Slc43a-3

Overview
NameSlc43a-3
Smed IDSMED30020222
Length (bp)911
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Slc43a-3 (SMED30020222) t-SNE clustered cells

Violin plots show distribution of expression levels for Slc43a-3 (SMED30020222) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Slc43a-3 (SMED30020222) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Slc43a-3 (SMED30020222) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020222

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30020222SMESG000043541.1 SmedASXL_067247SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30020222SMESG000043541.1 dd_Smed_v6_17677_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 4 cellSMED30020222SMESG000043541.1 dd_Smed_v4_17677_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Slc43a-3 vs. Ensembl Zebrafish
Match: slc43a3b (solute carrier family 43 member 3b [Source:ZFIN;Acc:ZDB-GENE-060312-28])

HSP 1 Score: 52.7582 bits (125), Expect = 2.181e-7
Identity = 40/157 (25.48%), Postives = 77/157 (49.04%), Query Frame = 1
Query:  259 KSVLFSRFYICHFLYFLVVYFRFSFFLAEIAIELNHHFVFQPQIVYKLLSVISFFFLCSLITSPISGIIIDKLKIQLKSAYKQSWSESKIYFSFANCFVVSQXXXXXXXXXXXXXXXXPNQHMVYLTFLCLSVTRSILFSFGSSYILELFPVKYFSK 729
            KS   S F++ H L+  V+  R   F+  +   LNH     P +V +  +  +F  LC ++ +P +G+++D+ K + +    QS  E+ +  +     ++S  + +   +L S+    P   + YLTF+   + RS L+   +++I   FP  +F K
Sbjct:  273 KSCFLSWFFLWHLLWLSVMQLRHYLFIGTLNPMLNHLTAGDPSLVSRYTNAFAFTQLCGILCAPWNGLLMDRHKGKQREP-GQSEQEADLKAA-----ILSLSLTALQCVLFSVCAATPILPLQYLTFILQVLNRSFLYGGNAAFISVAFPSVHFGK 423          
BLAST of Slc43a-3 vs. Ensembl Zebrafish
Match: slc43a3b (solute carrier family 43 member 3b [Source:ZFIN;Acc:ZDB-GENE-060312-28])

HSP 1 Score: 52.7582 bits (125), Expect = 2.181e-7
Identity = 40/157 (25.48%), Postives = 77/157 (49.04%), Query Frame = 1
Query:  259 KSVLFSRFYICHFLYFLVVYFRFSFFLAEIAIELNHHFVFQPQIVYKLLSVISFFFLCSLITSPISGIIIDKLKIQLKSAYKQSWSESKIYFSFANCFVVSQXXXXXXXXXXXXXXXXPNQHMVYLTFLCLSVTRSILFSFGSSYILELFPVKYFSK 729
            KS   S F++ H L+  V+  R   F+  +   LNH     P +V +  +  +F  LC ++ +P +G+++D+ K + +    QS  E+ +  +     ++S  + +   +L S+    P   + YLTF+   + RS L+   +++I   FP  +F K
Sbjct:  273 KSCFLSWFFLWHLLWLSVMQLRHYLFIGTLNPMLNHLTAGDPSLVSRYTNAFAFTQLCGILCAPWNGLLMDRHKGKQREP-GQSEQEADLKAA-----ILSLSLTALQCVLFSVCAATPILPLQYLTFILQVLNRSFLYGGNAAFISVAFPSVHFGK 423          
BLAST of Slc43a-3 vs. TrEMBL
Match: A0A0H3YFC8 (Slc43a-3 OS=Schmidtea mediterranea OX=79327 GN=slc43a-3 PE=2 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 1.373e-40
Identity = 94/232 (40.52%), Postives = 159/232 (68.53%), Query Frame = 1
Query:  178 QDNAGDATDMGFVKRLELYKTKTYPNLKSVLFSRFYICHFLYFLVVYFRFSFFLAEIAIELNHHFVFQPQIVYKLLSVISFFFLCSLITSPISGIIIDKLKIQLKSAYKQSWSESKIYFSFANCFVVSQXXXXXXXXXXXXXXXXPNQHMVYLTFLCLSVTRSILFSFGSSYILELFPVKYFSKXXXXXXXXXXXXXXXQFLLLFSDLFRLNIVNYILIGFSLATFSYPLYL 873
            +D   +  ++  + +LE    + YP+L+S++FS++Y+     F ++YFRF+FFL ++ ++L+++F  Q  +V  LLS  ++FFLC ++ SPI+GII+D  K         S +E  +Y      FV SQLIC   N+++SI ++IPN  +V++T+LC+++TR+ LFS  S+Y+L+ FP ++F +++GI  L+ G+++ IQ+ +LF+DL+RLNI+N+ILIGFS   F +PLYL
Sbjct:  284 EDGVIEDKELDLMNKLEALTNRMYPDLRSIVFSKYYLFQLGSFTILYFRFTFFLIQLNLQLHYNFPQQRGLVNNLLSRTNYFFLCGILISPIAGIIVDLSKKSFLKKLPNSINEVLLYKRTMKSFVTSQLICCVCNLIVSITVIIPNVALVHVTYLCVTITRAFLFSLNSAYLLQAFPGRFFGQIMGIIVLVAGLMSFIQYAILFNDLYRLNIINFILIGFSCLNFIHPLYL 515          
BLAST of Slc43a-3 vs. TrEMBL
Match: A0A0H3YJL7 (Slc43a-2 OS=Schmidtea mediterranea OX=79327 GN=slc43a-2 PE=2 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 1.093e-30
Identity = 89/220 (40.45%), Postives = 140/220 (63.64%), Query Frame = 1
Query:  214 VKRLELYKTKTYPNLKSVLFSRFYICHFLYFLVVYFRFSFFLAEIAIELNHHFVFQPQIVYKLLSVISFFFLCSLITSPISGIIIDKLKIQLKSAYKQSWSESKIYFSFANCFVVSQXXXXXXXXXXXXXXXXPNQHMVYLTFLCLSVTRSILFSFGSSYILELFPVKYFSKXXXXXXXXXXXXXXXQFLLLFSDLFRLNIVNYILIGFSLATFSYPLYL 873
            +  L  Y+   YP LK +L SR+++   +++++V+FRFSFFLA+++I+L+  FV    +V  LLSV S+FF+ S+  +PISGII+D LK ++K          ++Y +  + F +  +IC   N L++IFI++     +Y+ ++ L+V R+ LF+  +S+IL  FPVKYF  L GI     G+I+ IQ+ LL +DL  LNIVNY+LI  S  TF +P+ L
Sbjct:  263 LASLNAYRDSIYPGLKQILSSRYFLIQLMFYIIVFFRFSFFLAQLSIQLDTGFVSNHNMVLYLLSVSSYFFMTSIGIAPISGIIVDALKARIKPM----TDPVQLYKTTLSTFGIPLIICCVTNELMAIFIVVAENWAIYIAYMSLTVARAFLFTLTASFILTAFPVKYFGMLFGITVTTGGVISFIQYALLINDLTSLNIVNYVLIAISAFTFVHPILL 478          
BLAST of Slc43a-3 vs. TrEMBL
Match: A0A0H3YKJ2 (Slc43a-6 OS=Schmidtea mediterranea OX=79327 GN=slc43a-6 PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 3.230e-27
Identity = 90/233 (38.63%), Postives = 141/233 (60.52%), Query Frame = 1
Query:  175 PQDNAGDATDMGFVKRLELYKTKTYPNLKSVLFSRFYICHFLYFLVVYFRFSFFLAEIAIELNHHFVFQPQIVYKLLSVISFFFLCSLITSPISGIIIDKLKIQLKSAYKQSWSESKIYFSFANCFVVSQXXXXXXXXXXXXXXXXPNQHMVYLTFLCLSVTRSILFSFGSSYILELFPVKYFSKXXXXXXXXXXXXXXXQFLLLFSDLFRLNIVNYILIGFSLATFSYPLYL 873
            PQD      +      L++Y    Y NL S++F+R+Y+ H ++  +++FR  FFL+++ I+L  HF  QP+++  LL + SF F+  +I  P SG I+D LK  L+  Y+       +Y +   CFV+  +ICSF N+++SIFI+IP    VY++F+  ++TRS ++S  S YIL  FP +YF +  G  T + GII+ +Q+ L F D   +NI+NYILIG S   F +P+ L
Sbjct:  219 PQDRLDGPAN------LQVYINSKYHNLTSIVFNRYYLLHIVFTCIIFFRNIFFLSQLNIQLEIHFRGQPKVIEYLLFISSFVFVFGIIAGPFSGAIVDYLKNNLE--YQDKNDSELVYKANLKCFVIPFMICSFMNVIMSIFIMIPQIWAVYMSFIAFTITRSFVYSLYSGYILTAFPKEYFGQASGACTTIWGIISFLQYPLSFKDSMSVNILNYILIGMSCLAFIHPVVL 443          
BLAST of Slc43a-3 vs. TrEMBL
Match: A0A0H3YKI8 (Slc43a-1 OS=Schmidtea mediterranea OX=79327 GN=slc43a-1 PE=2 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 1.099e-21
Identity = 80/232 (34.48%), Postives = 142/232 (61.21%), Query Frame = 1
Query:  178 QDNAGDATDMGFVKRLELYKTKTYPNLKSVLFSRFYICHFLYFLVVYFRFSFFLAEIAIELNHHFVFQPQIVYKLLSVISFFFLCSLITSPISGIIIDKLKIQLKSAYKQSWSESKIYFSFANCFVVSQXXXXXXXXXXXXXXXXPNQHMVYLTFLCLSVTRSILFSFGSSYILELFPVKYFSKXXXXXXXXXXXXXXXQFLLLFSDLFRLNIVNYILIGFSLATFSYPLYL 873
            ++   D+  M  + + E YK   +P +K++L + +++    + ++ +FRFSFFLA++++++  +F         +L V ++FF+ S++ SPI G++ID      K+    S  +   Y S   CF +  LICS  N+ +SI I+IPN+  +Y+ +L  +VTR  +FS  +SYI+  FP KYF KL G+N  + G ++ +Q++LL +++  LN+VN+ILI FS+ +F +P+ L
Sbjct:  244 RNCKSDSYLMTSIMKQENYKNSQFPRMKTILRNHYFLFQLFFMVITFFRFSFFLAQLSVQMEKNFSDDETKAKSILLVGNYFFIPSVVISPIVGLMID----YQKNRVSPSKDQEAFYKSILKCFGIPMLICSLANLSMSILIIIPNEVAMYMAYLACTVTRCFMFSLNASYIISAFPRKYFGKLFGLNITICGCVSFLQYILLLNNICNLNVVNFILIAFSILSFIHPVIL 471          
BLAST of Slc43a-3 vs. TrEMBL
Match: A0A4Z2CQ55 (Solute carrier family 43 member 3 OS=Schistosoma japonicum OX=6182 GN=EWB00_008422 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 3.992e-14
Identity = 65/178 (36.52%), Postives = 101/178 (56.74%), Query Frame = 1
Query:  217 KRLELYKTKTYPNLKSVLFSRFYICHFLYFLVVYFRFSFFLAEIAIELNHHFVFQPQIVYKLLSVISFFFLCSLITSPISGIII--------DKLKIQLKSAYKQSWSESKIYFSFANCFVVSQXXXXXXXXXXXXXXXXPNQHMVYLTFLCLSVTRSILFSFGSSYILELFPVKYFS 726
            K L     + +P LK  +FS  Y    L+FL+  FRF+ FL+++  +L + F    Q+V  LL V S F +C  + +PISG+II        DK+   L ++ K + S  K+Y+++    V + +I S F I+LS  + IPN+  +Y  F+CL + RS+LFS   SY+L  FP++YF 
Sbjct:  242 KELSNVINERFPTLKKCVFSASYALINLWFLLGLFRFAMFLSQLYKQLVYLFPTDQQLVDHLLEVSSVFSMCGFLVAPISGLIIDLSLRRTRDKVANMLINS-KFNLSNKKMYYTYICGLVPALIIMSIFAIILSAMMFIPNKTAIYTAFVCLVIVRSLLFSSFVSYLLTGFPIRYFG 418          
BLAST of Slc43a-3 vs. Ensembl Cavefish
Match: slc43a3b (solute carrier family 43 member 3 [Source:NCBI gene;Acc:103033106])

HSP 1 Score: 52.373 bits (124), Expect = 2.906e-7
Identity = 60/235 (25.53%), Postives = 107/235 (45.53%), Query Frame = 1
Query:  226 ELYKTKTY---PNLKSVLFSRFYICHFLYFLVVYFRFSFFLAEIAIELNHHFVFQPQIVYKLLSVISFFFLCSLITSPISGIIIDKLKIQLKSAYKQSWSESKIYFSFANCFVVSQXXXXXXXXXXXXXXXXPNQHMVYLTFLCLSVTRSILFSFGSSYILELFPVKYFSKXXXXXXXXXXXXXXXQF--LLLFSDLFRLN--IVNYILIGFSLATFSYPLYLRYLNGKHNTHRA 909
            E  KT+T     + KS + S F++ H L+  V+  R   F+  +   LN      P +V    +  +   LC ++ +P +G+I+D+ K   +   ++  SE++     A   ++S  + +   +L S+   IP   + YLTF+   + RS L+   +++I   FP  +F K+ G    L  +++ +Q+    L S   R N   VN  L   S   F +P Y+     +    RA
Sbjct:  264 EASKTETAVTERSFKSCILSWFFLWHLLWLSVMQLRHYLFIGTLNPMLNRLTDGDPALVSTYTNAFAITQLCGILCAPWNGLIMDRHK---RKPREEGQSETEADLKAA---ILSLCLTALQCVLFSLCAAIPVLPLQYLTFILQVLNRSFLYGGNAAFISLAFPPAHFGKVYGTVMALSAVVSLLQYPCFALVSGPLRGNPFAVNVALTILSCLAFIHPFYVYLHCRRQAAERA 492          
BLAST of Slc43a-3 vs. Ensembl Cavefish
Match: slc43a3b (solute carrier family 43 member 3 [Source:NCBI gene;Acc:103033106])

HSP 1 Score: 49.6766 bits (117), Expect = 1.955e-6
Identity = 44/171 (25.73%), Postives = 82/171 (47.95%), Query Frame = 1
Query:  226 ELYKTKTY---PNLKSVLFSRFYICHFLYFLVVYFRFSFFLAEIAIELNHHFVFQPQIVYKLLSVISFFFLCSLITSPISGIIIDKLKIQLKSAYKQSWSESKIYFSFANCFVVSQXXXXXXXXXXXXXXXXPNQHMVYLTFLCLSVTRSILFSFGSSYILELFPVKYFSK 729
            E  KT+T     + KS + S F++ H L+  V+  R   F+  +   LN      P +V    +  +   LC ++ +P +G+I+D+ K   +   ++  SE++     A   ++S  + +   +L S+   IP   + YLTF+   + RS L+   +++I   FP  +F K
Sbjct:  264 EASKTETAVTERSFKSCILSWFFLWHLLWLSVMQLRHYLFIGTLNPMLNRLTDGDPALVSTYTNAFAITQLCGILCAPWNGLIMDRHK---RKPREEGQSETEADLKAA---ILSLCLTALQCVLFSLCAAIPVLPLQYLTFILQVLNRSFLYGGNAAFISLAFPPAHFGK 428          
BLAST of Slc43a-3 vs. Planmine SMEST
Match: SMESG000043541.1 (SMESG000043541.1)

HSP 1 Score: 515.383 bits (1326), Expect = 0.000e+0
Identity = 303/303 (100.00%), Postives = 303/303 (100.00%), Query Frame = 1
Query:    1 DNTGDMFMENLNKTNNNLFTEVDQNHSLHQDNAGDMFMXXXXXXXXXXXXEVDQNHLLPQDNAGDATDMGFVKRLELYKTKTYPNLKSVLFSRFYICHFLYFLVVYFRFSFFLAEIAIELNHHFVFQPQIVYKLLSVISFFFLCSLITSPISGIIIDKLKIQLKSAYKQSWSESKIYFSFANCFVVSQXXXXXXXXXXXXXXXXPNQHMVYLTFLCLSVTRSILFSFGSSYILELFPVKYFSKXXXXXXXXXXXXXXXQFLLLFSDLFRLNIVNYILIGFSLATFSYPLYLRYLNGKHNTHRA 909
            DNTGDMFMENLNKTNNNLFTEVDQNHSLHQDNAGDMFMKNLNKANNNLLAEVDQNHLLPQDNAGDATDMGFVKRLELYKTKTYPNLKSVLFSRFYICHFLYFLVVYFRFSFFLAEIAIELNHHFVFQPQIVYKLLSVISFFFLCSLITSPISGIIIDKLKIQLKSAYKQSWSESKIYFSFANCFVVSQLICSFFNILLSIFILIPNQHMVYLTFLCLSVTRSILFSFGSSYILELFPVKYFSKLLGINTLLLGIITPIQFLLLFSDLFRLNIVNYILIGFSLATFSYPLYLRYLNGKHNTHRA
Sbjct:  237 DNTGDMFMENLNKTNNNLFTEVDQNHSLHQDNAGDMFMKNLNKANNNLLAEVDQNHLLPQDNAGDATDMGFVKRLELYKTKTYPNLKSVLFSRFYICHFLYFLVVYFRFSFFLAEIAIELNHHFVFQPQIVYKLLSVISFFFLCSLITSPISGIIIDKLKIQLKSAYKQSWSESKIYFSFANCFVVSQLICSFFNILLSIFILIPNQHMVYLTFLCLSVTRSILFSFGSSYILELFPVKYFSKLLGINTLLLGIITPIQFLLLFSDLFRLNIVNYILIGFSLATFSYPLYLRYLNGKHNTHRA 539          
BLAST of Slc43a-3 vs. Planmine SMEST
Match: SMESG000043542.1 (SMESG000043542.1)

HSP 1 Score: 159.458 bits (402), Expect = 1.083e-46
Identity = 94/232 (40.52%), Postives = 159/232 (68.53%), Query Frame = 1
Query:  178 QDNAGDATDMGFVKRLELYKTKTYPNLKSVLFSRFYICHFLYFLVVYFRFSFFLAEIAIELNHHFVFQPQIVYKLLSVISFFFLCSLITSPISGIIIDKLKIQLKSAYKQSWSESKIYFSFANCFVVSQXXXXXXXXXXXXXXXXPNQHMVYLTFLCLSVTRSILFSFGSSYILELFPVKYFSKXXXXXXXXXXXXXXXQFLLLFSDLFRLNIVNYILIGFSLATFSYPLYL 873
            +D   +  ++  + +LE    + YP+L+S++FS++Y+     F ++YFRF+FFL ++ ++L+++F  Q  +V  LLS  ++FFLC ++ SPI+GII+D  K         S +E  +Y      FV SQLIC   N+++SI ++IPN  +V++T+LC+++TR+ LFS  S+Y+L+ FP ++F +++GI  L+ G+++ IQ+ +LF+DL+RLNI+N+ILIGFS   F +PLYL
Sbjct:   70 EDGVIEDKELDLMNKLEALTNRMYPDLRSIVFSKYYLFQLGSFTILYFRFTFFLIQLNLQLHYNFPQQRGLVNNLLSRTNYFFLCGILISPIAGIIVDLSKKSFLKKLPNSINEVLLYKRTMKSFVTSQLICCVCNLIVSITVIIPNVALVHVTYLCVTITRAFLFSLNSAYLLQAFPGRFFGQIMGIIVLVAGLMSFIQYAILFNDLYRLNIINFILIGFSCLNFIHPLYL 301          
BLAST of Slc43a-3 vs. Planmine SMEST
Match: SMESG000043543.1 (SMESG000043543.1)

HSP 1 Score: 130.183 bits (326), Expect = 3.231e-34
Identity = 89/220 (40.45%), Postives = 140/220 (63.64%), Query Frame = 1
Query:  214 VKRLELYKTKTYPNLKSVLFSRFYICHFLYFLVVYFRFSFFLAEIAIELNHHFVFQPQIVYKLLSVISFFFLCSLITSPISGIIIDKLKIQLKSAYKQSWSESKIYFSFANCFVVSQXXXXXXXXXXXXXXXXPNQHMVYLTFLCLSVTRSILFSFGSSYILELFPVKYFSKXXXXXXXXXXXXXXXQFLLLFSDLFRLNIVNYILIGFSLATFSYPLYL 873
            +  L  Y+   YP LK +L SR+++   +++++V+FRFSFFLA+++I+L+  FV    +V  LLSV S+FF+ S+  +PISGII+D LK ++K          ++Y +  + F +  +IC   N L++IFI++     +Y+ ++ L+V R+ LF+  +S+IL  FPVKYF  L GI     G+I+ IQ+ LL +DL  LNIVNY+LI  S  TF +P+ L
Sbjct:  263 LANLNAYRDSIYPGLKQILSSRYFLIQLMFYIIVFFRFSFFLAQLSIQLDTGFVSNHNMVLYLLSVSSYFFMTSIGIAPISGIIVDALKARIKPM----TDPVQLYKTTLSTFGIPLIICCVTNELMAIFIVVAENWAIYIAYMSLTVARAFLFTLTASFILTAFPVKYFGMLFGITVTTGGVISFIQYALLINDLTSLNIVNYVLIAISAFTFVHPILL 478          
BLAST of Slc43a-3 vs. Planmine SMEST
Match: SMESG000043544.1 (SMESG000043544.1)

HSP 1 Score: 128.257 bits (321), Expect = 1.546e-33
Identity = 88/232 (37.93%), Postives = 142/232 (61.21%), Query Frame = 1
Query:  178 QDNAGDATDMGFVKRLELYKTKTYPNLKSVLFSRFYICHFLYFLVVYFRFSFFLAEIAIELNHHFVFQPQIVYKLLSVISFFFLCSLITSPISGIIIDKLKIQLKSAYKQSWSESKIYFSFANCFVVSQXXXXXXXXXXXXXXXXPNQHMVYLTFLCLSVTRSILFSFGSSYILELFPVKYFSKXXXXXXXXXXXXXXXQFLLLFSDLFRLNIVNYILIGFSLATFSYPLYL 873
            Q +     +   +  L  Y+   YP LK +L SR+++   +++++V+FR SFFLA+++I+L+  F+    +V  LLSV S+FF+ S+  +PISGII+D LK ++K          ++Y +  + F +  +IC   N L++IFI++     +Y+ ++ L+V R+ LF+  +S+IL  FPVKYF  L GI     G+I+ IQ+ LL +DL  LNIVNY+LI  S  TF +P+ L
Sbjct:  251 QASGAVIKEPDILASLNAYRNSIYPGLKQILSSRYFLIQLMFYIIVFFRLSFFLAQLSIQLDTGFISNHNMVLYLLSVSSYFFMTSIGIAPISGIIVDALKARIKPM----TDPVQLYKTTLSTFGIPLIICCVTNELMAIFIVVAENWAIYIAYMSLTVARAFLFTLTASFILTAFPVKYFGMLFGITVTTGGVISFIQYALLINDLTSLNIVNYVLIAISAFTFVHPILL 478          
BLAST of Slc43a-3 vs. Planmine SMEST
Match: SMESG000043557.1 (SMESG000043557.1)

HSP 1 Score: 120.168 bits (300), Expect = 8.982e-31
Identity = 90/233 (38.63%), Postives = 141/233 (60.52%), Query Frame = 1
Query:  175 PQDNAGDATDMGFVKRLELYKTKTYPNLKSVLFSRFYICHFLYFLVVYFRFSFFLAEIAIELNHHFVFQPQIVYKLLSVISFFFLCSLITSPISGIIIDKLKIQLKSAYKQSWSESKIYFSFANCFVVSQXXXXXXXXXXXXXXXXPNQHMVYLTFLCLSVTRSILFSFGSSYILELFPVKYFSKXXXXXXXXXXXXXXXQFLLLFSDLFRLNIVNYILIGFSLATFSYPLYL 873
            PQD      +      L++Y    Y NL S++F+R+Y+ H ++  +++FR  FFL+++ I+L  HF  QP+++  LL + SF F+  +I  P SG I+D LK  L+  Y+       +Y +   CFV+  +ICSF N+++SIFI+IP    VY++F+  ++TRS ++S  S YIL  FP +YF +  G  T + GII+ +Q+ L F D   +NI+NYILIG S   F +P+ L
Sbjct:  219 PQDRLDGPAN------LQVYINSKYHNLTSIVFNRYYLLHIVFTCIIFFRNIFFLSQLNIQLEIHFRGQPKVIEYLLFISSFVFVFGIIAGPFSGAIVDYLKNNLE--YQDKNDSELVYKANLKCFVIPFMICSFMNVIMSIFIMIPQIWAVYMSFIAFTITRSFVYSLYSGYILTAFPKEYFGQASGACTTIWGIISFLQYPLSFKDSMSVNILNYILIGMSCLAFIHPVVL 443          
The following BLAST results are available for this feature:
BLAST of Slc43a-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc43a-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc43a-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc43a-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc43a3b2.181e-725.48solute carrier family 43 member 3b [Source:ZFIN;Ac... [more]
slc43a3b2.181e-725.48solute carrier family 43 member 3b [Source:ZFIN;Ac... [more]
back to top
BLAST of Slc43a-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc43a-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc43a-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc43a-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFC81.373e-4040.52Slc43a-3 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YJL71.093e-3040.45Slc43a-2 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YKJ23.230e-2738.63Slc43a-6 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YKI81.099e-2134.48Slc43a-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A4Z2CQ553.992e-1436.52Solute carrier family 43 member 3 OS=Schistosoma j... [more]
back to top
BLAST of Slc43a-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc43a3b2.906e-725.53solute carrier family 43 member 3 [Source:NCBI gen... [more]
slc43a3b1.955e-625.73solute carrier family 43 member 3 [Source:NCBI gen... [more]
back to top
BLAST of Slc43a-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc43a-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc43a-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc43a-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc43a-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043541.10.000e+0100.00SMESG000043541.1[more]
SMESG000043542.11.083e-4640.52SMESG000043542.1[more]
SMESG000043543.13.231e-3440.45SMESG000043543.1[more]
SMESG000043544.11.546e-3337.93SMESG000043544.1[more]
SMESG000043557.18.982e-3138.63SMESG000043557.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020222 ID=SMED30020222|Name=Slc43a-3|organism=Schmidtea mediterranea sexual|type=transcript|length=911bp
GATAACACTGGAGATATGTTCATGGAAAACCTTAATAAAACAAATAACAA
TTTATTCACAGAGGTTGACCAAAACCATTCTCTACATCAGGATAACGCTG
GAGATATGTTCATGAAGAACCTTAATAAAGCAAATAACAATTTATTAGCA
GAGGTTGACCAAAACCATTTGCTACCTCAGGATAACGCTGGAGACGCTAC
AGATATGGGCTTTGTGAAAAGATTAGAACTCTACAAAACGAAAACCTATC
CGAATTTGAAATCAGTTCTCTTCAGTCGATTTTATATCTGTCATTTTCTC
TATTTTCTTGTGGTTTATTTTAGATTTTCATTTTTCTTAGCTGAAATAGC
CATAGAATTGAATCATCATTTCGTCTTTCAACCTCAAATAGTCTACAAGT
TGTTGTCTGTGATAAGTTTCTTTTTCCTTTGTAGTCTCATCACCTCTCCA
ATCTCGGGGATCATAATAGACAAGTTGAAAATTCAACTGAAATCAGCATA
TAAACAGTCATGGAGTGAATCGAAAATCTACTTTTCCTTTGCAAACTGTT
TTGTAGTTTCTCAACTCATTTGTTCCTTCTTTAATATTCTACTGTCAATC
TTCATTCTGATACCAAATCAGCATATGGTTTATTTAACCTTTTTATGTTT
GTCCGTAACTCGCTCGATTTTGTTTTCTTTCGGTTCTTCTTATATTTTGG
AGTTATTTCCAGTCAAATATTTCAGTAAGTTATTAGGAATTAATACTTTA
TTATTAGGAATCATTACTCCCATTCAATTTCTTTTATTATTCAGTGATCT
TTTTAGATTAAACATTGTCAATTATATTTTGATTGGTTTTTCTTTGGCAA
CCTTCTCATACCCTCTATACCTCAGATACTTAAATGGCAAGCACAATACT
CACAGGGCTTG
back to top

protein sequence of SMED30020222-orf-1

>SMED30020222-orf-1 ID=SMED30020222-orf-1|Name=SMED30020222-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=303bp
DNTGDMFMENLNKTNNNLFTEVDQNHSLHQDNAGDMFMKNLNKANNNLLA
EVDQNHLLPQDNAGDATDMGFVKRLELYKTKTYPNLKSVLFSRFYICHFL
YFLVVYFRFSFFLAEIAIELNHHFVFQPQIVYKLLSVISFFFLCSLITSP
ISGIIIDKLKIQLKSAYKQSWSESKIYFSFANCFVVSQLICSFFNILLSI
FILIPNQHMVYLTFLCLSVTRSILFSFGSSYILELFPVKYFSKLLGINTL
LLGIITPIQFLLLFSDLFRLNIVNYILIGFSLATFSYPLYLRYLNGKHNT
HRA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 84..295
e-value: 1.1E-5
score: 26.8
NoneNo IPR availablePANTHERPTHR20772FAMILY NOT NAMEDcoord: 15..298
NoneNo IPR availableTMHMMTMhelixcoord: 272..294
NoneNo IPR availableTMHMMTMhelixcoord: 89..111
NoneNo IPR availableTMHMMTMhelixcoord: 240..262
NoneNo IPR availableTMHMMTMhelixcoord: 176..198
NoneNo IPR availableTMHMMTMhelixcoord: 134..156
NoneNo IPR availableTMHMMTMhelixcoord: 211..233
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 76..293