFVVVWILIYDMLY 417
            M+ + K KH+    V++T +K+IT +S W DKDEFLDVIYW +QI+G+I G+ WG +PL+G   + LF  ++   +YLYSSVFQ+IDE++ GGYG+I KEG ++ FA+F++VWI+ +D  Y
Sbjct:    1 MRESPKSKHAAQLTVLNTLRKSITPQSSWTDKDEFLDVIYWMRQIVGLITGIFWGLLPLRGATAISLFFIVNCSAVYLYSSVFQRIDEEEHGGYGEILKEGLMTTFATFMIVWIVFFDRFY 121          
BLAST of RAB5 interacting factor vs. Ensembl Cavefish
Match: rab5if (RAB5 interacting factor [Source:NCBI gene;Acc:103021550])

HSP 1 Score: 116.701 bits (291), Expect = 2.874e-32
Identity = 57/112 (50.89%), Postives = 90/112 (80.36%), Query Frame = 1
Query:   85 KHSGV-VDTFKKAITAKSQWHDKDEFLDVIYWFKQIIGVILGLLWGFIPLKGFLGLVLFAGXXXXXXXXXXXVFQQIDEDDFGGYGDIFKEGFLSAFASFVVVWILIYDMLY 417
            + +GV ++T+ KA+++K+ W DKDEFLDV+YWF+QII ++LG++WG  PLKGFLG+ +F  I+  ++Y+Y S FQQ+DE+++GG  ++ KEGF+++FA F+VVWI+ Y  L+
Sbjct:   17 QSNGVKLNTWSKAVSSKAVWEDKDEFLDVVYWFRQIIAIVLGIIWGVAPLKGFLGIAIFCVINAGVLYVYFSSFQQVDEEEYGGTWELTKEGFMTSFALFLVVWIIFYTALH 128          
BLAST of RAB5 interacting factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008187.1 (pep scaffold:Pmarinus_7.0:GL481013:25755:27287:-1 gene:ENSPMAG00000007405.1 transcript:ENSPMAT00000008187.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 44.2838 bits (103), Expect = 7.948e-7
Identity = 17/39 (43.59%), Postives = 31/39 (79.49%), Query Frame = 1
Query:  301 FQQIDEDDFGGYGDIFKEGFLSAFASFVVVWILIYDMLY 417
            FQ++DE+++GG  ++ KEGF+++F+ F+VVW + Y  L+
Sbjct:   16 FQKVDEEEYGGTWELTKEGFMTSFSLFLVVWAIFYTALH 54          
BLAST of RAB5 interacting factor vs. Ensembl Nematostella
Match: EDO41626 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S404])

HSP 1 Score: 107.071 bits (266), Expect = 3.860e-29
Identity = 52/105 (49.52%), Postives = 74/105 (70.48%), Query Frame = 1
Query:   73 NTMKKHSGVVDTFKKAITAKSQWHDKDEFLDVIYWFKQIIGVILGLLWGFIPLKGFLGLVLFAGXXXXXXXXXXXVFQQIDEDDFGGYGDIFKEGFLSAFASFVV 387
            N       V DTF+KA+ + S W DK+EFLDVIYW +QI+ V++G+LWG +PLKG   + LF  I+    Y+Y + FQ+IDEDD+GG  ++ KEGF+++FA F+V
Sbjct:   10 NEKNGEYSVSDTFRKALKSGSTWEDKEEFLDVIYWLRQILAVVIGILWGLVPLKGIFAIALFCIINAAAAYVYFNNFQKIDEDDYGGPWELTKEGFMTSFAVFLV 114          
BLAST of RAB5 interacting factor vs. Ensembl Medaka
Match: rab5if (RAB5 interacting factor [Source:NCBI gene;Acc:101160978])

HSP 1 Score: 110.538 bits (275), Expect = 7.123e-30
Identity = 55/105 (52.38%), Postives = 80/105 (76.19%), Query Frame = 1
Query:  103 DTFKKAITAKSQWHDKDEFLDVIYWFKQIIGVILGLLWGFIPLKGFLGLVLFAGXXXXXXXXXXXVFQQIDEDDFGGYGDIFKEGFLSAFASFVVVWILIYDMLY 417
             T+ K   +K+ W +KDEFLDVIYW +QII VILG++WG  PLKGFLG+ +F  I+  ++Y+Y S FQQ+DE+++GG  ++ KEGF+++FA F+VVWI+ Y  L+
Sbjct:   22 STWTKVFNSKAVWEEKDEFLDVIYWLRQIIAVILGVIWGVAPLKGFLGIAIFCVINAGVLYVYFSSFQQVDEEEYGGTWELTKEGFMTSFALFLVVWIIFYTALH 126          
BLAST of RAB5 interacting factor vs. Planmine SMEST
Match: SMESG000026673.1 (SMESG000026673.1)

HSP 1 Score: 212.231 bits (539), Expect = 8.200e-70
Identity = 120/121 (99.17%), Postives = 120/121 (99.17%), Query Frame = 1
Query:   67 MKNTMKKHSGVVDTFKKAITAKSQWHDKDEFLDVIYWFKQIIGVILGLLWGFIPLKGFLGLVLFAGXXXXXXXXXXXVFQQIDEDDFGGYGDIFKEGFLSAFASFVVVWILIYDMLYTFSS 429
            MKNTMKK SGVVDTFKKAITAKSQWHDKDEFLDVIYWFKQIIGVILGLLWGFIPLKGFLGLVLFAGISLLLIYLYSSVFQQIDEDDFGGYGDIFKEGFLSAFASFVVVWILIYDMLYTFSS
Sbjct:    1 MKNTMKKQSGVVDTFKKAITAKSQWHDKDEFLDVIYWFKQIIGVILGLLWGFIPLKGFLGLVLFAGISLLLIYLYSSVFQQIDEDDFGGYGDIFKEGFLSAFASFVVVWILIYDMLYTFSS 121          
The following BLAST results are available for this feature:
BLAST of RAB5 interacting factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB5IF7.736e-2749.06RAB5 interacting factor [Source:HGNC Symbol;Acc:HG... [more]
RAB5IF7.592e-2450.52RAB5 interacting factor [Source:HGNC Symbol;Acc:HG... [more]
TGIF2-RAB5IF5.377e-2252.22TGIF2-RAB5IF readthrough [Source:HGNC Symbol;Acc:H... [more]
RAB5IF7.541e-2251.02RAB5 interacting factor [Source:HGNC Symbol;Acc:HG... [more]
RAB5IF8.104e-1658.00RAB5 interacting factor [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of RAB5 interacting factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
F44E7.91.239e-2444.12pep chromosome:WBcel235:V:5791230:5792122:1 gene:W... [more]
back to top
BLAST of RAB5 interacting factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG121071.868e-3252.89gene:FBgn0033209 transcript:FBtr0088924[more]
back to top
BLAST of RAB5 interacting factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rab5if1.537e-3153.33RAB5 interacting factor [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of RAB5 interacting factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rab5if6.789e-3052.94RAB5 interacting factor [Source:NCBI gene;Acc:5492... [more]
back to top
BLAST of RAB5 interacting factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Rab5if2.940e-2648.11RAB5 interacting factor [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of RAB5 interacting factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q9CQT9|RCAF1_MOUSE2.057e-2548.11Respirasome Complex Assembly Factor 1 OS=Mus muscu... [more]
sp|Q9BUV8|RCAF1_HUMAN3.646e-2350.52Respirasome Complex Assembly Factor 1 OS=Homo sapi... [more]
back to top
BLAST of RAB5 interacting factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L0CBG62.035e-3256.76Uncharacterized protein OS=Lucilia cuprina OX=7375... [more]
W6UE559.466e-3250.89Uncharacterized protein OS=Echinococcus granulosus... [more]
A0A0K8TNV61.465e-3154.31Putative rab5-interacting protein OS=Tabanus bromi... [more]
A0A068WP731.671e-3151.35Rab5 interacting OS=Echinococcus granulosus OX=621... [more]
A0A5K3EIQ09.863e-3150.41Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of RAB5 interacting factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rab5if2.874e-3250.89RAB5 interacting factor [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of RAB5 interacting factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000008187.17.948e-743.59pep scaffold:Pmarinus_7.0:GL481013:25755:27287:-1 ... [more]
back to top
BLAST of RAB5 interacting factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RAB5 interacting factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO416263.860e-2949.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RAB5 interacting factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rab5if7.123e-3052.38RAB5 interacting factor [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of RAB5 interacting factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000026673.18.200e-7099.17SMESG000026673.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020245 ID=SMED30020245|Name=RAB5 interacting factor|organism=Schmidtea mediterranea sexual|type=transcript|length=882bp
TCACGTTTAACTTATTTTTTTAAATAATATTTTGCATTGATGTATTTTAA
TAGCTTTCAATTTTAGATGAAAAATACTATGAAGAAACACAGTGGTGTTG
TGGATACTTTTAAGAAAGCCATAACTGCAAAATCCCAGTGGCACGATAAG
GATGAATTTTTAGATGTGATATATTGGTTTAAGCAAATTATTGGAGTCAT
ATTAGGACTTCTTTGGGGATTTATACCTTTGAAAGGATTTTTAGGACTTG
TTTTATTTGCTGGTATTTCTCTGTTGTTAATATACCTCTACAGTTCTGTA
TTCCAACAGATCGATGAGGATGACTTTGGTGGTTATGGAGATATTTTTAA
AGAAGGATTCTTATCAGCTTTCGCTAGTTTTGTGGTTGTATGGATATTGA
TATACGACATGCTGTACACATTTTCTAGTTAATTATTTTGTGATTTTATA
ATTTTTTTAAATATATATTCTCTGTAATTTTGCATTTATCAGAAGTTGTT
GTCGAAATTGTCTTAGTTATCTCATGGTTTATTGTCGATTTTCTGGTTAA
ATCTGACTTTTTTATGATTTCTAATATTTTATAGATGAAAATTTGGATGT
ATATTTGACATGGCTGAGGTGAATCAAATTTTCCAATTTTTGTTGTATTA
ATATTCATTTTATCAATTATAAAATAATTGCCACTGAATGCCGGTGAGGC
TTGTATTGTTCGTTCATTATGTGATATCTAACTTGAATTTTTTGCACATA
CTTTTCAAATATGTTCTGTTTACATTGGACTTGTAAAAATGAAGTGAATT
ACAACTTTTGAAATAATTAGCATGTTAAAGATAAATTTTGTTGACAACTG
TTTCGCGTTTGGTTGTGATATTTGGACATTGG
back to top

protein sequence of SMED30020245-orf-1

>SMED30020245-orf-1 ID=SMED30020245-orf-1|Name=SMED30020245-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=122bp
MKNTMKKHSGVVDTFKKAITAKSQWHDKDEFLDVIYWFKQIIGVILGLLW
GFIPLKGFLGLVLFAGISLLLIYLYSSVFQQIDEDDFGGYGDIFKEGFLS
AFASFVVVWILIYDMLYTFSS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR010742Rab5ip
IPR029008Rab5IP_fam
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029008Rab5-interacting protein familyPFAMPF07019Rab5ipcoord: 34..113
e-value: 1.0E-15
score: 58.0
NoneNo IPR availablePANTHERPTHR12906:SF0PROTEIN TGIF2-C20ORF24coord: 7..116
NoneNo IPR availableTMHMMTMhelixcoord: 60..82
NoneNo IPR availableTMHMMTMhelixcoord: 34..53
NoneNo IPR availableTMHMMTMhelixcoord: 97..119
IPR010742Rab5-interacting proteinPANTHERPTHR12906PROTEIN C20ORF24 RAB5-INTERACTING PROTEINcoord: 7..116