Sodium/potassium-transporting ATPase subunit alpha

Overview
NameSodium/potassium-transporting ATPase subunit alpha
Smed IDSMED30020220
Length (bp)3220
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sodium/potassium-transporting ATPase subunit alpha (SMED30020220) t-SNE clustered cells

Violin plots show distribution of expression levels for Sodium/potassium-transporting ATPase subunit alpha (SMED30020220) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sodium/potassium-transporting ATPase subunit alpha (SMED30020220) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sodium/potassium-transporting ATPase subunit alpha (SMED30020220) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020220

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30020220SMESG000032753.1 SMESG000017208.1 dd_Smed_v4_3340_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020220SMESG000032753.1 SMESG000017208.1 dd_Smed_v4_3340_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30020220SMESG000032753.1 SMESG000017208.1 dd_Smed_v4_3340_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020220SMESG000032753.1 SMESG000017208.1 dd_Smed_v6_3340_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30020220SMESG000032753.1 SMESG000017208.1 dd_Smed_v6_3340_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30020220SMESG000032753.1 SMESG000017208.1 dd_Smed_v4_3340_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020220SMESG000032753.1 SMESG000017208.1 dd_Smed_v4_3340_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal region of the epidermisSMED30020220SMESG000032753.1 SMESG000017208.1 dd_Smed_v4_3340_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
whole organismSMED30020220SMESG000032753.1 SMESG000017208.1 dd_Smed_v4_3340_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ciliated epithelial cellSMED30020220SMESG000032753.1 SMESG000017208.1 dd_Smed_v4_3340_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Human
Match: ATP1A3 (ATPase Na+/K+ transporting subunit alpha 3 [Source:HGNC Symbol;Acc:HGNC:801])

HSP 1 Score: 1276.54 bits (3302), Expect = 0.000e+0
Identity = 644/985 (65.38%), Postives = 780/985 (79.19%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETND-GDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            ++V    H +++EE+  ++ TD  +GLT  +A   L RDG N+LTP   TPE VKF + L GGFSILLW+GAILCF+AYGIQ GT  D   DNLYLGIVL  VV+ TGCF YYQ+AKSSKIM SF  MVPQ+A V R G  + V  E +VVGD+VE+K GDR+PAD+RII + G KVDN++LTGESEPQ+R+P+CT +N LET NI FFSTN VEGT R VVV TGD TVMGRIA L S L  GKTPI  EIEHFI +I+G+ V LG+ FFI++ +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q G +  +   +W  L  +A LCNRA FK G+++  V KR+ +GDASESALLK  EL+ G     RE N KV E+PFNSTNKYQ+SIHET D  D RYLLVMKGAPERIL+R  TIL+ GKE  +DE  K+ F NAY+E+GG+GERVLGFC Y L E+ FPKGF FD D+VNF      FVGL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+S+VNPR+AKACVIHG+DLK+ TS Q+DEIL+ H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + + +IPL LGTITILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP  D LV  RLIS+ +GQ+G+IQA G FF++FVI+AENGFLP  LVGIR +W++  +NDL+DSYGQ+WTY+QRK +E+TC++A+FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+ +WW  A P+SF +  +DE+RK I+RR+    W  +E
Sbjct:   40 KEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCSTILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPG-GWVEKE 1023          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Human
Match: ATP1A3 (ATPase Na+/K+ transporting subunit alpha 3 [Source:HGNC Symbol;Acc:HGNC:801])

HSP 1 Score: 1275.38 bits (3299), Expect = 0.000e+0
Identity = 644/985 (65.38%), Postives = 780/985 (79.19%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETND-GDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            ++V    H +++EE+  ++ TD  +GLT  +A   L RDG N+LTP   TPE VKF + L GGFSILLW+GAILCF+AYGIQ GT  D   DNLYLGIVL  VV+ TGCF YYQ+AKSSKIM SF  MVPQ+A V R G  + V  E +VVGD+VE+K GDR+PAD+RII + G KVDN++LTGESEPQ+R+P+CT +N LET NI FFSTN VEGT R VVV TGD TVMGRIA L S L  GKTPI  EIEHFI +I+G+ V LG+ FFI++ +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q G +  +   +W  L  +A LCNRA FK G+++  V KR+ +GDASESALLK  EL+ G     RE N KV E+PFNSTNKYQ+SIHET D  D RYLLVMKGAPERIL+R  TIL+ GKE  +DE  K+ F NAY+E+GG+GERVLGFC Y L E+ FPKGF FD D+VNF      FVGL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+S+VNPR+AKACVIHG+DLK+ TS Q+DEIL+ H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + + +IPL LGTITILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP  D LV  RLIS+ +GQ+G+IQA G FF++FVI+AENGFLP  LVGIR +W++  +NDL+DSYGQ+WTY+QRK +E+TC++A+FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+ +WW  A P+SF +  +DE+RK I+RR+    W  +E
Sbjct:   27 KEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCSTILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPG-GWVEKE 1010          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Human
Match: AC010616.1 (novel protein, ATP1A3-RABAC1 readthrough)

HSP 1 Score: 1275 bits (3298), Expect = 0.000e+0
Identity = 642/976 (65.78%), Postives = 777/976 (79.61%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETND-GDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRD 3031
            ++V    H +++EE+  ++ TD  +GLT  +A   L RDG N+LTP   TPE VKF + L GGFSILLW+GAILCF+AYGIQ GT  D   DNLYLGIVL  VV+ TGCF YYQ+AKSSKIM SF  MVPQ+A V R G  + V  E +VVGD+VE+K GDR+PAD+RII + G KVDN++LTGESEPQ+R+P+CT +N LET NI FFSTN VEGT R VVV TGD TVMGRIA L S L  GKTPI  EIEHFI +I+G+ V LG+ FFI++ +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q G +  +   +W  L  +A LCNRA FK G+++  V KR+ +GDASESALLK  EL+ G     RE N KV E+PFNSTNKYQ+SIHET D  D RYLLVMKGAPERIL+R  TIL+ GKE  +DE  K+ F NAY+E+GG+GERVLGFC Y L E+ FPKGF FD D+VNF      FVGL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+S+VNPR+AKACVIHG+DLK+ TS Q+DEIL+ H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + + +IPL LGTITILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP  D LV  RLIS+ +GQ+G+IQA G FF++FVI+AENGFLP  LVGIR +W++  +NDL+DSYGQ+WTY+QRK +E+TC++A+FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+ +WW  A P+SF +  +DE+RK I+RR+
Sbjct:   27 KEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCSTILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRN 1002          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Human
Match: ATP1A3 (ATPase Na+/K+ transporting subunit alpha 3 [Source:HGNC Symbol;Acc:HGNC:801])

HSP 1 Score: 1274.23 bits (3296), Expect = 0.000e+0
Identity = 644/985 (65.38%), Postives = 780/985 (79.19%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETND-GDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            ++V    H +++EE+  ++ TD  +GLT  +A   L RDG N+LTP   TPE VKF + L GGFSILLW+GAILCF+AYGIQ GT  D   DNLYLGIVL  VV+ TGCF YYQ+AKSSKIM SF  MVPQ+A V R G  + V  E +VVGD+VE+K GDR+PAD+RII + G KVDN++LTGESEPQ+R+P+CT +N LET NI FFSTN VEGT R VVV TGD TVMGRIA L S L  GKTPI  EIEHFI +I+G+ V LG+ FFI++ +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q G +  +   +W  L  +A LCNRA FK G+++  V KR+ +GDASESALLK  EL+ G     RE N KV E+PFNSTNKYQ+SIHET D  D RYLLVMKGAPERIL+R  TIL+ GKE  +DE  K+ F NAY+E+GG+GERVLGFC Y L E+ FPKGF FD D+VNF      FVGL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+S+VNPR+AKACVIHG+DLK+ TS Q+DEIL+ H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + + +IPL LGTITILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP  D LV  RLIS+ +GQ+G+IQA G FF++FVI+AENGFLP  LVGIR +W++  +NDL+DSYGQ+WTY+QRK +E+TC++A+FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+ +WW  A P+SF +  +DE+RK I+RR+    W  +E
Sbjct:   38 KEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCSTILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPG-GWVEKE 1021          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Human
Match: ATP1A3 (ATPase Na+/K+ transporting subunit alpha 3 [Source:HGNC Symbol;Acc:HGNC:801])

HSP 1 Score: 1273.46 bits (3294), Expect = 0.000e+0
Identity = 643/978 (65.75%), Postives = 777/978 (79.45%), Query Frame = 2
Query:  128 HIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETND-GDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            H +++EE+  ++ TD  +GLT  +A   L RDG N+LTP   TPE VKF + L GGFSILLW+GAILCF+AYGIQ GT  D   DNLYLGIVL  VV+ TGCF YYQ+AKSSKIM SF  MVPQ+A V R G  + V  E +VVGD+VE+K GDR+PAD+RII + G KVDN++LTGESEPQ+R+P+CT +N LET NI FFSTN VEGT R VVV TGD TVMGRIA L S L  GKTPI  EIEHFI +I+G+ V LG+ FFI++ +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q G +  +   +W  L  +A LCNRA FK G+++  V KR+ +GDASESALLK  EL+ G     RE N KV E+PFNSTNKYQ+SIHET D  D RYLLVMKGAPERIL+R  TIL+ GKE  +DE  K+ F NAY+E+GG+GERVLGFC Y L E+ FPKGF FD D+VNF      FVGL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+S+VNPR+AKACVIHG+DLK+ TS Q+DEIL+ H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + + +IPL LGTITILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP  D LV  RLIS+ +GQ+G+IQA G FF++FVI+AENGFLP  LVGIR +W++  +NDL+DSYGQ+WTY+QRK +E+TC++A+FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+ +WW  A P+SF +  +DE+RK I+RR+    W  +E
Sbjct:    4 HKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCSTILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPG-GWVEKE 980          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Celegans
Match: eat-6 (Sodium/potassium-transporting ATPase subunit alpha [Source:UniProtKB/TrEMBL;Acc:P90735])

HSP 1 Score: 1251.5 bits (3237), Expect = 0.000e+0
Identity = 641/984 (65.14%), Postives = 776/984 (78.86%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            ++V+ D HI+ IEEL AR  T+ + GLT ++A   L ++G N+L+P E TPE +KF K L GGF++LLWVGAILC+IAY +   T +    DNLYLGIVL+ VVV TG F YYQ++KSSKIM SF  MVP  A V R G    V TE LVVGDIVEVK GDR+PAD+R++ + GFKVDN++LTGESEPQSR+P+CT+ N LET NIAFFSTNAVEGT + +V+ TGDNTVMGRIA+L S L TG TPI +EIEHFIH+I+G+ V LGI FFIIAF+LG  WL AV+FLIG+IVANVPEG++ATVTV LTLTAK+MA KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH WY+  I++  T+E Q     K+   S++ L+R+A LCNRA FKAG++D  + +R+C+GDASE ALLK+ EL +G     RE+N K+ E+PFNSTNKYQVSIH+  D    YLLVMKGAPERIL+   TI ++GKE E+ +  +++FN AY+E+GGMGERVLGFCD+ L    FPKGF FD +EVNFPL   RFVGL+SMIDPPR +VPDAVAKCRSAGIKV+MVTGDHPITAKAIAK+VGI S   +T+EDIA+ RG+P+ EVNPREAKA VIHGSDL+EM+  QL EI++YH EIVFARTSPQQKL IVEG Q+QG IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVVG+E+GR IFDNLKKSI Y L   IPEI PFL Y +  IPL LGT+TILCIDLGTDM+PAI+LAYE AES+IM+R+PR+P++D LV  RLISL +GQ+G+IQA   FF +F IMA+NGF+P  L  +R  W++   N++ DSYGQEWTY  RK LEYTC +AYFVS++V QW ++++ KTRRNSL QQGM N  L F + FET LA F+ Y PGL+  L++  LRF+WW  ALPFS  +  +DE+R+F+IRR     W  RE
Sbjct:   15 QEVKMDEHIVPIEELVARLGTNLETGLTRQKAQEVLAKNGPNALSPPETTPEWIKFCKNLFGGFAMLLWVGAILCYIAYSVDYFTMEYPSKDNLYLGIVLMTVVVITGVFQYYQESKSSKIMDSFKNMVPTFALVHRDGQKQQVKTEELVVGDIVEVKGGDRVPADLRVVSAFGFKVDNSSLTGESEPQSRSPDCTNENPLETRNIAFFSTNAVEGTAKGIVIYTGDNTVMGRIAHLASGLDTGMTPIAREIEHFIHLITGVAVFLGISFFIIAFILGYHWLTAVVFLIGIIVANVPEGLIATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWYDETIHECDTTETQTS-QEKRTGASFEALVRIASLCNRAEFKAGQQDTPILRRDCTGDASEIALLKFTELTQGNVIAVREKNKKIAEIPFNSTNKYQVSIHDNGD---HYLLVMKGAPERILDVCSTIFLNGKESELTDKLREDFNTAYLELGGMGERVLGFCDFVLPADKFPKGFKFDVEEVNFPLKNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVVMVTGDHPITAKAIAKSVGIISDGTETVEDIAIRRGIPVEEVNPREAKAAVIHGSDLREMSEDQLAEIIKYHSEIVFARTSPQQKLMIVEGFQKQGQIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVVGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLTYILFGIPLPLGTVTILCIDLGTDMVPAISLAYEEAESDIMKRQPRDPIRDKLVNERLISLAYGQIGMIQASAGFFTYFWIMADNGFMPWDLYQLRAQWDSRAYNNVLDSYGQEWTYANRKILEYTCQTAYFVSIVVVQWADLIISKTRRNSLVQQGMSNWTLNFGLVFETALAWFMCYCPGLDNGLRMYGLRFSWWFCALPFSILIFVYDEIRRFLIRRYPG-GWVERE 993          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Celegans
Match: eat-6 (Sodium/potassium-transporting ATPase subunit alpha [Source:UniProtKB/TrEMBL;Acc:P90735])

HSP 1 Score: 1251.5 bits (3237), Expect = 0.000e+0
Identity = 641/984 (65.14%), Postives = 776/984 (78.86%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            ++V+ D HI+ IEEL AR  T+ + GLT ++A   L ++G N+L+P E TPE +KF K L GGF++LLWVGAILC+IAY +   T +    DNLYLGIVL+ VVV TG F YYQ++KSSKIM SF  MVP  A V R G    V TE LVVGDIVEVK GDR+PAD+R++ + GFKVDN++LTGESEPQSR+P+CT+ N LET NIAFFSTNAVEGT + +V+ TGDNTVMGRIA+L S L TG TPI +EIEHFIH+I+G+ V LGI FFIIAF+LG  WL AV+FLIG+IVANVPEG++ATVTV LTLTAK+MA KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH WY+  I++  T+E Q     K+   S++ L+R+A LCNRA FKAG++D  + +R+C+GDASE ALLK+ EL +G     RE+N K+ E+PFNSTNKYQVSIH+  D    YLLVMKGAPERIL+   TI ++GKE E+ +  +++FN AY+E+GGMGERVLGFCD+ L    FPKGF FD +EVNFPL   RFVGL+SMIDPPR +VPDAVAKCRSAGIKV+MVTGDHPITAKAIAK+VGI S   +T+EDIA+ RG+P+ EVNPREAKA VIHGSDL+EM+  QL EI++YH EIVFARTSPQQKL IVEG Q+QG IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVVG+E+GR IFDNLKKSI Y L   IPEI PFL Y +  IPL LGT+TILCIDLGTDM+PAI+LAYE AES+IM+R+PR+P++D LV  RLISL +GQ+G+IQA   FF +F IMA+NGF+P  L  +R  W++   N++ DSYGQEWTY  RK LEYTC +AYFVS++V QW ++++ KTRRNSL QQGM N  L F + FET LA F+ Y PGL+  L++  LRF+WW  ALPFS  +  +DE+R+F+IRR     W  RE
Sbjct:   15 QEVKMDEHIVPIEELVARLGTNLETGLTRQKAQEVLAKNGPNALSPPETTPEWIKFCKNLFGGFAMLLWVGAILCYIAYSVDYFTMEYPSKDNLYLGIVLMTVVVITGVFQYYQESKSSKIMDSFKNMVPTFALVHRDGQKQQVKTEELVVGDIVEVKGGDRVPADLRVVSAFGFKVDNSSLTGESEPQSRSPDCTNENPLETRNIAFFSTNAVEGTAKGIVIYTGDNTVMGRIAHLASGLDTGMTPIAREIEHFIHLITGVAVFLGISFFIIAFILGYHWLTAVVFLIGIIVANVPEGLIATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWYDETIHECDTTETQTS-QEKRTGASFEALVRIASLCNRAEFKAGQQDTPILRRDCTGDASEIALLKFTELTQGNVIAVREKNKKIAEIPFNSTNKYQVSIHDNGD---HYLLVMKGAPERILDVCSTIFLNGKESELTDKLREDFNTAYLELGGMGERVLGFCDFVLPADKFPKGFKFDVEEVNFPLKNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVVMVTGDHPITAKAIAKSVGIISDGTETVEDIAIRRGIPVEEVNPREAKAAVIHGSDLREMSEDQLAEIIKYHSEIVFARTSPQQKLMIVEGFQKQGQIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVVGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLTYILFGIPLPLGTVTILCIDLGTDMVPAISLAYEEAESDIMKRQPRDPIRDKLVNERLISLAYGQIGMIQASAGFFTYFWIMADNGFMPWDLYQLRAQWDSRAYNNVLDSYGQEWTYANRKILEYTCQTAYFVSIVVVQWADLIISKTRRNSLVQQGMSNWTLNFGLVFETALAWFMCYCPGLDNGLRMYGLRFSWWFCALPFSILIFVYDEIRRFLIRRYPG-GWVERE 993          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Celegans
Match: catp-4 (Sodium/potassium-transporting ATPase subunit alpha [Source:UniProtKB/TrEMBL;Acc:G5EFV6])

HSP 1 Score: 932.939 bits (2410), Expect = 0.000e+0
Identity = 490/986 (49.70%), Postives = 663/986 (67.24%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQD--APMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDS---PTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKG--KTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDI-ALSRGVPISEV-----NPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIR 3025
            +DV  D H I ++ L+ R+ T    G++  EA  RL RDG N+LTP + T + +K   ++ GGF+ LLW  A    + YG+ +  + D   P DN+Y+ I+L  VV  TG F +YQ+ KS  +M SF  M+P K  V R G   ++  + LVVGD+V  + GDR+PAD+R+  + G KVDN++LTGESEPQ+R   CTS N LET N+  FST+ +EG+   +++ TGD T +GRIA LT+ +  G TP+ KEI HFI IIS +  ++GI FFI+A +     L A++F +G++VANVPEG++ TVTV LTLTA KM +K CLVK L+AVETLGSTS ICSDKTGTLTQN MTV H W++ KI D+   P +++  G    + ++S+  L+R A LC+R+ F+  E D  + KR  +GDASE A+++Y E+ +G  +  E+R+  PK+ E+PFNSTNKYQ+SIH  +    + +LVMKGAPE+IL+   T   +G+   + + ++ EF  AY  +G  GERVLGFCD  +    FP GF F+ +E NFP+   RF+GLISMIDPPRP VP+AV  C++AGI+V+MVTGDHPITA+AIA  V I   + +  E + A  +  P S+        +   A VIHG  L  M+   L  ++  + +IVFARTSP QKLQIVE  Q  G IV VTGDGVND+PAL+KADIGIAMGI+G+DVSKQAADMILL+DNFASIV G+E+GR IFDNLKKSI Y L   IPEI PF++Y +  +PL +  I IL IDLGTD+ PAI+ AYE  ES+IM+R PRNPL D LV  RL+  ++ Q+G IQA   F  +FV+M  NG+ P  L+ I E W+N  I+DL+DSYGQ+W+Y+ RK LE  CY  +F +++V QW ++   KTR+NSL  QGM NH L  S+ F   LAIF++ TP +N VL +   R     +ALPF+F++  +DE+R++ IR
Sbjct:   19 KDVVIDDHEIPLDALFKRYTTSEKNGISEAEATNRLNRDGPNALTPPKQTSKWIKLAGSIFGGFNFLLWCAASASAVGYGMDLSMSDDEEVPKDNMYMAIILATVVTVTGLFDFYQNRKSGNLMDSFANMIPPKTLVVRDGATREIEVKDLVVGDLVRFRGGDRVPADLRVTLARGLKVDNSSLTGESEPQTRNMNCTSKNALETKNLCMFSTSVLEGSGEGIIIGTGDRTFVGRIAALTTQVDPGPTPLAKEINHFIKIISIVAFTVGIAFFILALVYEYPPLKAIVFFMGIVVANVPEGIVPTVTVSLTLTAVKMRKKFCLVKKLQAVETLGSTSTICSDKTGTLTQNRMTVTHLWFDGKIKDTEILPPNDHFKGEKKYEKEDSYQKLLRCATLCSRSHFRVPEFDVPLAKRVVNGDASEVAIMRYCEMIRGDGQVDEFRKIMPKIGEIPFNSTNKYQLSIHPMSK--KQNILVMKGAPEKILKLCSTYYQNGETKNVSKKFEKEFQQAYETLGSYGERVLGFCDLEMSTTKFPPGFKFNMEEPNFPIKNLRFLGLISMIDPPRPGVPEAVRVCQNAGIRVVMVTGDHPITARAIANQVHIIEENVQVTEIVNADPKCDPASDEIYGKGRLKPTGAVVIHGEQLTTMSPKTLKAVVTNYHQIVFARTSPAQKLQIVEAFQSVGNIVGVTGDGVNDAPALRKADIGIAMGITGTDVSKQAADMILLNDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFMSYVLFGLPLPMSIIAILMIDLGTDLWPAISFAYEVPESDIMQRAPRNPLYDKLVNKRLVMFSYMQIGAIQACAGFTTYFVLMMSNGWFPQDLLNISEQWDNKYIDDLEDSYGQQWSYESRKALESCCYGTFFFTIVVTQWSDLFASKTRKNSLVMQGMENHVLNTSVIFTCFLAIFVLNTPFVNEVLGVQGFRLEIGFLALPFAFFIGLYDEVRRYFIR 1002          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Celegans
Match: catp-3 (Cation transporting ATPase [Source:UniProtKB/TrEMBL;Acc:O16331])

HSP 1 Score: 533.102 bits (1372), Expect = 5.658e-172
Identity = 370/1026 (36.06%), Postives = 562/1026 (54.78%), Query Frame = 2
Query:  113 VESDSHIITIEELYARFQTD-----PDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWV----GAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEP---QSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIG---VIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQ----------VDESWDLLMRVAILCNRAAFKA------------GEEDKVVWKRE------CSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETN------------DGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIR 3025
            VE   HI  + E +   + D       KGLT +EAA +L+ DG N+L+P    P+ +  ++  +  F  LLWV     A LCF+ Y   +    DA   NLY+GI +V +V       ++++ K  +++ +F  ++P    V R G  I +  E LVVGD+V V+ G ++PAD+RII  + F ++ +++TGE+EP    S+T +  ++ I E+ NIAF  +  V+G    +++ TG+NTV+G+IA+LT      K     EIE F+  I+ + +++  + F I  L+        LF+ G   VI+ANVP+G+  TVT  LT+ A++MA+KN  +K LE ++++G+T++I SDKTGTLT+N MTV   WYNN  Y+S   ENQ   T K+           D     ++ V  +CN+A  +              E D  V+K +       SG+ SE ALL+Y         E R+    V EVPFNS  KY + +  T             + D  ++L++KGAP+ +++   TI IDG  +E++    D+FN AY   G  G RV+GF   +      P    F       P+  + F+G+ +++DPPR   P A+  C+ AGIKV MVTGDH  TA AIA+ +G+   D + + ++  +R V I   N ++    VI G +L  ++  Q D +LE H  IVFART+P+ KL IV   Q++G  V VTGDGVND+PALKKAD+G+AMG++GSDV+KQAAD+ILLDDNF+SIV GIE+GR +FDNL+K+I Y +    PE+VP +       PL L  + IL IDL TD+ PA++LAYEG E++IM + PR   + +LVT  LI+ T+  + I  + G   A+ +    NG  P  L            ++     G     +Q+  +     +A+ ++V+V Q  ++ +  TRR S+F  GM N     ++  +  L     + PG+  V       +  WL+ +    ++  F+E+RKF IR
Sbjct:   38 VEHQMHIAQLSERFFHSKIDIVEPKKSKGLTKQEAAQKLKTDGKNALSP----PKTISNMELFVRQFKNLLWVLMFGAAALCFLTY---IYDPTDAL--NLYVGIFIVAIVFIMCVVSFFEEKKGVEVVRAFQTLMPTSCQVIRDGKEILLNPEELVVGDVVVVRSGCKVPADMRIIACTDFFLETSSITGEAEPLEFHSKTADAKTS-IFESYNIAFNGSFCVDGEGYGIIIRTGENTVIGQIASLTLGQKDKKCKFETEIERFVQFITVMAITMATVIFTIGLLVNGGNDVIRLFVTGFLMVIIANVPQGLPTTVTTELTIIARRMAKKNVFLKKLEKIDSVGATTLIASDKTGTLTKNCMTVTDLWYNNS-YNSARPENQGRTTKKRNLNAINTIGWYDAPLKDILSVICVCNKARIENNLTTKVRPPRVDSELDLTVYKSQPVKEMLISGNPSEVALLRYAS-GMLDAMEVRDSFHVVFEVPFNSVRKYHLILATTEATWAEIDDKKKVNADVEFILMIKGAPDVLIKSCSTINIDGVPMELNGKRMDDFNEAYETFGDEGCRVIGFACKKFRA---PATSTFSIKSNTIPMDNWDFLGMSAIMDPPRDDTPRAIKACKEAGIKVYMVTGDHKSTATAIARQIGMI--DTEEVTNLDHNRQV-IRRTNSQDW--AVITGPELPGLSEKQWDALLE-HRYIVFARTTPEHKLMIVTESQKRGECVTVTGDGVNDAPALKKADVGVAMGLAGSDVAKQAADIILLDDNFSSIVAGIEEGRLLFDNLRKTIAYTMTHMWPELVPVMLNFFFGFPLGLTPVQILSIDLITDIPPAVSLAYEGPEADIMLQPPRK-RETHLVTKGLITYTYLFMSIFISVGGVVAYLLSYYLNGIYPSELAFSSNDHFKVGASNFTTYNGVVLNAEQQVFMAAQAAAAFHIAVVVGQAWHLWMCLTRRVSIFVHGMANIVAILAVIIDLLLICLFTFVPGVQYVFGSQPPPWECWLVPVIVGIWIWIFNELRKFGIR 1041          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Celegans
Match: catp-2 (Cation transporting ATPase [Source:UniProtKB/TrEMBL;Acc:A0A131MBN3])

HSP 1 Score: 513.842 bits (1322), Expect = 1.028e-164
Identity = 352/1024 (34.38%), Postives = 561/1024 (54.79%), Query Frame = 2
Query:  122 DSHIITIEELYARFQ------TDP--DKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWV----GAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSN--NILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIG---VIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVD------ESWDL----LMRVAILCNRAAFKA------------GEEDKVVWK----RECS--GDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETN---------DGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKD-NLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRR 3028
            + H + + +L  +F        DP   +GL+ + AA RLE DG N+L+P    P+++   K  L  F  LLW+     A L  +AY         + + NL +GI ++ ++       ++++ K  +++ +F  ++P    V R G+   +  E LVVGDIV V+ G ++PAD+R+I  + F ++ +++TGE+EP            +I E+ NIAF  +  V+G    +V+ TG+ TV+G+IA++T      K     EI  F+  I+ + + + +I F +   +         F+ G   VI+ANVP+G+  TVT  LT+ A++MA+KN  +K LE ++++G+T++I SDKTGTLT+N MTV   WYNN  Y+S   EN+   T  +        +S+D     L+ V  +CN+A  +              E D  +++    +E +  G+ SE ALL+Y   A     E RE    V E+PFNS  KY + I  TN         + D  +++++KGAPE +++   T+ I+G+  E+D    ++FN AY   G  G RV+GF   +   +       F       P+  + F+G+ +++DPPR   P A+  C++AGIKV MVTGDH  TA AIA+ +G+   D + +  +  ++ + I   N ++    VI GS+L  +T  Q DE+L+ H  IVFART+P+ KL IV   Q++G  V VTGDGVND+PALKKAD+G+AMG++GSDV+KQAAD+ILLDDNF+SIV GIE+GR +FDNL+K+I Y +    PE+VP +       PL L  + IL IDL +D+ PA++LAYEG E++IM + PR   KD +LVT  LI+ T+  + I  + G   A+ +    NG  P  L     ++      +   + G     +Q+  +     +A+ +S+++ Q  ++ +  TRR S+F  G+ N    F++  +  L     + PG+  +       +  WL+ +    ++  F+E+RK  IR+
Sbjct:   38 NEHHLDMRQLSEKFSMSKLDIVDPKVSRGLSKQVAAERLESDGRNALSP----PKVISNWKLFLRQFKNLLWILMFGAAALSLVAY-----IYDPSDLTNLCVGIFIIVIIFVMCIVSFFEEKKGVEVVRAFQSLMPLSCQVIRDGVEQTLNPEELVVGDIVVVRSGCKVPADIRVIACTDFYLETSSITGEAEPLEFNSAMADQKTSIFESYNIAFNGSFCVDGEGYGIVIRTGERTVIGQIASMTLDQKEQKCKFQVEIGRFVKFITVMAIIMAVIIFSVGLGINKGHDVIRYFVTGFLMVIIANVPQGLPTTVTTELTIIARRMAKKNVFLKKLEKIDSVGATTLIASDKTGTLTKNCMTVTDLWYNNS-YNSGRPENRRRSTKTRFSITSNPAQSFDAPLSDLLSVVCVCNKARIENTVTVNRPPPNVDSELDMSMYRIQPVKEMTIVGNPSEVALLRYAS-AMLDAKELRESFQVVFEIPFNSVRKYHL-ILATNKNTWNQVDKNDDVEFVVMIKGAPEVLIKNCSTMNINGESKELDLKRMEDFNEAYEAFGDEGCRVIGFAQKKFRAR---ASTVFSLKSNTVPMEDWDFLGMSAIMDPPRDDTPKAIKACKAAGIKVYMVTGDHKSTATAIARQIGMI--DTEEVSRVDHNQQI-IRRSNSQDW--AVITGSELPALTQKQWDELLQ-HRYIVFARTTPEHKLMIVTESQKRGECVTVTGDGVNDAPALKKADVGVAMGLAGSDVAKQAADIILLDDNFSSIVAGIEEGRLLFDNLRKTIAYTMAHMWPELVPVILNFFFGFPLGLTPVQILSIDLISDIPPAVSLAYEGPEADIMLQPPRK--KDTHLVTKGLITYTYLFMSIFISIGCVCAYLLSYYINGIGPWELAFTASTYFKHGAANFTTAKGVILNEEQQMYMANQAAAAFHISLVLGQAFHLWMCLTRRVSIFAHGLGNIVAIFAVIIDLLLICIFTFVPGVKYIFGSQPPPWQCWLVPIVVGVWIWIFNELRKLGIRK 1038          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Fly
Match: Atpalpha (gene:FBgn0002921 transcript:FBtr0089515)

HSP 1 Score: 1280 bits (3311), Expect = 0.000e+0
Identity = 645/985 (65.48%), Postives = 783/985 (79.49%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETND-GDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            ++++ D H I+ EELY RFQT P+ GL+  +A   LERDG N+LTP + TPE VKF K L GGF++LLW+GAILCF+AY IQ  T+++   DNLYLGIVL  VV+ TG F YYQ++KSSKIM SF  MVPQ A+V R G  + +  E LV+GD+VEVKFGDRIPAD+RII++  FKVDN++LTGESEPQSR  E T  N LET N+AFFSTNAVEGT + VV+  GD+TVMGRIA L S L TG+TPI KEI HFIH+I+G+ V LG+ FF+IAF+LG  WLDAV+FLIG+IVANVPEG+LATVTV LTLTAK+MA KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I ++ T+E+Q G+   +    +  L R+A LCNRA FK G++   + K+E SGDASE+ALLK  ELA G     R+ N K+ EVPFNSTNKYQVSIHET D  DPRYLLVMKGAPERILER  TI I+GKE  +DE  K+ FNNAYME+GG+GERVLGFCD+ L    +P GF F+ D++NFP+   RFVGL+SMIDPPR +VPDAVAKCRSAGIKVIMVTGDHPITAKAIAK+VGI S  N+T+EDIA    +P+SEVNPREAKA V+HG++L++++S QLDEIL YH EIVFARTSPQQKL IVEGCQR GAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFLA+ +  IPL LGT+TILCIDLGTDM+PAI+LAYE AES+IM+R+PR+P +DNLV  RLIS+ +GQ+G+IQA   FF +FVIMAENGFLP +L GIR+ W++  +NDL DSYGQEWTY+ RK LEYTC++A+F+S++V QW ++++ KTRRNS+FQQGM N  L F + FET LA F+ Y PG+   L++  L+  WW  A+PF+  +  +DE R+F +RR+    W  +E
Sbjct:   16 QELDIDFHKISPEELYQRFQTHPENGLSHAKAKENLERDGPNALTPPKQTPEWVKFCKNLFGGFAMLLWIGAILCFVAYSIQASTSEEPADDNLYLGIVLSAVVIVTGIFSYYQESKSSKIMESFKNMVPQFATVIREGEKLTLRAEDLVLGDVVEVKFGDRIPADIRIIEARNFKVDNSSLTGESEPQSRGAEFTHENPLETKNLAFFSTNAVEGTAKGVVISCGDHTVMGRIAGLASGLDTGETPIAKEIHHFIHLITGVAVFLGVTFFVIAFILGYHWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIIEADTTEDQSGVQYDRTSPGFKALSRIATLCNRAEFKGGQDGVPILKKEVSGDASEAALLKCMELALGDVMNIRKRNKKIAEVPFNSTNKYQVSIHETEDTNDPRYLLVMKGAPERILERCSTIFINGKEKVLDEEMKEAFNNAYMELGGLGERVLGFCDFMLPSDKYPNGFKFNTDDINFPIDNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKSVGIISEGNETVEDIAQRLNIPVSEVNPREAKAAVVHGAELRDVSSDQLDEILRYHTEIVFARTSPQQKLIIVEGCQRMGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLAFILCDIPLPLGTVTILCIDLGTDMIPAISLAYEQAESDIMKRQPRDPYRDNLVNRRLISMAYGQIGMIQAAAGFFVYFVIMAENGFLPKKLFGIRKMWDSKAVNDLTDSYGQEWTYRDRKTLEYTCHTAFFISIVVVQWADLIICKTRRNSIFQQGMRNWALNFGLVFETVLAAFLSYCPGMEKGLRMYPLKLVWWFPAIPFALAIFIYDETRRFYLRRNPG-GWLEQE 999          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Fly
Match: Atpalpha (gene:FBgn0002921 transcript:FBtr0089516)

HSP 1 Score: 1279.23 bits (3309), Expect = 0.000e+0
Identity = 645/985 (65.48%), Postives = 782/985 (79.39%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETND-GDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            ++++ D H I+ EELY RFQT P+ GL+  +A   LERDG N+LTP + TPE VKF K L GGF++LLW+GAILCF+AY IQ  T+++   DNLYLGIVL  VV+ TG F YYQ++KSSKIM SF  MVPQ A+V R G  + +  E LV+GD+VEVKFGDRIPAD+RII++  FKVDN++LTGESEPQSR  E T  N LET N+AFFSTNAVEGT + VV+  GD+TVMGRIA L S L TG+TPI KEI HFIH+I+G+ V LG+ FF+IAF+LG  WLDAV+FLIG+IVANVPEG+LATVTV LTLTAK+MA KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I ++ T+E+Q G+   +    +  L R+A LCNRA FK G++   + K+E SGDASE+ALLK  ELA G     R+ N K+ EVPFNSTNKYQVSIHET D  DPRYLLVMKGAPERILER  TI I+GKE  +DE  K+ FNNAYME+GG+GERVLGFCD+ L    +P GF F+ D++NFP+   RFVGL+SMIDPPR +VPDAVAKCRSAGIKVIMVTGDHPITAKAIAK+VGI S  N+T+EDIA    +P+SEVNPREAKA V+HG++L++++S QLDEIL YH EIVFARTSPQQKL IVEGCQR GAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFLA+ +  IPL LGT+TILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP +D LV  RLIS+ +GQ+G+IQA   FF +FVIMAENGFLP +L GIR+ W++  +NDL DSYGQEWTY+ RK LEYTC++A+F+S++V QW ++++ KTRRNS+FQQGM N  L F + FET LA F+ Y PG+   L++  L+  WW  A+PF+  +  +DE R+F +RR+    W  +E
Sbjct:   16 QELDIDFHKISPEELYQRFQTHPENGLSHAKAKENLERDGPNALTPPKQTPEWVKFCKNLFGGFAMLLWIGAILCFVAYSIQASTSEEPADDNLYLGIVLSAVVIVTGIFSYYQESKSSKIMESFKNMVPQFATVIREGEKLTLRAEDLVLGDVVEVKFGDRIPADIRIIEARNFKVDNSSLTGESEPQSRGAEFTHENPLETKNLAFFSTNAVEGTAKGVVISCGDHTVMGRIAGLASGLDTGETPIAKEIHHFIHLITGVAVFLGVTFFVIAFILGYHWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIIEADTTEDQSGVQYDRTSPGFKALSRIATLCNRAEFKGGQDGVPILKKEVSGDASEAALLKCMELALGDVMNIRKRNKKIAEVPFNSTNKYQVSIHETEDTNDPRYLLVMKGAPERILERCSTIFINGKEKVLDEEMKEAFNNAYMELGGLGERVLGFCDFMLPSDKYPNGFKFNTDDINFPIDNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKSVGIISEGNETVEDIAQRLNIPVSEVNPREAKAAVVHGAELRDVSSDQLDEILRYHTEIVFARTSPQQKLIIVEGCQRMGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLAFILCDIPLPLGTVTILCIDLGTDMVPAISLAYETAESDIMKRQPRNPFQDKLVNERLISMAYGQIGMIQAAAGFFVYFVIMAENGFLPKKLFGIRKMWDSKAVNDLTDSYGQEWTYRDRKTLEYTCHTAFFISIVVVQWADLIICKTRRNSIFQQGMRNWALNFGLVFETVLAAFLSYCPGMEKGLRMYPLKLVWWFPAIPFALAIFIYDETRRFYLRRNPG-GWLEQE 999          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Fly
Match: Atpalpha (gene:FBgn0002921 transcript:FBtr0089514)

HSP 1 Score: 1279.23 bits (3309), Expect = 0.000e+0
Identity = 645/985 (65.48%), Postives = 782/985 (79.39%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETND-GDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            ++++ D H I+ EELY RFQT P+ GL+  +A   LERDG N+LTP + TPE VKF K L GGF++LLW+GAILCF+AY IQ  T+++   DNLYLGIVL  VV+ TG F YYQ++KSSKIM SF  MVPQ A+V R G  + +  E LV+GD+VEVKFGDRIPAD+RII++  FKVDN++LTGESEPQSR  E T  N LET N+AFFSTNAVEGT + VV+  GD+TVMGRIA L S L TG+TPI KEI HFIH+I+G+ V LG+ FF+IAF+LG  WLDAV+FLIG+IVANVPEG+LATVTV LTLTAK+MA KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I ++ T+E+Q G+   +    +  L R+A LCNRA FK G++   + K+E SGDASE+ALLK  ELA G     R+ N K+ EVPFNSTNKYQVSIHET D  DPRYLLVMKGAPERILER  TI I+GKE  +DE  K+ FNNAYME+GG+GERVLGFCD+ L    +P GF F+ D++NFP+   RFVGL+SMIDPPR +VPDAVAKCRSAGIKVIMVTGDHPITAKAIAK+VGI S  N+T+EDIA    +P+SEVNPREAKA V+HG++L++++S QLDEIL YH EIVFARTSPQQKL IVEGCQR GAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFLA+ +  IPL LGT+TILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP +D LV  RLIS+ +GQ+G+IQA   FF +FVIMAENGFLP +L GIR+ W++  +NDL DSYGQEWTY+ RK LEYTC++A+F+S++V QW ++++ KTRRNS+FQQGM N  L F + FET LA F+ Y PG+   L++  L+  WW  A+PF+  +  +DE R+F +RR+    W  +E
Sbjct:   16 QELDIDFHKISPEELYQRFQTHPENGLSHAKAKENLERDGPNALTPPKQTPEWVKFCKNLFGGFAMLLWIGAILCFVAYSIQASTSEEPADDNLYLGIVLSAVVIVTGIFSYYQESKSSKIMESFKNMVPQFATVIREGEKLTLRAEDLVLGDVVEVKFGDRIPADIRIIEARNFKVDNSSLTGESEPQSRGAEFTHENPLETKNLAFFSTNAVEGTAKGVVISCGDHTVMGRIAGLASGLDTGETPIAKEIHHFIHLITGVAVFLGVTFFVIAFILGYHWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIIEADTTEDQSGVQYDRTSPGFKALSRIATLCNRAEFKGGQDGVPILKKEVSGDASEAALLKCMELALGDVMNIRKRNKKIAEVPFNSTNKYQVSIHETEDTNDPRYLLVMKGAPERILERCSTIFINGKEKVLDEEMKEAFNNAYMELGGLGERVLGFCDFMLPSDKYPNGFKFNTDDINFPIDNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKSVGIISEGNETVEDIAQRLNIPVSEVNPREAKAAVVHGAELRDVSSDQLDEILRYHTEIVFARTSPQQKLIIVEGCQRMGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLAFILCDIPLPLGTVTILCIDLGTDMVPAISLAYETAESDIMKRQPRNPFQDKLVNERLISMAYGQIGMIQAAAGFFVYFVIMAENGFLPKKLFGIRKMWDSKAVNDLTDSYGQEWTYRDRKTLEYTCHTAFFISIVVVQWADLIICKTRRNSIFQQGMRNWALNFGLVFETVLAAFLSYCPGMEKGLRMYPLKLVWWFPAIPFALAIFIYDETRRFYLRRNPG-GWLEQE 999          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Fly
Match: Atpalpha (gene:FBgn0002921 transcript:FBtr0300191)

HSP 1 Score: 1278.08 bits (3306), Expect = 0.000e+0
Identity = 645/985 (65.48%), Postives = 782/985 (79.39%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETND-GDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            ++++ D H I+ EELY RFQT P+ GL+  +A   LERDG N+LTP + TPE VKF K L GGF++LLW+GAILCF+AY IQ  T+++   DNLYLGIVL  VV+ TG F YYQ++KSSKIM SF  MVPQ A+V R G  + +  E LV+GD+VEVKFGDRIPAD+RII++  FKVDN++LTGESEPQSR  E T  N LET N+AFFSTNAVEGT + VV+  GD+TVMGRIA L S L TG+TPI KEI HFIH+I+G+ V LG+ FF+IAF+LG  WLDAV+FLIG+IVANVPEG+LATVTV LTLTAK+MA KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I ++ T+E+Q G+   +    +  L R+A LCNRA FK G++   + K+E SGDASE+ALLK  ELA G     R+ N K+ EVPFNSTNKYQVSIHET D  DPRYLLVMKGAPERILER  TI I+GKE  +DE  K+ FNNAYME+GG+GERVLGFCD+ L    +P GF F+ D++NFP+   RFVGL+SMIDPPR +VPDAVAKCRSAGIKVIMVTGDHPITAKAIAK+VGI S  N+T+EDIA    +P+SEVNPREAKA V+HG++L++++S QLDEIL YH EIVFARTSPQQKL IVEGCQR GAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFLA+ +  IPL LGT+TILCIDLGTDM+PAI+LAYEG E++IM+R+PRNP  DNLV  RLIS+ +GQ+G+IQA   FF +FVIMAENGFLP +L GIR+ W++  +NDL DSYGQEWTY+ RK LEYTC++A+F+S++V QW ++++ KTRRNS+FQQGM N  L F + FET LA F+ Y PG+   L++  L+  WW  A+PF+  +  +DE R+F +RR+    W  +E
Sbjct:   16 QELDIDFHKISPEELYQRFQTHPENGLSHAKAKENLERDGPNALTPPKQTPEWVKFCKNLFGGFAMLLWIGAILCFVAYSIQASTSEEPADDNLYLGIVLSAVVIVTGIFSYYQESKSSKIMESFKNMVPQFATVIREGEKLTLRAEDLVLGDVVEVKFGDRIPADIRIIEARNFKVDNSSLTGESEPQSRGAEFTHENPLETKNLAFFSTNAVEGTAKGVVISCGDHTVMGRIAGLASGLDTGETPIAKEIHHFIHLITGVAVFLGVTFFVIAFILGYHWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIIEADTTEDQSGVQYDRTSPGFKALSRIATLCNRAEFKGGQDGVPILKKEVSGDASEAALLKCMELALGDVMNIRKRNKKIAEVPFNSTNKYQVSIHETEDTNDPRYLLVMKGAPERILERCSTIFINGKEKVLDEEMKEAFNNAYMELGGLGERVLGFCDFMLPSDKYPNGFKFNTDDINFPIDNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKSVGIISEGNETVEDIAQRLNIPVSEVNPREAKAAVVHGAELRDVSSDQLDEILRYHTEIVFARTSPQQKLIIVEGCQRMGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLAFILCDIPLPLGTVTILCIDLGTDMIPAISLAYEGPEADIMKRRPRNPEIDNLVNERLISMAYGQIGMIQAAAGFFVYFVIMAENGFLPKKLFGIRKMWDSKAVNDLTDSYGQEWTYRDRKTLEYTCHTAFFISIVVVQWADLIICKTRRNSIFQQGMRNWALNFGLVFETVLAAFLSYCPGMEKGLRMYPLKLVWWFPAIPFALAIFIYDETRRFYLRRNPG-GWLEQE 999          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Fly
Match: Atpalpha (gene:FBgn0002921 transcript:FBtr0089510)

HSP 1 Score: 1276.54 bits (3302), Expect = 0.000e+0
Identity = 644/985 (65.38%), Postives = 781/985 (79.29%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETND-GDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            ++++ D H I+ EELY RFQT P+ GL+  +A   LERDG N+LTP + TPE VKF K L GGF++LLW+GAILCF+AY IQ  T+++   DNLYLGIVL  VV+ TG F YYQ++KSSKIM SF  MVPQ A+V R G  + +  E LV+GD+VEVKFGDRIPAD+RII++  FKVDN++LTGESEPQSR  E T  N LET N+AFFSTNAVEGT + VV+  GD+TVMGRIA L S L TG+TPI KEI HFIH+I+G+ V LG+ FF+IAF+LG  WLDAV+FLIG+IVANVPEG+LATVTV LTLTAK+MA KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I ++ T+E+Q G+   +    +  L R+A LCNRA FK G++   + K+E SGDASE+ALLK  ELA G     R+ N K+ EVPFNSTNKYQVSIHET D  DPRYLLVMKGAPERILER  TI I+GKE  +DE  K+ FNNAYME+GG+GERVLGFCD+ L    +P GF F+ D++NFP+   RFVGL+SMIDPPR +VPDAVAKCRSAGIKVIMVTGDHPITAKAIAK+VGI S  N+T+EDIA    +P+SEVNPREAKA V+HG++L++++S QLDEIL YH EIVFARTSPQQKL IVEGCQR GAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFLA+ +  IPL LGT+TILCIDLGTDM+PAI+LAYE AE++IM+R PR+P  D LV SRLIS+ +GQ+G+IQA   FF +FVIMAENGFLP +L GIR+ W++  +NDL DSYGQEWTY+ RK LEYTC++A+F+S++V QW ++++ KTRRNS+FQQGM N  L F + FET LA F+ Y PG+   L++  L+  WW  A+PF+  +  +DE R+F +RR+    W  +E
Sbjct:   55 QELDIDFHKISPEELYQRFQTHPENGLSHAKAKENLERDGPNALTPPKQTPEWVKFCKNLFGGFAMLLWIGAILCFVAYSIQASTSEEPADDNLYLGIVLSAVVIVTGIFSYYQESKSSKIMESFKNMVPQFATVIREGEKLTLRAEDLVLGDVVEVKFGDRIPADIRIIEARNFKVDNSSLTGESEPQSRGAEFTHENPLETKNLAFFSTNAVEGTAKGVVISCGDHTVMGRIAGLASGLDTGETPIAKEIHHFIHLITGVAVFLGVTFFVIAFILGYHWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIIEADTTEDQSGVQYDRTSPGFKALSRIATLCNRAEFKGGQDGVPILKKEVSGDASEAALLKCMELALGDVMNIRKRNKKIAEVPFNSTNKYQVSIHETEDTNDPRYLLVMKGAPERILERCSTIFINGKEKVLDEEMKEAFNNAYMELGGLGERVLGFCDFMLPSDKYPNGFKFNTDDINFPIDNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKSVGIISEGNETVEDIAQRLNIPVSEVNPREAKAAVVHGAELRDVSSDQLDEILRYHTEIVFARTSPQQKLIIVEGCQRMGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLAFILCDIPLPLGTVTILCIDLGTDMVPAISLAYEHAEADIMKRPPRDPFNDKLVNSRLISMAYGQIGMIQAAAGFFVYFVIMAENGFLPKKLFGIRKMWDSKAVNDLTDSYGQEWTYRDRKTLEYTCHTAFFISIVVVQWADLIICKTRRNSIFQQGMRNWALNFGLVFETVLAAFLSYCPGMEKGLRMYPLKLVWWFPAIPFALAIFIYDETRRFYLRRNPG-GWLEQE 1038          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Zebrafish
Match: atp1a3b (ATPase Na+/K+ transporting subunit alpha 3b [Source:ZFIN;Acc:ZDB-GENE-001212-8])

HSP 1 Score: 1276.92 bits (3303), Expect = 0.000e+0
Identity = 646/985 (65.58%), Postives = 785/985 (79.70%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDG-DPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            ++V    H +++EE+  +FQTD  +GLT+ +A   L RDG N+LTP   TPE VKF + L GGFSILLW+GAILCF+AY IQ  T  D   DNLYLGIVL  VV+ TGCF Y+Q+AKSSKIM SF  MVPQ+A V R G  + +  E +V GD+VEVK GDRIPAD+RII + G KVDN++LTGESEPQ+R+P+CT +N LET NIAFFSTN VEGT R VVV TGD TVMGRIA LTS L TGKTPI KEIEHFIHII+G+ V LG+ FFI+A +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q G +  +   +W  L RVA LCNRA FKAG++   + KR+ +GDASESALLK  EL+ G     RE+N KV E+PFNSTNKYQ+SIHET D  D RYLLVMKGAPERIL+R  TI++ GKE  +DE  K+ F NAY+E+GG+GERVLGFC   + E  +PKGF FD D+VNF      FVGL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+S+VNPR+AKACVIHG+DLK+ +  Q+DE+L  H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGISGSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + +++IPL LGTITILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP++D LV  RLIS+ +GQ+G+IQA G FFA+FVI+AENGFLP  LVGIR +W++  +NDL+DSYGQ+WTY+QRK +E+TC++A+FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+ +WW  A P+SF +  +DE+RK ++RR+    W  +E
Sbjct:   37 KEVPLTEHKMSVEEVCRKFQTDIVQGLTNAKARDFLARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYAIQAATEDDPAGDNLYLGIVLSAVVIITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKMQINAEEVVAGDLVEVKGGDRIPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNIAFFSTNCVEGTARGVVVCTGDRTVMGRIATLTSGLETGKTPIAKEIEHFIHIITGVAVFLGVSFFILAVILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGASFDKSSVTWVALARVAALCNRAVFKAGQDSLPILKRDVAGDASESALLKCIELSSGSVKAMREKNKKVAEIPFNSTNKYQLSIHETEDNNDNRYLLVMKGAPERILDRCSTIMLQGKEQPMDEEMKEAFQNAYLELGGLGERVLGFCHVLMPEDQYPKGFAFDTDDVNFQTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDYSQEQIDEVLRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPMRDKLVNERLISIAYGQIGMIQALGGFFAYFVILAENGFLPSLLVGIRLNWDDRAMNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEVRKLLLRRNPG-GWVEKE 1020          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Zebrafish
Match: atp1a3b (ATPase Na+/K+ transporting subunit alpha 3b [Source:ZFIN;Acc:ZDB-GENE-001212-8])

HSP 1 Score: 1276.92 bits (3303), Expect = 0.000e+0
Identity = 646/985 (65.58%), Postives = 785/985 (79.70%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDG-DPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            ++V    H +++EE+  +FQTD  +GLT+ +A   L RDG N+LTP   TPE VKF + L GGFSILLW+GAILCF+AY IQ  T  D   DNLYLGIVL  VV+ TGCF Y+Q+AKSSKIM SF  MVPQ+A V R G  + +  E +V GD+VEVK GDRIPAD+RII + G KVDN++LTGESEPQ+R+P+CT +N LET NIAFFSTN VEGT R VVV TGD TVMGRIA LTS L TGKTPI KEIEHFIHII+G+ V LG+ FFI+A +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q G +  +   +W  L RVA LCNRA FKAG++   + KR+ +GDASESALLK  EL+ G     RE+N KV E+PFNSTNKYQ+SIHET D  D RYLLVMKGAPERIL+R  TI++ GKE  +DE  K+ F NAY+E+GG+GERVLGFC   + E  +PKGF FD D+VNF      FVGL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+S+VNPR+AKACVIHG+DLK+ +  Q+DE+L  H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGISGSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + +++IPL LGTITILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP++D LV  RLIS+ +GQ+G+IQA G FFA+FVI+AENGFLP  LVGIR +W++  +NDL+DSYGQ+WTY+QRK +E+TC++A+FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+ +WW  A P+SF +  +DE+RK ++RR+    W  +E
Sbjct:   37 KEVPLTEHKMSVEEVCRKFQTDIVQGLTNAKARDFLARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYAIQAATEDDPAGDNLYLGIVLSAVVIITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKMQINAEEVVAGDLVEVKGGDRIPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNIAFFSTNCVEGTARGVVVCTGDRTVMGRIATLTSGLETGKTPIAKEIEHFIHIITGVAVFLGVSFFILAVILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGASFDKSSVTWVALARVAALCNRAVFKAGQDSLPILKRDVAGDASESALLKCIELSSGSVKAMREKNKKVAEIPFNSTNKYQLSIHETEDNNDNRYLLVMKGAPERILDRCSTIMLQGKEQPMDEEMKEAFQNAYLELGGLGERVLGFCHVLMPEDQYPKGFAFDTDDVNFQTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDYSQEQIDEVLRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPMRDKLVNERLISIAYGQIGMIQALGGFFAYFVILAENGFLPSLLVGIRLNWDDRAMNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEVRKLLLRRNPG-GWVEKE 1020          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Zebrafish
Match: atp1a3a (ATPase Na+/K+ transporting subunit alpha 3a [Source:ZFIN;Acc:ZDB-GENE-001212-7])

HSP 1 Score: 1259.59 bits (3258), Expect = 0.000e+0
Identity = 638/985 (64.77%), Postives = 782/985 (79.39%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDP-RYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            ++V    H ++IEE+  ++ TD  +GLT+  AA  L RDG N+LTP   TPE VKF + L GGFSILLW+GAILCF+AY IQ  T  +   DNLYLGIVL  VV+ TGCF Y+Q+AKSSKIM SF  MVPQ+A V R G  + +  E +V GD+VEVK GDRIPAD+RII + G KVDN++LTGESEPQ+R+P+CT +N LET NIAFFSTN VEGT R +VV TGD TVMGRIA LTS L TGKTPI KEIEHFIHII+G+ V LG+ FFI++ +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q G +  +   +W  L RVA LCNRA FKAG+E   + KR+ +GDASESALLK  EL+ G     R++N KV E+PFNSTNKYQ+S+HE ++ +   YLLVMKGAPERIL+R  TIL  GKE  +DE  K+ F NAY+E+GG+GERVLGFC   +    +PKGF FD D++NF      FVGL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+S+VNPR+AKACVIHG+DLK+++  Q+DE+L+ H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGISGSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + +++IPL LGTITILCIDLGTDM+PAI+LAYE AES+IM+R+PRNPL+D LV  RLIS+ +GQ+G+IQA G FF++FVI+AENGFLP  LVGIR +W++   NDL+DSYGQ+WTY+QRK +E+TC++A+FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+ +WW  A P+SF +  +DE+RK I+RR+    W  +E
Sbjct:   37 KEVPLTEHKMSIEEVCRKYNTDIVQGLTNARAAEYLARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYAIQAATEDEPAGDNLYLGIVLSAVVIITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKLQINAEEVVGGDLVEVKGGDRIPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNIAFFSTNCVEGTARGIVVCTGDRTVMGRIATLTSGLETGKTPIAKEIEHFIHIITGVAVFLGVTFFILSIILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGASFDKSSGTWLALARVAALCNRAVFKAGQESLPILKRDVAGDASESALLKCIELSCGSVKAMRDKNKKVAEIPFNSTNKYQLSVHELDESEENHYLLVMKGAPERILDRCSTILQQGKEQPMDEELKEAFQNAYLELGGLGERVLGFCHLVMPGDKYPKGFAFDTDDINFQTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDLSQDQMDEVLKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFILVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPLRDKLVNERLISIAYGQIGMIQALGGFFSYFVILAENGFLPSVLVGIRLNWDDRSNNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPG-GWVEKE 1020          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Zebrafish
Match: atp1a2a (ATPase Na+/K+ transporting subunit alpha 2 [Source:ZFIN;Acc:ZDB-GENE-001212-6])

HSP 1 Score: 1247.65 bits (3227), Expect = 0.000e+0
Identity = 627/973 (64.44%), Postives = 762/973 (78.31%), Query Frame = 2
Query:  113 VESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRD 3031
            V  D H +T++EL  R+  D  +GLT + A   L RDG N+LTP   TPE VKF K L GGFSILLW+GAILCF+AY IQ  T  +   DNLYLG+VL  VV+ TGCF YYQ+AKSS+IM SF  MVPQ+A V R G  + +  E +V GD+VE+K GDR+PAD+RII SSG KVDN++LTGESEPQ+R+PE T  N LET NI+FFSTN VEGT   +V+ TGD+TVMGRIA L S L  G+TPI  EIEHFIHII+G+ + LG+ FFI++ +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q G    +   +W  L RV  LCNRA FKAG+E+  +  R+ +GDASESALLK  E+  G     RE N KV E+PFNSTNKYQ+SIHE  D    +LLVMKGAPERIL+R  TI+I+G+E  ID+ W D F  AYME+GG+GERVLGFC   L    FP+GF FD D+VNFP+    F+GLISMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+S+VNPREAKACV+HGSDLK+M++  LD+IL  H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + + S+PL LGT+TILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP  D LV  RLIS+ +GQ+G+IQA G FF +FVIMAENGFLP  L+GIR  W++  +NDL+D YGQ+WTY+QRK +E+TC++++FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+  WW  A P+S  +  +DE+RKFI+RR+
Sbjct:   34 VSLDDHKLTLDELSTRYGVDLARGLTHKRAMEILARDGPNALTPPPTTPEWVKFCKQLFGGFSILLWIGAILCFLAYSIQAATEDEPVNDNLYLGVVLSAVVIITGCFSYYQEAKSSRIMDSFKNMVPQQALVIRDGEKLQINAEEVVQGDLVEIKGGDRVPADLRIISSSGCKVDNSSLTGESEPQTRSPEFTHENPLETRNISFFSTNCVEGTAHGIVIATGDHTVMGRIATLASGLEVGQTPINMEIEHFIHIITGVAIFLGMSFFILSIILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGCDFDKSSPTWFSLSRVGGLCNRAVFKAGQEEIPIRTRDTAGDASESALLKCVEILSGNVETLRENNRKVAEIPFNSTNKYQLSIHELEDSPTGHLLVMKGAPERILDRCSTIMINGEEFPIDDDWMDAFQGAYMELGGLGERVLGFCHLFLSPSQFPRGFEFDCDDVNFPVNQLCFLGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAERLNIPLSQVNPREAKACVVHGSDLKDMSAEYLDDILRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGITGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIASVPLPLGTVTILCIDLGTDMVPAISLAYESAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFVIMAENGFLPQTLLGIRLDWDDRTVNDLEDGYGQQWTYEQRKIIEFTCHTSFFVSIVVVQWADLIICKTRRNSVFQQGMKNRILIFGLFAETALAAFLSYCPGMDVALRMYPLKIMWWFCAFPYSLLIFVYDEIRKFILRRN 1006          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Zebrafish
Match: atp1a2a (ATPase Na+/K+ transporting subunit alpha 2 [Source:ZFIN;Acc:ZDB-GENE-001212-6])

HSP 1 Score: 1247.65 bits (3227), Expect = 0.000e+0
Identity = 627/973 (64.44%), Postives = 762/973 (78.31%), Query Frame = 2
Query:  113 VESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRD 3031
            V  D H +T++EL  R+  D  +GLT + A   L RDG N+LTP   TPE VKF K L GGFSILLW+GAILCF+AY IQ  T  +   DNLYLG+VL  VV+ TGCF YYQ+AKSS+IM SF  MVPQ+A V R G  + +  E +V GD+VE+K GDR+PAD+RII SSG KVDN++LTGESEPQ+R+PE T  N LET NI+FFSTN VEGT   +V+ TGD+TVMGRIA L S L  G+TPI  EIEHFIHII+G+ + LG+ FFI++ +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q G    +   +W  L RV  LCNRA FKAG+E+  +  R+ +GDASESALLK  E+  G     RE N KV E+PFNSTNKYQ+SIHE  D    +LLVMKGAPERIL+R  TI+I+G+E  ID+ W D F  AYME+GG+GERVLGFC   L    FP+GF FD D+VNFP+    F+GLISMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+S+VNPREAKACV+HGSDLK+M++  LD+IL  H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + + S+PL LGT+TILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP  D LV  RLIS+ +GQ+G+IQA G FF +FVIMAENGFLP  L+GIR  W++  +NDL+D YGQ+WTY+QRK +E+TC++++FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+  WW  A P+S  +  +DE+RKFI+RR+
Sbjct:   34 VSLDDHKLTLDELSTRYGVDLARGLTHKRAMEILARDGPNALTPPPTTPEWVKFCKQLFGGFSILLWIGAILCFLAYSIQAATEDEPVNDNLYLGVVLSAVVIITGCFSYYQEAKSSRIMDSFKNMVPQQALVIRDGEKLQINAEEVVQGDLVEIKGGDRVPADLRIISSSGCKVDNSSLTGESEPQTRSPEFTHENPLETRNISFFSTNCVEGTAHGIVIATGDHTVMGRIATLASGLEVGQTPINMEIEHFIHIITGVAIFLGMSFFILSIILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGCDFDKSSPTWFSLSRVGGLCNRAVFKAGQEEIPIRTRDTAGDASESALLKCVEILSGNVETLRENNRKVAEIPFNSTNKYQLSIHELEDSPTGHLLVMKGAPERILDRCSTIMINGEEFPIDDDWMDAFQGAYMELGGLGERVLGFCHLFLSPSQFPRGFEFDCDDVNFPVNQLCFLGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAERLNIPLSQVNPREAKACVVHGSDLKDMSAEYLDDILRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGITGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIASVPLPLGTVTILCIDLGTDMVPAISLAYESAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFVIMAENGFLPQTLLGIRLDWDDRTVNDLEDGYGQQWTYEQRKIIEFTCHTSFFVSIVVVQWADLIICKTRRNSVFQQGMKNRILIFGLFAETALAAFLSYCPGMDVALRMYPLKIMWWFCAFPYSLLIFVYDEIRKFILRRN 1006          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Xenopus
Match: cdk2 (cyclin-dependent kinase 2 [Source:Xenbase;Acc:XB-GENE-1001990])

HSP 1 Score: 1253.81 bits (3243), Expect = 0.000e+0
Identity = 632/985 (64.16%), Postives = 773/985 (78.48%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTREN 3061
            ++V  D H +++EE+  ++ TD  KGLT+  AA  L +DG N+LTP   TPE VKF + L GGFSILLW+GAILCF+AYGIQ+    +   DNLYLG+VL  VV+ TGCF YYQ+AKSSKIM SF  MVPQ+A V R G  + +  E +VVGD+VE+K GDR+PAD+RII + G KVDN++LTGESEPQ+R+PE T  N LET NI FFSTN VEGT R +V++TGD TVMGRIA L S L  G+TPI  EIEHFIHII+G+ V LG+ FF+++ +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q G T  +   +W  L R+A LCNRA FK G+E   V KR+ +GDASESALLK  EL+ G   + R+ NPKV E+PFNSTNK+Q+SIHE  D    +LLVMKGAPERIL+R  TI++ G E  +DE  KD F NAY E+GG+GERVLGFC   +    F +GF FD DE NFPLT   F+GLISMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+++VNPREAKACV+HGSDLK+MTS QLD++L+ H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + + +IPL LGT+TILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP  D LV  RLIS+ +GQ+G+IQA G FF +FVI+AENGFLP RL+GIR  W++   ND++DSYGQEWTY+QRK +E+TC++A+F S++V QW ++++ KTRRNS+FQQGM N  L F +  ET LA F+ Y PG++  L++  L+ TWW  A P+S  +  +DE+RK I+RRD    W  +E+
Sbjct:   35 KEVAMDDHKLSMEEIGRKYGTDLAKGLTNARAAEVLAQDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQIAMEDEPINDNLYLGVVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVIREGEKLQINAEMVVVGDLVEIKGGDRVPADIRIIIAHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNICFFSTNCVEGTGRGIVINTGDRTVMGRIATLASGLEVGRTPIAMEIEHFIHIITGVAVFLGVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTTFDKRSPTWTALSRIAGLCNRAVFKVGQEKVAVSKRDTAGDASESALLKCIELSCGSVRKLRDRNPKVAEIPFNSTNKFQLSIHEREDSPEGHLLVMKGAPERILDRCSTIMLHGAEQPLDEEMKDAFQNAYFELGGLGERVLGFCHLYIPADKFQRGFKFDTDEPNFPLTDLCFIGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIADRLNIPVNQVNPREAKACVVHGSDLKDMTSEQLDDLLKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRSNNDVEDSYGQEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETALAAFLSYCPGMDVALRMYPLKVTWWFCAFPYSLLIFLYDEVRKLILRRDPG-GWVEKES 1018          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Xenopus
Match: naif1 (nuclear apoptosis inducing factor 1 [Source:Xenbase;Acc:XB-GENE-986890])

HSP 1 Score: 1253.81 bits (3243), Expect = 0.000e+0
Identity = 639/988 (64.68%), Postives = 777/988 (78.64%), Query Frame = 2
Query:  128 HIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIG------LTNKQVDES---WDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETND-GDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTREN 3061
            H IT+EE+  +  TD  +GLT  +AA  L RDG N+LTP   TPE +KF + L GGFSILLW+GAILCF AYGI     ++   DNLYLGIVL  VV+ TGCF YYQ+AKSSKIM SF  MVPQ+A V R G  + +  E +VVGD+VEVK GDR+PAD+RII S G KVDN++LTGESEPQ+R+P+CT  N LET NIAFFSTN VEGT R +VV TGD TVMGRIA L S L  GKTPI KEIEHFIH+I+G+ V LG+ FF+++ +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q         +    D+S   W  L R+A LCNRA FKAG ++  V KR+ +GDASESALLK  EL+ G     RE++ KV E+PFNSTNKYQ+SIHET D  D RYLLVMKGAPERIL+   TILI GKE  +D+  K+ F NAY+E+GG+GERVLGFC Y   E+L PKGF FD +++NF      FVGL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+S+VNPR+AKACVIHG+DLK+M++ Q+DEIL+ H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + + +IPL LGTITILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP  D LV  RLIS+ +GQ+G+IQA G FF++FVI+AENGFLP  L+GIR +W++  +NDL+DSYGQ+WTY+QRK +E+TC++A+FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+ +WW  A P+SF +  +DE+RK I+RR     W  +E+
Sbjct:    4 HKITVEEVCRKLNTDCVQGLTLSKAAEILARDGPNALTPPPTTPEWIKFCRQLFGGFSILLWIGAILCFFAYGILASMEEEPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQLNAEEVVVGDLVEVKGGDRVPADLRIISSHGCKVDNSSLTGESEPQTRSPDCTHENPLETRNIAFFSTNCVEGTARGIVVATGDRTVMGRIATLASGLEVGKTPIAKEIEHFIHLITGVAVFLGVTFFVLSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSAHSYPYYFSISSFDKSSPTWLGLARIAALCNRAVFKAGNDNIPVLKRDVAGDASESALLKCIELSCGSVKAMREKSKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDVCSTILIQGKEQPLDDELKEAFQNAYLELGGLGERVLGFCHYYFPEELHPKGFAFDTEDLNFSTENLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDMSTEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPSHLIGIRLTWDDRSVNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDIALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRHPG-GWVEKES 990          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Xenopus
Match: rab8b (RAB8B, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-480278])

HSP 1 Score: 1247.65 bits (3227), Expect = 0.000e+0
Identity = 634/975 (65.03%), Postives = 778/975 (79.79%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHE-TNDGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRR 3028
            +++  + H ++++EL+ +F TD  +GL++  AA  L RDG N+LTP   TPE VKF + L GGFS+LLW+GAILCF+AYGI   T ++   DNLYLG+VL  VV+ TGCF YYQ+AKSSKIM SF  MVPQ+A V R+G  + +  E +V+GD+VEVK GDRIPADVRII + G KVDN++LTGESEPQ+R+P+ T+ N LET NIAFFSTN VEGT R VVV+TGD TVMGRIA L S L  G+TPI  EIEHFIHII+G+ V LG+ FFI++ +L   WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+ENQ G +  +   +W  L RVA LCNRA F+AG+E+  + KR+ +GDASESALLK  EL  G   + RE+NPKV E+PFNSTNKYQ+S+H+  N  + RY+LVMKGAPERIL+R  TI++ GKE  +DE  KD F NAY+E+GG+GERVLGFC   L +  FP GF FD +EVNFP     FVGLISMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+++VNPR+AKACVIHGSDLK+M   Q+D+IL++H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + V +IPL LGT+TILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP  D LV  RLIS+ +GQ+G+IQA G FF +FVI+AENGFLP  L+GIR +W++   ND++DSYGQ+WTY+QRK +E+TC++A+FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+ TWW  A P+S  +  +DE+RK IIRR
Sbjct:   34 KELTMEDHKLSLDELHRKFGTDMQRGLSTARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAILCFLAYGITAATEEEPTNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKLSINAEDVVLGDLVEVKGGDRIPADVRIISAHGCKVDNSSLTGESEPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGVVVNTGDRTVMGRIATLASGLEGGRTPIAIEIEHFIHIITGVAVFLGVSFFILSLILQYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGASFDKSSPTWTALSRVAGLCNRAVFQAGQENTPILKRDVAGDASESALLKCIELCCGSVRDMREKNPKVAEIPFNSTNKYQLSVHKNANPSESRYILVMKGAPERILDRCSTIVLQGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLALSDDQFPDGFQFDTEEVNFPTENLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVNQVNPRDAKACVIHGSDLKDMAQEQIDDILKHHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIVANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPWTLLGIRVNWDDRWNNDVEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPTWWFCAFPYSLLIFIYDEVRKLIIRR 1008          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Xenopus
Match: rab8b (RAB8B, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-480278])

HSP 1 Score: 1246.88 bits (3225), Expect = 0.000e+0
Identity = 634/975 (65.03%), Postives = 778/975 (79.79%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHE-TNDGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRR 3028
            +++  + H ++++EL+ +F TD  +GL++  AA  L RDG N+LTP   TPE VKF + L GGFS+LLW+GAILCF+AYGI   T ++   DNLYLG+VL  VV+ TGCF YYQ+AKSSKIM SF  MVPQ+A V R+G  + +  E +V+GD+VEVK GDRIPADVRII + G KVDN++LTGESEPQ+R+P+ T+ N LET NIAFFSTN VEGT R VVV+TGD TVMGRIA L S L  G+TPI  EIEHFIHII+G+ V LG+ FFI++ +L   WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+ENQ G +  +   +W  L RVA LCNRA F+AG+E+  + KR+ +GDASESALLK  EL  G   + RE+NPKV E+PFNSTNKYQ+S+H+  N  + RY+LVMKGAPERIL+R  TI++ GKE  +DE  KD F NAY+E+GG+GERVLGFC   L +  FP GF FD +EVNFP     FVGLISMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+++VNPR+AKACVIHGSDLK+M   Q+D+IL++H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + V +IPL LGT+TILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP  D LV  RLIS+ +GQ+G+IQA G FF +FVI+AENGFLP  L+GIR +W++   ND++DSYGQ+WTY+QRK +E+TC++A+FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+ TWW  A P+S  +  +DE+RK IIRR
Sbjct:   37 KELTMEDHKLSLDELHRKFGTDMQRGLSTARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAILCFLAYGITAATEEEPTNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKLSINAEDVVLGDLVEVKGGDRIPADVRIISAHGCKVDNSSLTGESEPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGVVVNTGDRTVMGRIATLASGLEGGRTPIAIEIEHFIHIITGVAVFLGVSFFILSLILQYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGASFDKSSPTWTALSRVAGLCNRAVFQAGQENTPILKRDVAGDASESALLKCIELCCGSVRDMREKNPKVAEIPFNSTNKYQLSVHKNANPSESRYILVMKGAPERILDRCSTIVLQGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLALSDDQFPDGFQFDTEEVNFPTENLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVNQVNPRDAKACVIHGSDLKDMAQEQIDDILKHHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIVANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPWTLLGIRVNWDDRWNNDVEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPTWWFCAFPYSLLIFIYDEVRKLIIRR 1011          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Xenopus
Match: rab8b (RAB8B, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-480278])

HSP 1 Score: 1235.32 bits (3195), Expect = 0.000e+0
Identity = 634/995 (63.72%), Postives = 778/995 (78.19%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHE-TNDGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQ--------------------GAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRR 3028
            +++  + H ++++EL+ +F TD  +GL++  AA  L RDG N+LTP   TPE VKF + L GGFS+LLW+GAILCF+AYGI   T ++   DNLYLG+VL  VV+ TGCF YYQ+AKSSKIM SF  MVPQ+A V R+G  + +  E +V+GD+VEVK GDRIPADVRII + G KVDN++LTGESEPQ+R+P+ T+ N LET NIAFFSTN VEGT R VVV+TGD TVMGRIA L S L  G+TPI  EIEHFIHII+G+ V LG+ FFI++ +L   WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+ENQ G +  +   +W  L RVA LCNRA F+AG+E+  + KR+ +GDASESALLK  EL  G   + RE+NPKV E+PFNSTNKYQ+S+H+  N  + RY+LVMKGAPERIL+R  TI++ GKE  +DE  KD F NAY+E+GG+GERVLGFC   L +  FP GF FD +EVNFP     FVGLISMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+++VNPR+AKACVIHGSDLK+M   Q+D+IL++H EIVFARTSPQQKL IVEGCQRQ                    GAIVAVTGDGVNDSPALKKADIGIAMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + V +IPL LGT+TILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP  D LV  RLIS+ +GQ+G+IQA G FF +FVI+AENGFLP  L+GIR +W++   ND++DSYGQ+WTY+QRK +E+TC++A+FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+ TWW  A P+S  +  +DE+RK IIRR
Sbjct:   65 KELTMEDHKLSLDELHRKFGTDMQRGLSTARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAILCFLAYGITAATEEEPTNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKLSINAEDVVLGDLVEVKGGDRIPADVRIISAHGCKVDNSSLTGESEPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGVVVNTGDRTVMGRIATLASGLEGGRTPIAIEIEHFIHIITGVAVFLGVSFFILSLILQYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGASFDKSSPTWTALSRVAGLCNRAVFQAGQENTPILKRDVAGDASESALLKCIELCCGSVRDMREKNPKVAEIPFNSTNKYQLSVHKNANPSESRYILVMKGAPERILDRCSTIVLQGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLALSDDQFPDGFQFDTEEVNFPTENLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVNQVNPRDAKACVIHGSDLKDMAQEQIDDILKHHTEIVFARTSPQQKLIIVEGCQRQVSSVGLPFPLGSALLLCNIQGAIVAVTGDGVNDSPALKKADIGIAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIVANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPWTLLGIRVNWDDRWNNDVEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPTWWFCAFPYSLLIFIYDEVRKLIIRR 1059          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Mouse
Match: Atp1a3 (ATPase, Na+/K+ transporting, alpha 3 polypeptide [Source:MGI Symbol;Acc:MGI:88107])

HSP 1 Score: 1276.54 bits (3302), Expect = 0.000e+0
Identity = 644/985 (65.38%), Postives = 780/985 (79.19%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETND-GDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            ++V    H +++EE+  ++ TD  +GLT  +A   L RDG N+LTP   TPE VKF + L GGFSILLW+GAILCF+AYGIQ GT  D   DNLYLGIVL  VV+ TGCF YYQ+AKSSKIM SF  MVPQ+A V R G  + V  E +VVGD+VE+K GDR+PAD+RII + G KVDN++LTGESEPQ+R+P+CT +N LET NI FFSTN VEGT R VVV TGD TVMGRIA L S L  GKTPI  EIEHFI +I+G+ V LG+ FFI++ +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q G +  +   +W  L  +A LCNRA FK G+++  V KR+ +GDASESALLK  EL+ G     RE N KV E+PFNSTNKYQ+SIHET D  D RYLLVMKGAPERIL+R  TIL+ GKE  +DE  K+ F NAY+E+GG+GERVLGFC Y L E+ FPKGF FD D+VNF      FVGL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+S+VNPR+AKACVIHG+DLK+ TS Q+DEIL+ H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + + +IPL LGTITILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP  D LV  RLIS+ +GQ+G+IQA G FF++FVI+AENGFLP  LVGIR +W++  +NDL+DSYGQ+WTY+QRK +E+TC++A+FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+ +WW  A P+SF +  +DE+RK I+RR+    W  +E
Sbjct:   40 KEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCATILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPG-GWVEKE 1023          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Mouse
Match: Atp1a3 (ATPase, Na+/K+ transporting, alpha 3 polypeptide [Source:MGI Symbol;Acc:MGI:88107])

HSP 1 Score: 1275 bits (3298), Expect = 0.000e+0
Identity = 642/976 (65.78%), Postives = 777/976 (79.61%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETND-GDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRD 3031
            ++V    H +++EE+  ++ TD  +GLT  +A   L RDG N+LTP   TPE VKF + L GGFSILLW+GAILCF+AYGIQ GT  D   DNLYLGIVL  VV+ TGCF YYQ+AKSSKIM SF  MVPQ+A V R G  + V  E +VVGD+VE+K GDR+PAD+RII + G KVDN++LTGESEPQ+R+P+CT +N LET NI FFSTN VEGT R VVV TGD TVMGRIA L S L  GKTPI  EIEHFI +I+G+ V LG+ FFI++ +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q G +  +   +W  L  +A LCNRA FK G+++  V KR+ +GDASESALLK  EL+ G     RE N KV E+PFNSTNKYQ+SIHET D  D RYLLVMKGAPERIL+R  TIL+ GKE  +DE  K+ F NAY+E+GG+GERVLGFC Y L E+ FPKGF FD D+VNF      FVGL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+S+VNPR+AKACVIHG+DLK+ TS Q+DEIL+ H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + + +IPL LGTITILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP  D LV  RLIS+ +GQ+G+IQA G FF++FVI+AENGFLP  LVGIR +W++  +NDL+DSYGQ+WTY+QRK +E+TC++A+FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+ +WW  A P+SF +  +DE+RK I+RR+
Sbjct:   27 KEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCATILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRN 1002          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Mouse
Match: Atp1a3 (ATPase, Na+/K+ transporting, alpha 3 polypeptide [Source:MGI Symbol;Acc:MGI:88107])

HSP 1 Score: 1274.23 bits (3296), Expect = 0.000e+0
Identity = 644/985 (65.38%), Postives = 780/985 (79.19%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETND-GDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            ++V    H +++EE+  ++ TD  +GLT  +A   L RDG N+LTP   TPE VKF + L GGFSILLW+GAILCF+AYGIQ GT  D   DNLYLGIVL  VV+ TGCF YYQ+AKSSKIM SF  MVPQ+A V R G  + V  E +VVGD+VE+K GDR+PAD+RII + G KVDN++LTGESEPQ+R+P+CT +N LET NI FFSTN VEGT R VVV TGD TVMGRIA L S L  GKTPI  EIEHFI +I+G+ V LG+ FFI++ +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q G +  +   +W  L  +A LCNRA FK G+++  V KR+ +GDASESALLK  EL+ G     RE N KV E+PFNSTNKYQ+SIHET D  D RYLLVMKGAPERIL+R  TIL+ GKE  +DE  K+ F NAY+E+GG+GERVLGFC Y L E+ FPKGF FD D+VNF      FVGL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+S+VNPR+AKACVIHG+DLK+ TS Q+DEIL+ H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + + +IPL LGTITILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP  D LV  RLIS+ +GQ+G+IQA G FF++FVI+AENGFLP  LVGIR +W++  +NDL+DSYGQ+WTY+QRK +E+TC++A+FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+ +WW  A P+SF +  +DE+RK I+RR+    W  +E
Sbjct:   27 KEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCATILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPG-GWVEKE 1010          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Mouse
Match: Atp1a2 (ATPase, Na+/K+ transporting, alpha 2 polypeptide [Source:MGI Symbol;Acc:MGI:88106])

HSP 1 Score: 1267.68 bits (3279), Expect = 0.000e+0
Identity = 636/974 (65.30%), Postives = 766/974 (78.64%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRR 3028
            ++V  D H ++++EL  ++Q D  KGLT++ A   L RDG N+LTP   TPE VKF + L GGFSILLW+GA+LCF+AYGI      +   DNLYLGIVL  VV+ TGCF YYQ+AKSSKIM SF  MVPQ+A V R G  + +  E +VVGD+VEVK GDR+PAD+RII S G KVDN++LTGESEPQ+R+PE T  N LET NI FFSTN VEGT R +V+ TGD TVMGRIA L S L  G+TPI  EIEHFI +I+G+ V LG+ FF+++ +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q G T  +   +W  L R+A LCNRA FKAG+E+  V KR+ +GDASESALLK  EL+ G   + R+ NPKV E+PFNSTNKYQ+SIHE  D    ++LVMKGAPERIL+R  TIL+ GKEI +D+  +D F NAYME+GG+GERVLGFC   L    FP+GF FD DE+NFP     FVGL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+S+VNPREAKACV+HGSDLK+MTS QLDEIL  H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + + +IPL LGT+TILCIDLGTDM+PAI+LAYE AES+IM+R+PRN   D LV  RLIS+ +GQ+G+IQA G FF +FVI+AENGFLP RL+GIR  W++   NDL+DSYGQEWTY+QRK +E+TC++A+F S++V QW ++++ KTRRNS+FQQGM N  L F +  ET LA F+ Y PG+   L++  L+ TWW  A P+S  +  +DE+RK I+RR
Sbjct:   35 KEVAMDDHKLSLDELGRKYQVDLSKGLTNQRAQDILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGALLCFLAYGILAAMEDEPSNDNLYLGIVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVIREGEKMQINAEEVVVGDLVEVKGGDRVPADLRIISSHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNICFFSTNCVEGTARGIVIATGDRTVMGRIATLASGLEVGQTPIAMEIEHFIQLITGVAVFLGVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGATFDKRSPTWTALSRIAGLCNRAVFKAGQENISVSKRDTAGDASESALLKCIELSCGSVRKMRDRNPKVAEIPFNSTNKYQLSIHEREDSPQSHVLVMKGAPERILDRCSTILVQGKEIPLDKEMQDAFQNAYMELGGLGERVLGFCQLNLPSGKFPRGFKFDTDELNFPTEKLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPREAKACVVHGSDLKDMTSEQLDEILRDHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNSQTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRTTNDLEDSYGQEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETALAAFLSYCPGMGVALRMYPLKVTWWFCAFPYSLLIFIYDEVRKLILRR 1008          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Mouse
Match: Atp1a1 (ATPase, Na+/K+ transporting, alpha 1 polypeptide [Source:MGI Symbol;Acc:MGI:88105])

HSP 1 Score: 1263.44 bits (3268), Expect = 0.000e+0
Identity = 633/985 (64.26%), Postives = 787/985 (79.90%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHET-NDGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            ++V  D H ++++EL+ ++ TD  +GLT   AA  L RDG N+LTP   TPE VKF + L GGFS+LLW+GAILCF+AYGI+  T ++ P D+LYLG+VL  VV+ TGCF YYQ+AKSSKIM SF  MVPQ+A V R+G  + +  E +VVGD+VEVK GDRIPAD+RII ++G KVDN++LTGESEPQ+R+P+ T+ N LET NIAFFSTN VEGT R +VV TGD TVMGRIA L S L  G+TPI +EIEHFIH+I+G+ V LG+ FFI++ +L   WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+ENQ G++  +   +W  L R+A LCNRA F+A +E+  + KR  +GDASESALLK  E+  G   E RE+  K++E+PFNSTNKYQ+SIH+  N  +P++LLVMKGAPERIL+R  +IL+ GKE  +DE  KD F NAY+E+GG+GERVLGFC   L ++ FP+GF FD D+VNFP+    FVGLISMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+++VNPR+AKACV+HGSDLK+MTS +LD+IL YH EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGI GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + + +IPL LGT+TILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP  D LV  RLIS+ +GQ+G+IQA G FF +FVI+AENGFLP  L+GIRE+W++  +ND++DSYGQ+WTY+QRK +E+TC++A+FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG+   L++  L+ TWW  A P+S  +  +DE+RK IIRR +   W  +E
Sbjct:   37 KEVSMDDHKLSLDELHRKYGTDLSRGLTPARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAILCFLAYGIRSATEEEPPNDDLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSINAEDVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAEEIEHFIHLITGVAVFLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWFALSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLKCIEVCCGSVMEMREKYSKIVEIPFNSTNKYQLSIHKNPNASEPKHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLLLPDEQFPEGFQFDTDDVNFPVDNLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVNQVNPRDAKACVVHGSDLKDMTSEELDDILRYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIVGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPFHLLGIRETWDDRWVNDVEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMGAALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLIIRR-RPGGWVEKE 1020          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. UniProt/SwissProt
Match: sp|Q6RWA9|AT1A_TAESO (Sodium/potassium-transporting ATPase subunit alpha OS=Taenia solium OX=6204 PE=2 SV=1)

HSP 1 Score: 1332.39 bits (3447), Expect = 0.000e+0
Identity = 668/985 (67.82%), Postives = 800/985 (81.22%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPM-DNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            +++  D H I+++ELYAR  T+PD GLTSE+A  RL+RDG N+LTP + TPE VKF K + GGFS+LLW+GA+LCFIA+GI      +  + DNLYLGIVL  VVV TGCF YYQ++KSSKIM SF K+VPQ A V R G  ID   E LVVGDI++VKFGDR+PAD+R+IK+S FKVDN+ALTGESEPQ+RT E T+ N LET N+AFFSTNAVEGTCR VVV TGD TVMGRIANL S L  G TPI +EI HFIHII+G+ V LG+ FFIIAF+LG +WLDAV+FLIG+IVANVPEG+LATVTV LTLTAK+MA KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++NKI+++ TS++Q      +   +W  L R+A+LCNRA FK GEE   V KREC+GDASESALLK   L+ G  T YR + PKV E+PFNSTNKYQVS+H+T+DGD RYL+VMKGAPERIL+R  T+L++G+E+ +D+ W++ FNNAY+E+GG+GERVLGFCD RL    FP+GF FD DE NFP+ G  FVGL+SMIDPPR +VPDAV+KCRSAGIKV+MVTGDHPITAKAIAK VGI S  NKT+EDIA  RGVP+S+VNPREA ACV+HGSDL++MT  Q+DEILE H EIVFARTSPQQKL IVEG QR GAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + +  +PL LGTITILCIDLGTDM+PAI+LAYE AE +IM+R PR+P +D LV  RLIS+ +GQ+G+IQA G FF +FVIMAENGF P RL+G+R+ W++P IND+ DSYGQEWTY QRK+LEYTC++A+F S+++ QW ++L+ KTR+NS++QQGMWNH LTF +FFET LAIF+ Y PGL   L+++ LR+TWWL  LPFS  +  FDE+RK  +R     NW  RE
Sbjct:   28 QELAMDEHQISLDELYARLGTNPDTGLTSEQAKTRLDRDGPNALTPPKTTPEWVKFCKNMFGGFSLLLWIGAVLCFIAHGIPCWCAGEPYLYDNLYLGIVLAAVVVITGCFSYYQESKSSKIMESFAKLVPQYAVVIRGGQRIDAPAEALVVGDIIDVKFGDRVPADIRVIKASSFKVDNSALTGESEPQTRTAEYTNENPLETKNLAFFSTNAVEGTCRGVVVATGDRTVMGRIANLASGLEMGATPIAREIAHFIHIITGVAVFLGVTFFIIAFILGYYWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIFEADTSDDQSTANYSRASSTWMALSRIAMLCNRAEFKPGEETNPVLKRECNGDASESALLKCVGLSIGGVTGYRTDKPKVAEIPFNSTNKYQVSVHQTDDGDERYLVVMKGAPERILDRCSTVLMEGQELHMDDQWRESFNNAYLELGGIGERVLGFCDLRLPADKFPRGFKFDIDEPNFPIEGMPFVGLMSMIDPPRAAVPDAVSKCRSAGIKVVMVTGDHPITAKAIAKGVGIISDGNKTVEDIAAERGVPVSQVNPREASACVVHGSDLRDMTPAQIDEILENHSEIVFARTSPQQKLIIVEGIQRMGAIVAVTGDGVNDSPALKKADIGVAMGITGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLIFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAE-DIMKRMPRDPFRDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAENGFWPSRLLGLRKQWDSPAINDVADSYGQEWTYTQRKRLEYTCHTAFFASIVIVQWTDLLICKTRKNSIYQQGMWNHHLTFGLFFETTLAIFLSYCPGLEHGLRMMPLRWTWWLPVLPFSVSIFIFDEVRKKFLRTLPPGNWVERE 1011          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. UniProt/SwissProt
Match: sp|P13607|ATNA_DROME (Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster OX=7227 GN=Atpalpha PE=1 SV=3)

HSP 1 Score: 1276.54 bits (3302), Expect = 0.000e+0
Identity = 644/985 (65.38%), Postives = 781/985 (79.29%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETND-GDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            ++++ D H I+ EELY RFQT P+ GL+  +A   LERDG N+LTP + TPE VKF K L GGF++LLW+GAILCF+AY IQ  T+++   DNLYLGIVL  VV+ TG F YYQ++KSSKIM SF  MVPQ A+V R G  + +  E LV+GD+VEVKFGDRIPAD+RII++  FKVDN++LTGESEPQSR  E T  N LET N+AFFSTNAVEGT + VV+  GD+TVMGRIA L S L TG+TPI KEI HFIH+I+G+ V LG+ FF+IAF+LG  WLDAV+FLIG+IVANVPEG+LATVTV LTLTAK+MA KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I ++ T+E+Q G+   +    +  L R+A LCNRA FK G++   + K+E SGDASE+ALLK  ELA G     R+ N K+ EVPFNSTNKYQVSIHET D  DPRYLLVMKGAPERILER  TI I+GKE  +DE  K+ FNNAYME+GG+GERVLGFCD+ L    +P GF F+ D++NFP+   RFVGL+SMIDPPR +VPDAVAKCRSAGIKVIMVTGDHPITAKAIAK+VGI S  N+T+EDIA    +P+SEVNPREAKA V+HG++L++++S QLDEIL YH EIVFARTSPQQKL IVEGCQR GAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFLA+ +  IPL LGT+TILCIDLGTDM+PAI+LAYE AE++IM+R PR+P  D LV SRLIS+ +GQ+G+IQA   FF +FVIMAENGFLP +L GIR+ W++  +NDL DSYGQEWTY+ RK LEYTC++A+F+S++V QW ++++ KTRRNS+FQQGM N  L F + FET LA F+ Y PG+   L++  L+  WW  A+PF+  +  +DE R+F +RR+    W  +E
Sbjct:   55 QELDIDFHKISPEELYQRFQTHPENGLSHAKAKENLERDGPNALTPPKQTPEWVKFCKNLFGGFAMLLWIGAILCFVAYSIQASTSEEPADDNLYLGIVLSAVVIVTGIFSYYQESKSSKIMESFKNMVPQFATVIREGEKLTLRAEDLVLGDVVEVKFGDRIPADIRIIEARNFKVDNSSLTGESEPQSRGAEFTHENPLETKNLAFFSTNAVEGTAKGVVISCGDHTVMGRIAGLASGLDTGETPIAKEIHHFIHLITGVAVFLGVTFFVIAFILGYHWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIIEADTTEDQSGVQYDRTSPGFKALSRIATLCNRAEFKGGQDGVPILKKEVSGDASEAALLKCMELALGDVMNIRKRNKKIAEVPFNSTNKYQVSIHETEDTNDPRYLLVMKGAPERILERCSTIFINGKEKVLDEEMKEAFNNAYMELGGLGERVLGFCDFMLPSDKYPNGFKFNTDDINFPIDNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKSVGIISEGNETVEDIAQRLNIPVSEVNPREAKAAVVHGAELRDVSSDQLDEILRYHTEIVFARTSPQQKLIIVEGCQRMGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLAFILCDIPLPLGTVTILCIDLGTDMVPAISLAYEHAEADIMKRPPRDPFNDKLVNSRLISMAYGQIGMIQAAAGFFVYFVIMAENGFLPKKLFGIRKMWDSKAVNDLTDSYGQEWTYRDRKTLEYTCHTAFFISIVVVQWADLIICKTRRNSIFQQGMRNWALNFGLVFETVLAAFLSYCPGMEKGLRMYPLKLVWWFPAIPFALAIFIYDETRRFYLRRNPG-GWLEQE 1038          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. UniProt/SwissProt
Match: sp|P13637|AT1A3_HUMAN (Sodium/potassium-transporting ATPase subunit alpha-3 OS=Homo sapiens OX=9606 GN=ATP1A3 PE=1 SV=3)

HSP 1 Score: 1275.38 bits (3299), Expect = 0.000e+0
Identity = 644/985 (65.38%), Postives = 780/985 (79.19%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETND-GDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            ++V    H +++EE+  ++ TD  +GLT  +A   L RDG N+LTP   TPE VKF + L GGFSILLW+GAILCF+AYGIQ GT  D   DNLYLGIVL  VV+ TGCF YYQ+AKSSKIM SF  MVPQ+A V R G  + V  E +VVGD+VE+K GDR+PAD+RII + G KVDN++LTGESEPQ+R+P+CT +N LET NI FFSTN VEGT R VVV TGD TVMGRIA L S L  GKTPI  EIEHFI +I+G+ V LG+ FFI++ +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q G +  +   +W  L  +A LCNRA FK G+++  V KR+ +GDASESALLK  EL+ G     RE N KV E+PFNSTNKYQ+SIHET D  D RYLLVMKGAPERIL+R  TIL+ GKE  +DE  K+ F NAY+E+GG+GERVLGFC Y L E+ FPKGF FD D+VNF      FVGL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+S+VNPR+AKACVIHG+DLK+ TS Q+DEIL+ H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + + +IPL LGTITILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP  D LV  RLIS+ +GQ+G+IQA G FF++FVI+AENGFLP  LVGIR +W++  +NDL+DSYGQ+WTY+QRK +E+TC++A+FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+ +WW  A P+SF +  +DE+RK I+RR+    W  +E
Sbjct:   27 KEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCSTILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPG-GWVEKE 1010          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. UniProt/SwissProt
Match: sp|P24798|AT1A3_CHICK (Sodium/potassium-transporting ATPase subunit alpha-3 OS=Gallus gallus OX=9031 GN=ATP1A3 PE=2 SV=1)

HSP 1 Score: 1275 bits (3298), Expect = 0.000e+0
Identity = 643/985 (65.28%), Postives = 780/985 (79.19%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETND-GDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            ++V    H ++IEE+  ++ TD  +GLT  +A   L RDG N+LTP   TPE VKF + L GGFSILLW+GAILCF+AYGIQ GT  +   DNLYLGIVL  VV+ TGCF YYQ+AKSSKIM SF  MVPQ+A V R G  + +  E +VVGD+VEVK GDR+PAD+RII + G KVDN++LTGESEPQ+R+P+CT +N LET NI FFSTN VEGT R VV+ TGD TVMGRIA L S L  GKTPI  EIEHFI +I+G+ V LGI FF+++ +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q G +  +   +W  L  +A LCNRA FK G+E+  + KR+ +GDASESALLK  EL+ G     RE N KV E+PFNSTNKYQ+SIHET D  D RYLLVMKGAPERIL+R  TIL+ GKE  +DE  K+ F NAY+E+GG+GERVLGFC + L E+ +PKGF FD D+VNF      FVGL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+S+VNPR+AKACVIHG+DLK+M+S Q+DEIL+ H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGI GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + + +IPL LGTITILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP  D LV  RLIS+ +GQ+G+IQA G FF++FVI+AENGFLP  LVGIR SW++  INDL+DSYGQ+WTY+QRK +E+TC++A+FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+ +WW  A P+SF +  +DE+RK I+RR+    W  +E
Sbjct:   24 KEVAMTEHKMSIEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDEPSNDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQLNAEEVVVGDLVEVKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVIATGDRTVMGRIATLASGLEVGKTPIAVEIEHFIQLITGVAVFLGISFFVLSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSATWVALSHIAGLCNRAVFKGGQENVPILKRDVAGDASESALLKCIELSSGSVKVMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCSTILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHFYLPEEQYPKGFAFDCDDVNFATDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDMSSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIRGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRSDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPSCLVGIRLSWDDRTINDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPG-GWVEKE 1007          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. UniProt/SwissProt
Match: sp|P06687|AT1A3_RAT (Sodium/potassium-transporting ATPase subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Atp1a3 PE=1 SV=2)

HSP 1 Score: 1274.23 bits (3296), Expect = 0.000e+0
Identity = 644/985 (65.38%), Postives = 780/985 (79.19%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETND-GDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            ++V    H +++EE+  ++ TD  +GLT  +A   L RDG N+LTP   TPE VKF + L GGFSILLW+GAILCF+AYGIQ GT  D   DNLYLGIVL  VV+ TGCF YYQ+AKSSKIM SF  MVPQ+A V R G  + V  E +VVGD+VE+K GDR+PAD+RII + G KVDN++LTGESEPQ+R+P+CT +N LET NI FFSTN VEGT R VVV TGD TVMGRIA L S L  GKTPI  EIEHFI +I+G+ V LG+ FFI++ +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q G +  +   +W  L  +A LCNRA FK G+++  V KR+ +GDASESALLK  EL+ G     RE N KV E+PFNSTNKYQ+SIHET D  D RYLLVMKGAPERIL+R  TIL+ GKE  +DE  K+ F NAY+E+GG+GERVLGFC Y L E+ FPKGF FD D+VNF      FVGL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+S+VNPR+AKACVIHG+DLK+ TS Q+DEIL+ H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + + +IPL LGTITILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP  D LV  RLIS+ +GQ+G+IQA G FF++FVI+AENGFLP  LVGIR +W++  +NDL+DSYGQ+WTY+QRK +E+TC++A+FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+ +WW  A P+SF +  +DE+RK I+RR+    W  +E
Sbjct:   27 KEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCATILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPG-GWVEKE 1010          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. TrEMBL
Match: O76154 (Sodium/potassium-transporting ATPase subunit alpha OS=Dugesia japonica OX=6161 GN=Djnak PE=2 SV=1)

HSP 1 Score: 1424.45 bits (3686), Expect = 0.000e+0
Identity = 697/983 (70.91%), Postives = 833/983 (84.74%), Query Frame = 2
Query:  110 DVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            +++ DSH I I++LY R Q+DPDKG++ E+A  RL RDG N+LTP + TPE VKF K L GGFS+LLW+GA+LCF+AY IQ G  +D P DNLYLG+VL  VVV TGCF YYQDAKSSKIM SFGKMVPQKA+V R G + +++ E LVVGD++EVKFGDR+PAD+R+I++S FKVDN+ALTGESE Q RTPE T++N LET NIAFFSTNAVEGTCR +V+  GDNTVMGRIANL S L  G TPI KEI HFIHII+G+ V LG+ FF+IAF+LG FWLDAV+FLIG+IVANVPEG+LATVTV LTLTAK+MA+KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++NKI +S TSENQI  ++KQ  ++W +L R+++LCNRA FKAGEEDK V KR+C+GDASESALLK  EL+ G  T+YREEN K++E+PFNSTNKYQVSIHETNDG+P YL+ MKGAPERILER  TILIDGKE+ +D+HWK EFNNAY+E+GGMGERVLGFCD+RLDE  FPKGF F+ DEVNFPL G RFVGL+SMIDPPR +VPDAVAKCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T++DIA  RG+  SEVNPR+A+ACVIHGSDL++MTS QLDE+L++H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + +  +PL LGTITILCIDLGTDM+PAI+LAYE AES+IM+RKPR+P  D LV  RLIS+ +GQ+G+IQA G FF +FVIMAE GF P RL+G+R+ W++  +NDL DSYGQEWT++QRK+LEYTC++A+FVS+++ QW ++++ KTRRNS+FQQGMWNHQ+TF +FFET LA F+ Y PGL+  LK+  LRFTWWL A+PFS  +  +DE+RK+++R+ K+ +W   E
Sbjct:   37 ELDIDSHRIPIKDLYIRLQSDPDKGISYEDAKMRLARDGPNALTPPKTTPEWVKFCKQLFGGFSLLLWIGAVLCFLAYAIQSGAYEDPPKDNLYLGVVLTAVVVITGCFSYYQDAKSSKIMESFGKMVPQKANVIREGKISEISAENLVVGDVIEVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRTPEFTNDNPLETKNIAFFSTNAVEGTCRGIVISVGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSSKQESDTWKMLARISMLCNRAQFKAGEEDKPVLKRDCTGDASESALLKCVELSIGGVTKYREENKKIVEIPFNSTNKYQVSIHETNDGNPGYLIAMKGAPERILERCSTILIDGKEVHMDDHWKQEFNNAYLELGGMGERVLGFCDFRLDENEFPKGFKFNPDEVNFPLDGLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNRTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMTSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFEQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEVRKYLLRKWKNGSWLENE 1019          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. TrEMBL
Match: M4LUP7 (Sodium/potassium-transporting ATPase subunit alpha OS=Schmidtea mediterranea OX=79327 GN=ATP12A PE=2 SV=1)

HSP 1 Score: 1413.28 bits (3657), Expect = 0.000e+0
Identity = 698/983 (71.01%), Postives = 829/983 (84.33%), Query Frame = 2
Query:  110 DVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            +++ DSH I+I++LY R QTDP+KGL+ EEA  RL RDG N+LTP + TPE VKF + L GGFS+LLW+GA LCF+AY I  G  +D P DNLYLGIVL  VVV TGCF YYQ+AKSSKIM SFGKMVPQKA+V R G ++++A E LV GDI++VKFGDR+PAD+R+I++S FKVDN+ALTGESE Q R+ E T++N LET NIAFFSTNAVEGTC+ VV+ TGDNTVMGRIANL S L  G TPI KEI HFIHII+G+ V LG+ FF+IAF+LG FWLDAV+FLIG+IVANVPEG+LATVTV LTLTAKKMA+KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++NKI +S TSENQI  + KQ  E+W +L RVA+LCNRA FK+GEE+K V KREC+GDASESALLK  EL+ G  T+YR EN K++E+PFNSTNKYQVSIHET+DG+  YLL MKGAPERILER  TILIDGKE+E+D+HW+ EFNNAY+E+GGMGERVLGFCDYRLDE  FP+GF F+ DEVNFPL G RFVGL+SMIDPPR +VPDAVAKCRSAGIKVIMVTGDHPITAKAIAK VGI S  NKT++DIA  RG+  SEVNPR+A+ACVIHGSDL++M+S QLDE+L++H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + +  +PL LGTITILCIDLGTDM+PAI+LAYE AES+IM+RKPR+P  D LV  RLIS+ +GQ+G+IQA G FF +FVIMAE GF P RL+G+R+ W++  +NDL DSYGQEWT+ QRK+LEYTC++A+FVS+++ QW ++++ KTRRNS+FQQGMWNHQ+TF +FFET LA F+ Y PGL+  LK+  LRFTWWL A+PFS  +  +DE+RKF++R+ K+ +W   E
Sbjct:   37 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENE 1019          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. TrEMBL
Match: A0A0R3UN07 (Uncharacterized protein (Fragment) OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS9151 PE=3 SV=1)

HSP 1 Score: 1368.6 bits (3541), Expect = 0.000e+0
Identity = 683/980 (69.69%), Postives = 806/980 (82.24%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNW 3046
            +D+  D H I+++ELYAR  T+P+ GLT E+A  RL+RDG N+LTP + TPE VKF K + GGFS+LLW+GAILCFIA+ I  G  ++   DNLYLGIVL  VV+ TGCF YYQ++KSSKIM SF KMVP  A V R G  ID   E+LVVGDI+EVKFGDR+PAD+R+IK+S FKVDN+ALTGESEPQSRTPE T+ N LET N+AFFSTNAVEGTCR VVV TGD TVMGRIANL S L TG TPI +EI HFIHII+G+ V LG+ FFIIAF+LG  WLDAV+FLIG+IVANVPEG+LATVTV LTLTAK+MA+KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++NKI+++ TS++Q   T  +   +W  L RVA+LCNRA FKAGEE K V KREC+GDASESALLK  EL+ G  T+YR ENPKV E+PFNSTNKYQVS+HETNDGD RYL+VMKGAPERIL+R  TILIDG+E+ +D+ W++ FNNAY+E+GG+GERVLGFCD RL    FP+GF FD DE NFP+ G RFVGL+SMIDPPR +VPDAVAKCRSAGIKV+MVTGDHPITAKAIAK+VGI S  N+T+EDIA  RGV +SEV+PREA ACVIHGSDL+ MT  Q+DE+LE H EIVFARTSPQQKL IVEG QR GAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + V  IPL LG ITILCIDLGTDM+PAI+LAYE AES+IM+R PR+P  D LV  RLIS+ +GQ+G+IQA   FF +FVIMAENGF P RL+G+R+ W++P IND+ DSYGQEWTY QRK+LEYTC++A+FVS+++ QW ++L+ KTR+NS+FQQG+ NHQLTF +FFET LA+F+ Y PGL   L+++ LR+TWWL ALPFS  +  FDE+RK ++R     NW
Sbjct:   28 QDISMDDHQISLDELYARLGTNPETGLTIEQAKTRLDRDGANALTPPKTTPEWVKFCKNMFGGFSLLLWIGAILCFIAHAILAGVQENPTNDNLYLGIVLAAVVIITGCFSYYQESKSSKIMESFAKMVPHYALVIRGGQKIDAPAESLVVGDIIEVKFGDRVPADIRVIKASSFKVDNSALTGESEPQSRTPEYTNENPLETKNLAFFSTNAVEGTCRGVVVATGDRTVMGRIANLASGLETGATPIAREIAHFIHIITGVAVFLGVSFFIIAFILGYPWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHLWFDNKIFEADTSDDQSCATYNRDSSTWMALSRVAMLCNRAEFKAGEESKPVLKRECNGDASESALLKCVELSIGGVTKYRSENPKVAEIPFNSTNKYQVSVHETNDGDDRYLVVMKGAPERILDRCSTILIDGQELHMDDEWRENFNNAYLELGGIGERVLGFCDLRLPVDKFPRGFKFDVDEQNFPIDGMRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVVMVTGDHPITAKAIAKSVGIISEGNRTVEDIAAERGVSVSEVDPREASACVIHGSDLRNMTPTQIDEVLENHSEIVFARTSPQQKLIIVEGFQRMGAIVAVTGDGVNDSPALKKADIGVAMGITGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLLFVVADIPLPLGVITILCIDLGTDMVPAISLAYEEAESDIMKRMPRDPSHDKLVNERLISMAYGQIGMIQASAGFFVYFVIMAENGFWPSRLLGLRKQWDSPAINDVADSYGQEWTYTQRKRLEYTCHTAFFVSIVIVQWSDLLICKTRKNSIFQQGVRNHQLTFGLFFETTLALFLSYCPGLEQGLRMMPLRWTWWLPALPFSVMIFVFDEVRKKLLRNLPPGNW 1007          

HSP 2 Score: 402.134 bits (1032), Expect = 1.924e-116
Identity = 226/327 (69.11%), Postives = 267/327 (81.65%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEA 1087
            R++E D H I+++ELYAR  T+P  GLTSE+A  RL+RDG N+LTP + TPE VKF K + GGFS+LLW+GA+LCFIA+GI     ++   DNLYLGIVL  VV+ TGCF YYQ++KSSKIM SF KM+PQ A V R G   DV  E LVVGDI++VKFGDR+PAD+R+IK+S FKVDN+ALTGESEPQSRTPE T+ N LET N+AFFSTNAVEGTCR VVV TGD TVMGRIANL S L TG TPI +EI HFIHII+G+ V LG+ F IIAF+LG +WLDAV+FLIG+IVANVPEG+LATVTV LTLTAK+MA+KNCLVKNLEA
Sbjct: 1091 RELEMDEHQISLDELYARLGTNPGTGLTSEQAKTRLDRDGPNALTPPKATPEWVKFCKNMFGGFSLLLWIGAVLCFIAHGIHAVVLENPSNDNLYLGIVLAAVVIITGCFSYYQESKSSKIMESFAKMLPQYAVVIRRGQRTDVPAEALVVGDIIDVKFGDRVPADIRVIKASSFKVDNSALTGESEPQSRTPEYTNENPLETKNLAFFSTNAVEGTCRGVVVATGDRTVMGRIANLASGLETGATPIAREISHFIHIITGVAVFLGVSFSIIAFILGYYWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEA 1417          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. TrEMBL
Match: Q95WT4 (Sodium/potassium-transporting ATPase subunit alpha OS=Schistosoma mansoni OX=6183 PE=2 SV=1)

HSP 1 Score: 1368.6 bits (3541), Expect = 0.000e+0
Identity = 678/984 (68.90%), Postives = 812/984 (82.52%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            ++++ D H I+++ELY+R  TDP  GLT+E+A  RLERDG N+LTP + TPE VKF KTL GGFS+LLW+GA+LCFIA+ I+ GT +D P DNLYLGIVL  VVV TGCF YYQ++KSS+IM SF KM+PQ A V R G+ I+   E LVVGD+++VK GDR+PAD+RII +S FKVDN+ALTGESEPQSRT E T+ N LET N+AFFSTNAV+GTCR +VV TGD TVMGRIANL S L  G+TPI KEI HFIH+I+ + V LG+ FF+IAF+LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MA KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MT+AH W++NKI+D+ T+++Q   T  +   +W  L R+ +LCNRA FK GEE+K V KREC+GDASESALLK  EL+ G  TEYR +NPKV E+PFNSTNKYQ+SIHETND D RYLLVMKGAPERIL+R  TILI+GKE  +DE  ++ FN+AY+E+GGMGERVLGFCDYRL    + KG+PF+ DE NFPLT  RFVGL+SMIDPPR +VPDAVAKCRSAGIKVIMVTGDHPITAKAIAK VGI S  +KT+EDIA  RG+P+S+VNPR+A+ACVIHGSDL+EMT  Q+D+IL  H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALK+ADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL Y +  IPL LGTITILCIDLGTDM+PAI+LAYE AE++IM+R PR+PL D LV  RLIS+ +GQ+G+IQA G FF +FVIMAENGF P RL+GIR  W++  INDL DSYGQEWTY QRK+LEYTC++A+F S+++ QW ++++ KTRRNS+FQQGMWNH LTF +FFET LAIF+ Y PGL+  L+++ +RFTWWL  LPFSF +  +DE+RKF++RR    +W  +E
Sbjct:   21 QELDMDEHRISLDELYSRLSTDPQSGLTAEQAKTRLERDGPNALTPPKTTPEWVKFCKTLFGGFSLLLWIGAVLCFIAFSIESGTHEDPPKDNLYLGIVLSVVVVVTGCFSYYQESKSSRIMESFKKMIPQTALVIRGGVKIEAPAEALVVGDLIDVKCGDRVPADIRIISASSFKVDNSALTGESEPQSRTSEYTNENPLETKNLAFFSTNAVDGTCRGIVVSTGDRTVMGRIANLASGLQIGQTPINKEINHFIHLITSVAVFLGVSFFVIAFILGYHWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTIAHMWFDNKIFDADTTDDQSVATYDKNSPTWIALARIGMLCNRAEFKVGEENKPVLKRECNGDASESALLKCVELSFGGVTEYRRKNPKVAEIPFNSTNKYQLSIHETNDSDERYLLVMKGAPERILDRCGTILINGKEEVMDESMRENFNSAYLELGGMGERVLGFCDYRLPLDTYKKGYPFNVDEPNFPLTNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKGVGIISESSKTVEDIAAERGIPVSQVNPRDAQACVIHGSDLREMTPAQIDDILLNHSEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKQADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVYILADIPLPLGTITILCIDLGTDMIPAISLAYEEAEADIMKRMPRDPLHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAENGFWPSRLLGIRREWDSKAINDLADSYGQEWTYNQRKRLEYTCHTAFFASIVIVQWTDLMICKTRRNSIFQQGMWNHHLTFGLFFETTLAIFLSYCPGLDKGLRMMPMRFTWWLPGLPFSFLIFVYDEVRKFLLRRLPPGSWLEKE 1004          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. TrEMBL
Match: A0A3Q0KLP2 (Sodium/potassium-transporting ATPase subunit alpha OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 1366.67 bits (3536), Expect = 0.000e+0
Identity = 677/984 (68.80%), Postives = 811/984 (82.42%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            ++++ D H I+++ELY+R  TDP  GLT+E+A  RLERDG N+LTP + TPE VKF KTL GGFS+LLW+GA+LCFIA+ I+ GT +D P DNLYLGIVL  VVV TGCF YYQ++KSS+IM SF KM+PQ A V R G+ I+   E LVVGD+++VK GDR+PAD+RII +S FKVDN+ALTGESEPQSRT E T+ N LET N+AFFSTNAV+GTCR +VV TGD TVMGRIANL S L  G+TPI KEI HFIH+I+ + V LG+ FF+IAF+LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MA KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MT+AH W++NKI+D+ T+++Q   T  +   +W  L R+ +LCNRA FK GEE+K V KREC+GDASESALLK  EL+ G  TEYR +NPKV E+PFNSTNKYQ+SIHETND D RYLLVMKGAPERIL+R  TILI+GKE  +DE  ++ FN+AY+E+GGMGERVLGFCDYRL    + KG+PF+ DE NFPLT  RFVGL+SMIDPPR +VPDAVAKCRSAGIKVIMVTGDHPITAKAIAK VGI S  +KT+EDIA  RG+P+ +VNPR+A+ACVIHGSDL+EMT  Q+D+IL  H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALK+ADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL Y +  IPL LGTITILCIDLGTDM+PAI+LAYE AE++IM+R PR+PL D LV  RLIS+ +GQ+G+IQA G FF +FVIMAENGF P RL+GIR  W++  INDL DSYGQEWTY QRK+LEYTC++A+F S+++ QW ++++ KTRRNS+FQQGMWNH LTF +FFET LAIF+ Y PGL+  L+++ +RFTWWL  LPFSF +  +DE+RKF++RR    +W  +E
Sbjct:   33 QELDMDEHRISLDELYSRLSTDPQSGLTAEQAKTRLERDGPNALTPPKTTPEWVKFCKTLFGGFSLLLWIGAVLCFIAFSIESGTHEDPPKDNLYLGIVLSVVVVVTGCFSYYQESKSSRIMESFKKMIPQTALVIRGGVKIEAPAEALVVGDLIDVKCGDRVPADIRIISASSFKVDNSALTGESEPQSRTSEYTNENPLETKNLAFFSTNAVDGTCRGIVVSTGDRTVMGRIANLASGLQIGQTPINKEINHFIHLITSVAVFLGVSFFVIAFILGYHWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTIAHMWFDNKIFDADTTDDQSVATYDKNSPTWIALARIGMLCNRAEFKVGEENKPVLKRECNGDASESALLKCVELSFGGVTEYRRKNPKVAEIPFNSTNKYQLSIHETNDSDERYLLVMKGAPERILDRCGTILINGKEEVMDESMRENFNSAYLELGGMGERVLGFCDYRLPLDTYKKGYPFNVDEPNFPLTNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKGVGIISESSKTVEDIAAERGIPVRQVNPRDAQACVIHGSDLREMTPAQIDDILLNHSEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKQADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVYILADIPLPLGTITILCIDLGTDMIPAISLAYEEAEADIMKRMPRDPLHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAENGFWPSRLLGIRREWDSKAINDLADSYGQEWTYNQRKRLEYTCHTAFFASIVIVQWTDLMICKTRRNSIFQQGMWNHHLTFGLFFETTLAIFLSYCPGLDKGLRMMPMRFTWWLPGLPFSFLIFVYDEVRKFLLRRLPPGSWLEKE 1016          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Cavefish
Match: atp1a3a (sodium/potassium-transporting ATPase subunit alpha-3-like [Source:NCBI gene;Acc:103030580])

HSP 1 Score: 1276.92 bits (3303), Expect = 0.000e+0
Identity = 644/985 (65.38%), Postives = 785/985 (79.70%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETND-GDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            ++V    H ++IEE+  ++ TD  +GLT+ +AA  L RDG N+LTP   TPE +KF + L GGFSILLW+GAILCF+AY IQ  T  +   DNLYLGIVL  VV+ TGCF Y+Q+AKSSKIM SF  MVPQ+A V R G  + +  E +V GD+VEVK GDRIPAD+RII + G KVDN++LTGESEPQ+R+P+CT +N LET NIAFFSTN VEGT R +VV TGD TVMGRIA LTS L TGKTPI KEIEHFI II+G+ V LG+ FFI++ +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q G +  +   +W  L RVA LCNRA FKAG+E   + KR+ +GDASESALLK  EL+ G     R++N KV E+PFNSTNKYQ+S+HET +  D  YLLVMKGAPERIL+R  TI++ GKE  +DE  K+ F NAY+E+GG+GERVLGFC   + E  +PKGF FD D+VNF      FVGL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+S+VNPR+AKACVIHGSDLKE+T  Q+D++L+ H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGISGSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + +++IPL LGTITILCIDLGTDM+PAI+LAYE AES+IM+R+PRNPL+D LV  RLIS+ +GQ+G+IQA G FFA+FVIMAENGFLP RLVGIR +W++   NDL+DSYGQ+WTY+QRK +E+TC++A+FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+ +WW  A P+SF +  +DE+RK I+RR+    W  +E
Sbjct:   36 KEVPLTEHRMSIEEVCRKYNTDIVQGLTNAKAAEYLARDGPNALTPPPTTPEWIKFCRQLFGGFSILLWIGAILCFLAYAIQAATEDEPAGDNLYLGIVLSAVVIITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKLQINAEEVVAGDLVEVKGGDRIPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNIAFFSTNCVEGTARGIVVCTGDRTVMGRIATLTSGLETGKTPIAKEIEHFIQIITGVAVFLGVTFFILSIILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKTSVTWVSLARVAALCNRAVFKAGQESLPILKRDVAGDASESALLKCIELSCGSVKAMRDKNKKVAEIPFNSTNKYQLSVHETEEPSDNHYLLVMKGAPERILDRCSTIMVQGKEQPMDEEMKEAFQNAYLELGGLGERVLGFCHLFMPEDQYPKGFAFDTDDVNFKTDNMCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGSDLKELTQEQMDDVLKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFILVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPLRDKLVNERLISIAYGQIGMIQALGGFFAYFVIMAENGFLPSRLVGIRLNWDDRSNNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPG-GWVEKE 1019          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Cavefish
Match: atp1a3b (ATPase Na+/K+ transporting subunit alpha 3 [Source:NCBI gene;Acc:103034051])

HSP 1 Score: 1276.54 bits (3302), Expect = 0.000e+0
Identity = 646/985 (65.58%), Postives = 786/985 (79.80%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETND-GDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            ++V    H +++EE+  +FQTD  +GLT+ +AA  L+RDG N+LTP   TPE VKF + L GGFSILLW GAILCF+AY IQ  T  +   DNLYLGIVL  VV+ TGCF Y+Q+AKSSKIM SF  MVPQ+A V R G  + +  E +V GD+VEVK GDRIPAD+RII S G KVDN++LTGESEPQ+R+P+CT +N LET NIAFFSTN VEGT R +VV TGD TVMGRIA LTS L TGKTPI KEIEHFIHII+G+ V LG+ FFI++ +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q G +  +   +W  L RVA LCNRA FKAG++   + KR+ +GDASESALLK  EL+ G   + RE N KV E+PFNSTNKYQ+SIHET +  D RYLLVMKGAPERIL+R  TI+I GKE  +DE  K+ F NAY+E+GG+GERVLGFC   + E  +PKGF FD D+VNF      FVGL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+S+VNPR+AKACVIHG++LK+M+  Q+DEIL  H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGISGSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + +++IPL LGTITILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP++D LV  RLIS+ +GQ+G+IQA G FF++FVI+AENGFLP  LVGIR SW++   NDL+DSYGQ+WTY+QRK +E+TC++A+FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+ +WW  A P+SF +  +DE+RK ++RR+    W  +E
Sbjct:   38 KEVPLTEHKMSVEEVCRKFQTDIVQGLTNAKAAEFLQRDGPNALTPPPTTPEWVKFCRQLFGGFSILLWTGAILCFLAYAIQAATEDEPAGDNLYLGIVLSAVVIITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKMQINAEEVVAGDLVEVKGGDRIPADLRIISSHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNIAFFSTNCVEGTARGIVVCTGDRTVMGRIATLTSGLETGKTPIAKEIEHFIHIITGVAVFLGLSFFILSIILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGASFDKTSVTWVSLARVASLCNRAVFKAGQDSLPILKRDVAGDASESALLKCIELSCGSVKQMRERNKKVAEIPFNSTNKYQLSIHETEEPNDNRYLLVMKGAPERILDRCSTIMIQGKEQPMDEEMKEAFQNAYLELGGLGERVLGFCHLLMPEDQYPKGFAFDTDDVNFQTDNMCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTELKDMSQDQIDEILRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFIIVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPMRDKLVNERLISIAYGQIGMIQALGGFFSYFVILAENGFLPSLLVGIRLSWDDRTANDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLLLRRNPG-GWVEKE 1021          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Cavefish
Match: atp1a3a (sodium/potassium-transporting ATPase subunit alpha-3-like [Source:NCBI gene;Acc:103030580])

HSP 1 Score: 1263.44 bits (3268), Expect = 0.000e+0
Identity = 637/960 (66.35%), Postives = 770/960 (80.21%), Query Frame = 2
Query:  182 GLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETND-GDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            GLT+ +AA  L RDG N+LTP   TPE +KF + L GGFSILLW+GAILCF+AY IQ  T  +   DNLYLGIVL  VV+ TGCF Y+Q+AKSSKIM SF  MVPQ+A V R G  + +  E +V GD+VEVK GDRIPAD+RII + G KVDN++LTGESEPQ+R+P+CT +N LET NIAFFSTN VEGT R +VV TGD TVMGRIA LTS L TGKTPI KEIEHFI II+G+ V LG+ FFI++ +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q G +  +   +W  L RVA LCNRA FKAG+E   + KR+ +GDASESALLK  EL+ G     R++N KV E+PFNSTNKYQ+S+HET +  D  YLLVMKGAPERIL+R  TI++ GKE  +DE  K+ F NAY+E+GG+GERVLGFC   + E  +PKGF FD D+VNF      FVGL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+S+VNPR+AKACVIHGSDLKE+T  Q+D++L+ H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGISGSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + +++IPL LGTITILCIDLGTDM+PAI+LAYE AES+IM+R+PRNPL+D LV  RLIS+ +GQ+G+IQA G FFA+FVIMAENGFLP RLVGIR +W++   NDL+DSYGQ+WTY+QRK +E+TC++A+FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+ +WW  A P+SF +  +DE+RK I+RR+    W  +E
Sbjct:   55 GLTNAKAAEYLARDGPNALTPPPTTPEWIKFCRQLFGGFSILLWIGAILCFLAYAIQAATEDEPAGDNLYLGIVLSAVVIITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKLQINAEEVVAGDLVEVKGGDRIPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNIAFFSTNCVEGTARGIVVCTGDRTVMGRIATLTSGLETGKTPIAKEIEHFIQIITGVAVFLGVTFFILSIILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKTSVTWVSLARVAALCNRAVFKAGQESLPILKRDVAGDASESALLKCIELSCGSVKAMRDKNKKVAEIPFNSTNKYQLSVHETEEPSDNHYLLVMKGAPERILDRCSTIMVQGKEQPMDEEMKEAFQNAYLELGGLGERVLGFCHLFMPEDQYPKGFAFDTDDVNFKTDNMCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGSDLKELTQEQMDDVLKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFILVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPLRDKLVNERLISIAYGQIGMIQALGGFFAYFVIMAENGFLPSRLVGIRLNWDDRSNNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPG-GWVEKE 1013          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Cavefish
Match: atp1a3b (ATPase Na+/K+ transporting subunit alpha 3 [Source:NCBI gene;Acc:103034051])

HSP 1 Score: 1261.9 bits (3264), Expect = 0.000e+0
Identity = 638/960 (66.46%), Postives = 770/960 (80.21%), Query Frame = 2
Query:  182 GLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETND-GDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            GLT+ +AA  L+RDG N+LTP   TPE VKF + L GGFSILLW GAILCF+AY IQ  T  +   DNLYLGIVL  VV+ TGCF Y+Q+AKSSKIM SF  MVPQ+A V R G  + +  E +V GD+VEVK GDRIPAD+RII S G KVDN++LTGESEPQ+R+P+CT +N LET NIAFFSTN VEGT R +VV TGD TVMGRIA LTS L TGKTPI KEIEHFIHII+G+ V LG+ FFI++ +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q G +  +   +W  L RVA LCNRA FKAG++   + KR+ +GDASESALLK  EL+ G   + RE N KV E+PFNSTNKYQ+SIHET +  D RYLLVMKGAPERIL+R  TI+I GKE  +DE  K+ F NAY+E+GG+GERVLGFC   + E  +PKGF FD D+VNF      FVGL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+S+VNPR+AKACVIHG++LK+M+  Q+DEIL  H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGISGSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + +++IPL LGTITILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP++D LV  RLIS+ +GQ+G+IQA G FF++FVI+AENGFLP  LVGIR SW++   NDL+DSYGQ+WTY+QRK +E+TC++A+FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+ +WW  A P+SF +  +DE+RK ++RR+    W  +E
Sbjct:   33 GLTNAKAAEFLQRDGPNALTPPPTTPEWVKFCRQLFGGFSILLWTGAILCFLAYAIQAATEDEPAGDNLYLGIVLSAVVIITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKMQINAEEVVAGDLVEVKGGDRIPADLRIISSHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNIAFFSTNCVEGTARGIVVCTGDRTVMGRIATLTSGLETGKTPIAKEIEHFIHIITGVAVFLGLSFFILSIILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGASFDKTSVTWVSLARVASLCNRAVFKAGQDSLPILKRDVAGDASESALLKCIELSCGSVKQMRERNKKVAEIPFNSTNKYQLSIHETEEPNDNRYLLVMKGAPERILDRCSTIMIQGKEQPMDEEMKEAFQNAYLELGGLGERVLGFCHLLMPEDQYPKGFAFDTDDVNFQTDNMCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTELKDMSQDQIDEILRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFIIVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPMRDKLVNERLISIAYGQIGMIQALGGFFSYFVILAENGFLPSLLVGIRLSWDDRTANDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLLLRRNPG-GWVEKE 991          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Cavefish
Match: atp1a1b (sodium/potassium-transporting ATPase subunit alpha-1 [Source:NCBI gene;Acc:103024756])

HSP 1 Score: 1230.31 bits (3182), Expect = 0.000e+0
Identity = 625/986 (63.39%), Postives = 772/986 (78.30%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDP--RYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            ++V+ D H ++++EL+ ++ TD  +GL+S  A   L RDG N+LTP   TPE VKF K + GGFS+LLW GA+LCF+AYGIQ     +   DNLYLG+VL  VV+ TGCF YYQ+AKSSKIM SF  +VPQ+A V R G    +  E +V+GD+VEVK GDRIPAD+RII + G KVDN++LTGESEPQ+R+P+ +++N LET NIAFFSTN VEGT R +V+ TGD TVMGRIA L S L  G+TPI  EIEHFIHII+G+ V LG+ FFI++ +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MA+KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+ENQ G T  +   +W  L RVA LCNRA F A + D  + KR+ +GDASESALLK  EL  G   E RE+  K  E+PFNSTNKYQ+S+H+  +  P  +YLLVMKGAPERIL+R  TI+  GKE  +D+  +D F NAY+E+GG+GERVLGFC Y L E+ FP+GF FD D+VNFP     FVGL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +PI+EVNPR+AKACV+HG DLK++++ QLD+IL++H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + + +IPL LGT+TILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP  D LV  RLIS+ +GQ+G+IQA   FF +FVI+AENGFLP RL+GIR  W++   NDL+DSYGQ+WTY+QRK +E+TC++A+F S++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG+   L++  L+  WW  A P+S  +  +DE+RK I+RR+     W RE
Sbjct:   38 KEVDLDDHKLSLDELHRKYGTDLSRGLSSSRAQEILARDGPNALTPPPTTPEWVKFCKQMFGGFSMLLWTGAVLCFLAYGIQAAMEDEPANDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMDSFKNLVPQQALVIRDGEKNHINAEDVVLGDLVEVKGGDRIPADLRIISAHGCKVDNSSLTGESEPQTRSPDFSNDNPLETRNIAFFSTNCVEGTARGIVISTGDRTVMGRIATLASGLEVGRTPISIEIEHFIHIITGVAVFLGLSFFILSLVLGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGTTFDRSSTTWACLARVAGLCNRAVFLAEQTDVPILKRDVAGDASESALLKCIELCCGSVKEMREKYSKAAEIPFNSTNKYQLSVHKNPNATPESKYLLVMKGAPERILDRCSTIMFQGKEQPLDDEMRDAFQNAYLELGGLGERVLGFCHYNLPEEQFPEGFQFDTDDVNFPTENLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPINEVNPRDAKACVVHGGDLKDLSAEQLDDILKHHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPKTDKLVNERLISIAYGQIGMIQALAGFFTYFVILAENGFLPSRLLGIRVHWDDKYTNDLEDSYGQQWTYEQRKIVEFTCHTAFFTSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMGVALRMYPLKPNWWFCAFPYSLLIFIYDEIRKLILRRNP--GGWVRE 1021          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002888.1 (pep scaffold:Pmarinus_7.0:GL478641:194938:205936:1 gene:ENSPMAG00000002641.1 transcript:ENSPMAT00000002888.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 766.148 bits (1977), Expect = 0.000e+0
Identity = 367/578 (63.49%), Postives = 455/578 (78.72%), Query Frame = 2
Query: 1328 KRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETND-GDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            +R   GDASESALL+  EL  G   + R  N KV E+PF+ST KYQ+SIHE+++  DPRYLLVMKGAPERIL+R  +I+I+G+E  +DE  ++ F NAY+E+GG+GERVLG C  RL    FP+G+ FD + +NFP+     VGL+SMIDPPR +VPDAV KCRSAGIKVIM TGDHPITAKAIAK+VGI S  N+T+EDIA    +P+++V+PR+AKACV+HGSDLK MT  QLD+IL+ + EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDS ALKKADIGIAMGI GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + + +IPL LGT+TILCIDLGTDM+PAI+LAYE AES+IM+R+PRN   D LV  RLIS+ +GQ+G+IQA G FF +FVIMAENGFLP +L+G+R  W     N+L+DSYGQEWTY+QRK +EYTC++++FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+ +WW  A P+S  +  +DE+RK IIRR+    W  +E
Sbjct:    1 QRNVVGDASESALLRCVELCVGNVRDMRSRNQKVAEIPFDSTIKYQLSIHESDEPNDPRYLLVMKGAPERILDRCSSIIIEGQEESLDEELEEAFQNAYLELGGLGERVLGLCQLRLPVDQFPRGYAFDTENINFPMEDLCLVGLMSMIDPPRATVPDAVGKCRSAGIKVIMATGDHPITAKAIAKSVGIISEGNETVEDIAARLNIPVNQVDPRDAKACVVHGSDLKNMTETQLDDILKNYTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSLALKKADIGIAMGIVGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFILCNIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNVRVDKLVNERLISIAYGQIGMIQALGGFFTYFVIMAENGFLPSKLMGLRIEWNTRSQNELEDSYGQEWTYEQRKIVEYTCHTSFFVSIVVVQWADLIICKTRRNSVFQQGMKNKVLIFGLFEETALAAFLSYCPGMDVALRMYPLKLSWWFCAFPYSILIFVYDEVRKLIIRRNPG-GWVEKE 577          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002145.1 (pep scaffold:Pmarinus_7.0:GL482157:124:4919:1 gene:ENSPMAG00000001949.1 transcript:ENSPMAT00000002145.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 275/411 (66.91%), Postives = 338/411 (82.24%), Query Frame = 2
Query: 1829 KVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTREN 3061
            +VIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+S+VNPR+AKACV+HGSDLK+MT +QLD+IL+ H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + + +IPL LGT+TILCIDLGTDM+PAI+LAYE AES+IM+R+PRN   D LV  RLIS+ +GQ+G+IQA G FF++FVI+AENGFLP  L+GIR +W++  +NDL+DSYGQEWTY+QRK +EYTC++++FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+ +WW  A P+S  +  +DE+RKFI+RR     W  RE 
Sbjct:    1 QVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVVHGSDLKDMTEIQLDDILKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFILCNIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNARVDKLVNERLISIAYGQIGMIQALGGFFSYFVILAENGFLPWNLIGIRINWDDKSLNDLEDSYGQEWTYEQRKIVEYTCHTSFFVSIVVVQWADLIICKTRRNSVFQQGMKNKVLIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSLLIFVYDEVRKFILRRHPG-GWVERET 410          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009058.1 (pep scaffold:Pmarinus_7.0:GL480374:1:11062:-1 gene:ENSPMAG00000008154.1 transcript:ENSPMAT00000009058.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 455.292 bits (1170), Expect = 1.353e-150
Identity = 260/416 (62.50%), Postives = 325/416 (78.12%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDAS 1354
            ++V  D H ++++EL+ ++ TD  +GLT+  AA  L RDG N+LTP   TPE VKF K L GGFS+LLWVGAILCF+AYGIQ  T  +   DNLYLG+VL  VV+ TGCF YYQ++KSS+IM SF  MVPQ+A V R G    +  E +V+GD+VE+K GDRIPAD+RI+ S G KVDN++LTGESEPQSR+P+ T +N LET NIAFFSTN VEGT R +V++TGD+TVMGRIA L S L  G+TPI  EIEHFIHII+G+ V LG+ FFI++ +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MA+KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q G    +   +W  L RVA LCNRA F+AG+E+  V KR+ +GDAS
Sbjct:   35 KEVSLDDHKLSLDELHRKYGTDLSRGLTNVRAAEILARDGPNALTPPPTTPEWVKFCKQLFGGFSLLLWVGAILCFLAYGIQAATEDEPSNDNLYLGVVLSAVVIITGCFSYYQESKSSRIMDSFRNMVPQQALVIREGEKTQLNAELVVLGDLVEIKGGDRIPADLRIVSSHGCKVDNSSLTGESEPQSRSPDFTHDNPLETRNIAFFSTNCVEGTARGIVINTGDHTVMGRIATLASGLEGGRTPINIEIEHFIHIITGVAVFLGVSFFILSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTAFDKSSPTWTALARVASLCNRAVFQAGQENVPVLKRDVAGDAS 450          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001612.1 (pep scaffold:Pmarinus_7.0:GL478157:83838:93675:1 gene:ENSPMAG00000001454.1 transcript:ENSPMAT00000001612.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 269.626 bits (688), Expect = 3.311e-83
Identity = 125/257 (48.64%), Postives = 184/257 (71.60%), Query Frame = 2
Query: 2288 GRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMW-NHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTR 3055
            GR IFDNLKKSI Y L K I E+ PFL Y + SIPL +GT+TIL IDLGTD++P+IALAYE  ES+IM R+PRN   D+LV S+L + ++ Q+G+ QA G+F ++F +MAE G+LP   +G+R+ WE     +L+DSYGQEWT+ QR+Q E+ CY+A+FV++++QQ  ++++ KTRRNS+F QG++ N  +   M  +  +A F+ Y PG++  L  + LR  WW +A+ ++ ++  +DEMRKF IRR  + +WW +
Sbjct:    1 GRLIFDNLKKSIAYTLTKNIAELCPFLIYIIASIPLPIGTVTILFIDLGTDIIPSIALAYEKPESDIMNRRPRNARIDHLVNSKLATYSYLQIGVTQAVGAFLSYFTVMAEEGWLPITCIGLRKHWEQVDEQELEDSYGQEWTFVQRQQQEFVCYTAFFVAIVIQQLADLVIRKTRRNSVFTQGLFRNKVVLLGMLSQLVIAAFLSYCPGMDEGLHFMPLRVGWWFVAISYAIFIWLYDEMRKFFIRRYPE-SWWAQ 256          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010373.1 (pep scaffold:Pmarinus_7.0:GL481096:3909:20014:1 gene:ENSPMAG00000009373.1 transcript:ENSPMAT00000010373.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 256.914 bits (655), Expect = 3.977e-72
Identity = 258/885 (29.15%), Postives = 407/885 (45.99%), Query Frame = 2
Query:  584 GDRIPADVRI--IKSSGFKVDNAALTGES----EPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXX------XXXXXXXXXXWLDAVLFLIGVIVANV----PEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDES--------------WDLLMRVAI---LCNRAAFKAGEEDKVVWKRECSGDASESAL----------------LKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDPRY----LLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGE--RVLGFCDY----RLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEI-LEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVI--MAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCY---SAY----FVSVMVQ-QWCNILVVKTRRNSLFQQGMW-NHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIR 3025
            GD++PAD+R+  IKS+  +VD + LTGES    +     P+  + N  +  N+ F  TN   G    VVV TG NT +G+I +  ++    KTP+ ++++ F   +S +   + I             + G  W+   ++   + VA      PEG+ A +T  L L  ++MA+KN +V++L +VETLG TS+ICSDKTGTLT N M+V   +  ++      S N+  +T                     +D L+ +A    LCN ++    E   V  K    G+A+E+AL                L   E A       ++   K   + F S ++  +S++ T     R      + +KGAPE +++R   + +   ++ +    K++      E G   +  R L         R ++        F + EV+    G   VG   M+DPPR  V  ++  CR AGI+VI   GD+  TA AI + +GIF  D + ++D A +                       +E   + L+E  L       FAR  P  K +IVE  Q    I A+TGDGVND+PALKKA+IGIAMG SG+ V+K A++M+L DDNF+SIV  +E+GR I++N+K+ I Y++   + E+V       +  P AL  + +L ++L TD +PA AL +   + +IM R PRNP K+ L++  L                FF +  I        +         + + P +   + S+  + T +        C+   S Y     +SV+V  + CN L   +   SL +   W N  L  ++     L   I+Y   L  + ++  L    WL+ L  S  ++  DE  KFI R
Sbjct:    4 GDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVN-QDKKNMLFSGTNIAAGKAVGVVVATGVNTEIGKIRDEMAATEQDKTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWMRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIIDRADGENCSLNEFTITGSTYAPEGEVYKNDKLVRCGEYDGLIELATICALCNDSSLDFNEAKGVYEK---VGEATETALTCQVEKMNVFDTHLVGLSKVERANACNNVIKQLMKKEFTLEF-SRDRKSMSVYCTPVKPSRSSVGNKMFVKGAPEGVIDRCSHVRVGTTKLPMTAGMKEKILATIREYGTGRDTLRCLALATRDMPPRREDMNLIDSTKFASYEVDLTFVGCVGVG---MLDPPRKEVSSSIILCREAGIRVI---GDNKGTAVAICRRIGIFGED-EDVKDKAYTG----------------------REFDDLPLEEQRLACQRARCFARVEPSHKSKIVEFLQSCDEITAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRNP-KEPLISGWL----------------FFRYLAIGCYVGAATVGAAAWWFMAADDGPGVTFYQLSHFMQCTPEHPDFEGLDCHVFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWDNIWLLGAICLSMSLHFLILYVEPLPIIFQITPLNLEQWLVVLKISLPVILLDETLKFIAR 836          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Yeast
Match: PMR1 (High affinity Ca2+/Mn2+ P-type ATPase; required for Ca2+ and Mn2+ transport into Golgi; involved in Ca2+ dependent protein sorting, processing; D53A mutant (Mn2+ transporting) is rapamycin sensitive, Q783A mutant (Ca2+ transporting) is rapamycin resistant; Mn2+ transport into Golgi lumen required for rapamycin sensitivity; mutations in human homolog ATP2C1 cause acantholytic skin condition Hailey-Hailey disease; human ATP2C1 can complement yeast null mutant [Source:SGD;Acc:S000003135])

HSP 1 Score: 364.385 bits (934), Expect = 2.449e-110
Identity = 307/1006 (30.52%), Postives = 495/1006 (49.20%), Query Frame = 2
Query:  134 ITIEELYARFQTDPDKGL-TSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVL-VFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEP---QSRTPECTSNN--------ILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTW----YNNKIY-----DSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTILID-GKEIE-IDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLIS--LTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMF-FETGLAIF----IVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRR--DKDRNWWT 3052
            ++++E   +  TD + GL +S EA  R    G N +T  +      KF+   +    ILL +G+ +      + +G   DA      + I L +F+VV  G   + Q+ +S K + +  K+VP +  + R G    V   TLV GD+V  + GDRIPAD+RII++    +D + LTGE+EP    S+T E +S N        I E S IA+  T   EG  + +VV TG NT  G +  + +++   KTP+   ++     +S +   +  +  ++  + G  WL+     + + VA +PEG+   VTV L L   +MA++  +V+ L +VETLGS ++ICSDKTGTLT N MTV+  W     +NK+       +  ++N  G     + E     + +  LCN A+F   +E  +       G+ ++ ALL+  +LA  +  + R    KV E+PFNS  K  ++    N  D +  + +KGA ERILE S + L   GK+ E + E  K   N     M   G RV GF    L +       P   D +        F GLI M DPPRP+V  A+ +    G+ +IM+TGD   TA  IAK +GI                 P+  ++P   K  V+ G  L EM+  QL  +++ H+ I FAR +P+ KL IV   +++G +VA+TGDGVND+PALK +DIG++MG  G+DV+K+A+DM+L DD+F++I+  IE+G+ IF+N++  + + L  ++  +      T   +P  L  + IL I++  D  PA +L  E  +  +M++ PR    D ++T  ++   LT     I+   G+ + F   MAE+G +  R                               + +TC+  +          N L  +    S+F+ G + ++    MF +  GL++      +Y P   ++ K   L  +  L+ L  S  +   DE+RK   R+  ++D  +++
Sbjct:   41 LSVDEALEKLDTDKNGGLRSSNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVV----SLFMGNIDDA------VSITLAIFIVVTVG---FVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGMICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSNGNLKNYLTEDVRETLTIGNLCNNASF--SQEHAIFL-----GNPTDVALLE--QLANFEMPDIRNTVQKVQELPFNSKRKL-MATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSMASEGLRVFGFAKLTLSDS----STPLTEDLIK----DLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGI-----------------PV--IDP---KLSVLSGDKLDEMSDDQLANVID-HVNI-FARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAFKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKR-TDKILTHDVMKRLLTTAACIIV---GTVYIFVKEMAEDGKVTAR----------------------------DTTMTFTCFVFF-------DMFNALACRHNTKSIFEIGFFTNK----MFNYAVGLSLLGQMCAIYIPFFQSIFKTEKLGISDILLLLLISSSVFIVDELRKLWTRKKNEEDSTYFS 948          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Yeast
Match: ENA2 (P-type ATPase sodium pump; involved in Na+ efflux to allow salt tolerance; likely not involved in Li+ efflux [Source:SGD;Acc:S000002446])

HSP 1 Score: 269.626 bits (688), Expect = 9.165e-76
Identity = 304/1107 (27.46%), Postives = 479/1107 (43.27%), Query Frame = 2
Query:  128 HIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGF-SILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETS-----NIAFFSTNAVEGTCRCVVVDTGDNTVMGRIAN----------------------LTSSLTTGK-------TPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWY---------NNKIYDSPT---------------SENQIG-----------LTNKQVDESWDL-----LMRVAILCNRAA-FKAGEEDKVVWKRECSGDASESAL--------LKYGELAKGKTTEYREENPK-----------------VIEVPFNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTIL-IDGKEIE--IDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPL------TGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISI---------PLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGII--QAFGSFFAFFVIMAEN--GFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNIL----VVKTRRNSL------------FQQGMWNHQLTF-SMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRR 3028
            H +T EE      T   +GLT +E+  RL+  G N+L    G    + +   +L    + ++ V  I   I++ ++   T          G V+ FV+         Q+ K++K M+S   +    A V R+G    + ++ +V GDI  VK GD IPAD+R+I++  F  D + LTGES P S+          ETS     N+AF S+  V+G  + +V+ T  N+ +G+IA                       +++   TG        TP+ +++     ++  I V   II            +   ++ I V ++ +P  ++  +T+ +++ A  M  +N +V+ L+++E LG+ + ICSDKTGTLTQ  M     W          N+    +P                S N+ G           L  K + E  D+      +  A L N A  FK    D   WK    GD +E A+        L +  L   K+T    EN +                 + E PF+ST K   S++  N+ +  Y +  KGA E I+    +    DG +I    D   +    N Y  +   G RVLGF       K F K    D    N         +   F+GLI + DPPR     AV K   AGI V M+TGD   TAKAIA+ VGI  P N             +   +     + V+ GS    ++  ++D++    L +V AR SPQ K++++E   R+    A+TGDGVNDSP+LK A++GIAMGI+GSDVSK+A+D++L DDNFASI+  +E+GR++ DN++K ++ +L + + + +    Y +I +            L  + +L I + T   PA+ L  E A  ++M R P +                 ++GI   +     FA+ +IM  +        L G         IN  +  +  + TY    +  Y   SA F ++    WC ++    VV  RR+              F + +W +Q  F S+ F    A  +VY P +N  + L       W +A+ F+       E+ K   RR
Sbjct:   18 HTLTTEEAAEFIGTSLTEGLTQDESLRRLKAVGENTL----GDDTKIDYKAMVLHQVCNAMIMVLVISMAISFAVRDWIT----------GGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRV--AIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATD--CWK--AHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVY-YNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVY-SLSNEGLRVLGFA-----SKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGIL-PTN-------------LYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPV--LPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQAL----YLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHD----------------SEVGIFTWEVIIDTFAYGIIMTGSCMASFTGSLYG---------INSGRLGHDCDGTYNSSCRDVYRSRSAAFATM---TWCALILAWEVVDMRRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWGLAIAFTIAFWIGAELYKCGKRR 1049          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Yeast
Match: ENA5 (Protein with similarity to P-type ATPase sodium pumps; member of the Na+ efflux ATPase family [Source:SGD;Acc:S000002445])

HSP 1 Score: 269.626 bits (688), Expect = 1.096e-75
Identity = 309/1103 (28.01%), Postives = 480/1103 (43.52%), Query Frame = 2
Query:  128 HIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGF-SILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETS-----NIAFFSTNAVEGTCRCVVVDTGDNTVMGRIAN----------------------LTSSLTTGK-------TPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWY---------NNKIYDSPT---------------SENQIG-----------LTNKQVDESWDL-----LMRVAILCNRAA-FKAGEEDKVVWKRECSGDASESAL--------LKYGELAKGKTTEYREENPK-----------------VIEVPFNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTIL-IDGKEIE--IDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPL------TGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISI---------PLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNIL----VVKTRRNSL------------FQQGMWNHQLTF-SMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRR 3028
            H +T EE      T   +GLT +E+  RL+  G N+L    G    + +   +L    + ++ V  I   I++ ++   T          G V+ FV+         Q+ K++K M+S   +    A V R+G    + ++ +V GDI  VK GD IPAD+R+I++  F  D + LTGES P S+          ETS     N+AF S+  V+G  + +V+ T  N+ +G+IA                       +++   TG        TP+ +++     ++  I V   II            +   ++ I V ++ +P  ++  +T+ +++ A  M  +N +V+ L+++E LG+ + ICSDKTGTLTQ  M     W          N+    +P                S N+ G           L  K + E  D+      +  A L N A  FK    D   WK    GD +E A+        L +  L   K+T    EN +                 + E PF+ST K   S++  N+ +  Y +  KGA E I+    +    DG +I    D   +    N Y  +   G RVLGF       K F K    D    N         +   F+GLI + DPPR     AV K   AGI V M+TGD   TAKAIA+ VGI  P N             +   +     + V+ GS    ++  ++D++    L +V AR SPQ K++++E   R+    A+TGDGVNDSP+LK A++GIAMGI+GSDVSK+A+D++L DDNFASI+  +E+GR++ DN++K ++ +L + + + +    Y +I +            L  + +L I + T   PA+ L  E A  ++M R P N  +  + T  +I  T    GII   GS  A F            L G         IN  +  +  + TY    +  Y   SA F ++    WC ++    VV  RR+              F + +W +Q  F S+ F    A  +VY P +N  + L       W +A+ F+       E+ K   RR
Sbjct:   18 HTLTTEEAAEFIGTSLTEGLTQDESLRRLKAVGENTL----GDDTKIDYKAMVLHQVCNAMIMVLVISMAISFAVRDWIT----------GGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRV--AIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATD--CWK--AHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVY-YNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVY-SLSNEGLRVLGFA-----SKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGIL-PTN-------------LYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPV--LPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQAL----YLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPP-NDSEVGIFTWEVIIDTFA-YGIIMT-GSCMASFT---------GSLYG---------INSGRLGHDCDGTYNSSCRDVYRSRSAAFATM---TWCALILAWEVVDMRRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWGLAIAFTIAFWIGAELYKCGKRR 1049          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Yeast
Match: ENA1 (P-type ATPase sodium pump; involved in Na+ and Li+ efflux to allow salt tolerance [Source:SGD;Acc:S000002447])

HSP 1 Score: 266.159 bits (679), Expect = 1.727e-74
Identity = 300/1106 (27.12%), Postives = 472/1106 (42.68%), Query Frame = 2
Query:  128 HIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETS-----NIAFFSTNAVEGTCRCVVVDT--------------GDNTVMGRIAN--------LTSSLTTGK-------TPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWY---------NNKIYDSPT---------------SENQIG-----------LTNKQVDESWDL-----LMRVAILCNRAA-FKAGEEDKVVWKRECSGDASESAL--------LKYGELAKGKTTEYREENPK-----------------VIEVPFNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTIL-IDGKEIE--IDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPL------TGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISI---------PLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGII--QAFGSFFAFFVIMAEN--GFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNIL----VVKTRRNSL------------FQQGMWNHQLTF-SMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRR 3028
            H +T EE      T   +GLT +E   RL+  G N+L            +  +     ++L +  I+ F              M +   G V+ FV+         Q+ K++K M+S   +    A V R+G    + ++ +V GDI  VK GD IPAD+R+I++  F  D + LTGES P S+          ETS     N+AF S+  V+G  + +V+ T              GD+ ++ R  +        +++   TG        TP+ +++     ++  I V   II            +   ++ I V ++ +P  ++  +T+ +++ A  M  +N +V+ L+++E LG+ + ICSDKTGTLTQ  M     W          N+    +P                S N+ G           L  K + E  D+      +  A L N A  FK    D   WK    GD +E A+        L +  L   K+T    EN +                 + E PF+ST K   S++  N+ +  Y +  KGA E I+    +    DG +I    D   +    N Y  +   G RVLGF       K F K    D    N         +   F+GLI + DPPR     AV K   AGI V M+TGD   TAKAIA+ VGI  P N             +   +     + V+ GS    ++  ++D++    L +V AR SPQ K++++E   R+     +TGDGVNDSP+LK A++GIAMGI+GSDVSK+A+D++L DDNFASI+  +E+GR++ DN++K ++ +L + + + +    Y +I +            L  + +L I + T   PA+ L  E A  ++M R P +                 ++GI   +     FA+ +IM  +        L G         IN  +  +  + TY    +  Y   SA F ++    WC ++    VV  RR+              F + +W +Q  F S+ F    A  +VY P +N  + L       W +A+ F+       E+ K   RR
Sbjct:   18 HTLTAEEAAEFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCNAMIMVLLISMIISF-------------AMHDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRV--AIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATD--CWK--AHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVY-YNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVY-SLSNEGLRVLGFA-----SKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGIL-PTN-------------LYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPV--LPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQAL----YLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHD----------------SEVGIFTWEVIIDTFAYGIIMTGSCMASFTGSLYG---------INSGRLGHDCDGTYNSSCRDVYRSRSAAFATM---TWCALILAWEVVDMRRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWGLAIAFTIAFWIGAELYKCGKRR 1049          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Yeast
Match: PMA1 (Plasma membrane P2-type H+-ATPase; pumps protons out of cell; major regulator of cytoplasmic pH and plasma membrane potential; long-lived protein asymmetrically distributed at plasma membrane between mother cells and buds; accumulates at high levels in mother cells during aging, buds emerge with very low levels of Pma1p, newborn cells have low levels of Pma1p; Hsp30p plays a role in Pma1p regulation; interactions with Std1p appear to propagate [GAR+] [Source:SGD;Acc:S000002976])

HSP 1 Score: 203.756 bits (517), Expect = 2.094e-54
Identity = 210/823 (25.52%), Postives = 370/823 (44.96%), Query Frame = 2
Query:  161 FQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGF-KVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENG 2626
             QTDP  GLTS+E   R ++ GLN +   E    +VKF+   +G    ++   AIL   A G+          D +  G++   +++  G   + Q+ ++  I+    K +   A V R G L+++    +V GDI++++ G  IP D RI+    F ++D +A+TGES    +             +  F S+    G    VV  TGDNT +GR A L +    G+    + +     I+  + ++  ++ +   F   +  +  + + +G+ +  VP G+ A VT  + + A  +A+K  +V+ L A+E+L    I+CSDKTGTLT+N +++   +    +  SP                 DL++   +  +R        DK   K       ++ AL KY      K  E+          PF+  +K   ++ E+ +G+   ++ +KGAP  +L+  +      ++  I E   + + N   E+   G R LG    R +                     +  +G++  +DPPR      V++ R  G++V M+TGD          AVGI     +T   + L   +  +E                 +M   +L + +E      FA   PQ K ++VE  Q +G +VA+TGDGVND+P+LKKAD GIA+    +D ++ AAD++ L    ++I+  ++  R+IF  +   ++Y +  ++  +  FL   +  +  +L    I+ I +  D +  +A+AY+ A  +     P+ P+K NL     +S+    LGI+ A GS+     +    G
Sbjct:   80 LQTDPSYGLTSDEVLKRRKKYGLNQMAD-EKESLVVKFVMFFVGPIQFVMEAAAIL---AAGLS---------DWVDFGVICGLLMLNAGV-GFVQEFQAGSIVDELKKTLANTAVVIRDGQLVEIPANEVVPGDILQLEDGTVIPTDGRIVTEDCFLQIDQSAITGESLAVDK----------HYGDQTFSSSTVKRGEGFMVVTATGDNTFVGRAAALVNKAAGGQGHFTEVLNGIGIILLVLVIATLLLVWTACFYRTNGIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGV--SPD----------------DLMLTACLAASRKKKGLDAIDKAFLKSLKQYPKAKDALTKY------KVLEFH---------PFDPVSKKVTAVVESPEGE--RIVCVKGAPLFVLKTVE------EDHPIPEDVHENYENKVAELASRGFRALGVARKRGEGH-------------------WEILGVMPCMDPPRDDTAQTVSEARHLGLRVKMLTGD----------AVGI---AKETCRQLGLGTNIYNAERLGLGGGG---------DMPGSELADFVENADG--FAEVFPQHKYRVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSL-HLEIFLGLWIAILDNSLDIDLIVFIAIFAD-VATLAIAYDNAPYS-----PK-PVKWNLPRLWGMSII---LGIVLAIGSWITLTTMFLPKG 782          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Nematostella
Match: EDO40680 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6M1])

HSP 1 Score: 1212.59 bits (3136), Expect = 0.000e+0
Identity = 626/991 (63.17%), Postives = 760/991 (76.69%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETND----------------GDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDA-DEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRR 3028
            ++++ D H IT+EEL  R  T+   GLT EEAA RL+RDG N+LTP   TPE VKF+K + GGF++LLW+GAILCFIA GI   T ++   DNLYLGIVL FVV+ TG F YYQ++KSSKIM SF  +VPQ+A+V RSG    V  E LV+GD+V VK GDR+P D+RI++   FKVDN++LTGESEPQSR P+CT  N LET N+AFFST A+EG    VVV TGDNTVMGRIANL S L +GKTPI  EIEHFIHII+G+ V LG+ FFIIAF+L   WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MA KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH WY+N I ++ TSE+Q   + ++   +W  L RVA LCNRA FKA +EDK V KREC+GDASESALLKY ELA G    +R+ + KV E+PFNSTNKYQVSIHE  D                 + +++LVMKGAPERIL+R  TIL++GKE  +D+  K+ FN AY+++GG+GERVLGFC + L  + FP GF FD  D  NFPL G  FVGL+SMIDPPR +VPDAV+KCRSAGIKVIMVTGDHPITAKAIAK VGI S   +T+EDIA    +P+ EV+  +AKA V+HGS LK+    ++D IL  H EIVFARTSPQQKL IVEGCQR GAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + ++ IPL LGT+TILCIDLGTDM+PAI+LAYE AE++IM+R+PR+P+ D LV  RLI++ +GQ+G+IQA   FF +FVIMAENGF P  L G+R  W++   + + DSYGQEW Y QRK LEYTC++A+FVS+++ QW ++++ KTRRNSLF QGM N  L F +FFET LA F  YTPG++  L++  L + WW  A+PFS  +  +DE R++I+RR
Sbjct:   65 QELDVDWHRITVEELMTRLDTNVQTGLTDEEAAIRLKRDGPNALTPPPTTPEWVKFMKQMFGGFAMLLWIGAILCFIAQGIMEATEEEPLRDNLYLGIVLAFVVIVTGIFSYYQESKSSKIMESFKNLVPQEANVLRSGGRKTVGAENLVIGDVVSVKGGDRLPGDIRILECKSFKVDNSSLTGESEPQSRGPDCTHENPLETRNLAFFSTYALEGNATGVVVQTGDNTVMGRIANLASGLGSGKTPIAVEIEHFIHIITGVAVFLGVTFFIIAFILKYKWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHLWYDNNIVEADTSEDQKQASGEKKSTTWYALSRVATLCNRAEFKADQEDKPVLKRECTGDASESALLKYVELAIGNVISFRKNHKKVCEIPFNSTNKYQVSIHEIPDEPEHDIEEGSDVDEREKNSKHILVMKGAPERILDRCSTILVNGKEQALDDKEKENFNQAYLDLGGLGERVLGFCHFYLPTEQFPLGFEFDPEDNPNFPLEGLCFVGLMSMIDPPRAAVPDAVSKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGTETVEDIAERLNIPVEEVDETKAKAIVVHGSQLKDYDQEKIDGILCNHTEIVFARTSPQQKLIIVEGCQRMGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLMFIILDIPLPLGTVTILCIDLGTDMVPAISLAYEHAENDIMKRQPRDPINDKLVNERLIAMAYGQIGMIQASAGFFTYFVIMAENGFRPSLLFGLRRQWDDKYNHSVVDSYGQEWGYSQRKILEYTCHTAFFVSIVIVQWADLIICKTRRNSLFTQGMTNKFLNFGLFFETALAAFFSYTPGMSNGLRMYPLNWQWWFPAMPFSLIIWIYDECRRWILRR 1055          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Nematostella
Match: EDO36455 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SII2])

HSP 1 Score: 1149.42 bits (2972), Expect = 0.000e+0
Identity = 610/977 (62.44%), Postives = 747/977 (76.46%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKREC-SGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDPRY--LLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRR 3028
            +++E D H + +E L  R  +  +KGL+ EEA  RLERDG N LTP   TPE VKF+K L GGFS+LLWVGAI C+I Y I++   ++ P D+LYLG+ L FVVV T CF YYQ++KSSKIM SF  MVPQ+A++ R G  +    E +V+GDI+ V  GDR+PAD+R+I+S GFKVDN++LTGESEPQ+R PE T  N LET N+AFFSTNAVEGTC  +VV TGDNTVMGRIA L S L +GKTPI  EI HFIHII+G+ V+LG+ FFII+ +LG   L AV+FLIG+IVANVPEG+LATVTV LTLTAK+MA KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++NK +++ T+E+Q G T  +  E+W  L R+A LCNRA F +G+++  V +R+   G+ASE+ALLK  EL  G  T+ REE  +V E+PFNSTNKY VSIHE ND +  Y   L+MKGAPER+L+R  TILI G+   +D+  K  F  AY+++GGMGERVLGF  + LD++ FP GF F+ DE NFP+ G  FVGL+SMIDPPR +VPDAVAKCRSAGIKV MVTGDHPITAKAIA+ VGI S   +T+EDI+L   +P+ EV+  +A A V+HG +LK+MT   +D+IL+ H EIVFARTSPQQKL IVEGCQR GAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + V  IP  LGTITILCIDLGTDM+PAI+LAYE AES+IM+R PR+P  + LV  RLIS+T+GQ+G +QA   F  +FVIMAENGFLP  L  IR  WE+   N L DSYGQEW Y QRK LE+TC+SA+FVS++V QW ++++ KTRRNS+  Q M NH L   + FET LA F++YTPGL+T L L  L  +WW I +P+S  +  +DE+R++I+R+
Sbjct:   72 QELEVDWHKVPLEALVNRLDSSVEKGLSQEEAEVRLERDGPNCLTPPPTTPEWVKFLKLLFGGFSLLLWVGAIFCYIVYSIKMSVEEEPPQDDLYLGVTLTFVVVVTACFSYYQESKSSKIMDSFKNMVPQEATILRDGKKVVKNAEQVVIGDIIFVAIGDRVPADIRVIESKGFKVDNSSLTGESEPQARGPEFTHENPLETKNLAFFSTNAVEGTCTGIVVQTGDNTVMGRIAGLASGLGSGKTPIAIEIGHFIHIITGVAVALGVTFFIISLVLGYTILQAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAAKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKTFEADTTEDQSG-TAMEKTETWTALGRIAGLCNRAEFVSGQDNVAVLRRDTMGGNASEAALLKCVELQVGSVTKMREEFHRVAEIPFNSTNKYHVSIHEINDENSTYSHHLLMKGAPERVLDRCSTILIKGELKPLDDDMKQAFEMAYLDLGGMGERVLGFAQHYLDKENFPIGFEFETDEPNFPVEGLCFVGLMSMIDPPRAAVPDAVAKCRSAGIKVFMVTGDHPITAKAIAQGVGIISEGTETVEDISLRLEIPVEEVDKSQADAIVVHGGELKDMTDKDIDDILKNHKEIVFARTSPQQKLIIVEGCQRNGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLMFIVAGIPQPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRMPRDPRTEKLVNERLISMTYGQIGFMQASAGFLTYFVIMAENGFLPGDLFNIRGLWEDKTNNTLLDSYGQEWGYAQRKVLEFTCHSAFFVSIVVVQWADLIICKTRRNSIITQKMNNHILIIGLIFETALAAFLLYTPGLSTALSLYGLNASWWFIGVPYSILIFVYDEVRRYILRK 1047          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Nematostella
Match: EDO35616 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL15])

HSP 1 Score: 338.576 bits (867), Expect = 8.820e-101
Identity = 290/1003 (28.91%), Postives = 473/1003 (47.16%), Query Frame = 2
Query:  134 ITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRT----PECTSNN-ILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGV--IVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPT------------SENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQ-VSIHETNDGDP-----RYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIV-YTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRR-DKDRNWWTREN 3061
            + +EE+  +F TD  +GL+++E   R    G N     E      K++        +LL     +      I +G   DA   ++ + I++V  V F       Q+ +S K + +  K+VP +    R+G + +     LV GD+V +  GDR+PAD+R+ ++   ++D ++ TGE EP S+T    P   S + +    NIAF  T    G  + VV+ TG+N+  G I  L  +  T KTP+ K ++     +S   + +  +  ++ ++     L+  +F IGV   VA +PEG+   VTV L L   +MA++N +VK L  VETLG +S+ICSDKTGTLT+N MTV+  +  +  Y   T            +E+ I  T+   + S    +    LCN A+ + G    V++     G  +E A++   +  K  T     +  +V E PF+S  K   V     +         R +  +KGAPE ++ +  +   +G  + +     +   +A + M   G RV+ F                        L    ++G++ ++DPPR  V +AV     +G++V M+TGD   TA  IA+ +GI              +G P             + G +L+ +  +QL  I++     VF R SP+ K+ IV+  Q+ G +VA+TGDGVND+ ALK+ADIGIAMG SG+DVSK+AA+MIL+DD+F +I+  IE+G+ IF N+K  + + L  +I  I      T + +P  L  + IL I++  D  PA +L  E  +S++MRR PRN +K  ++T  LI+       ++   G+ + F+  M +N   P                  +D+            + +TC+  +          N L  +++  S+FQ G   +++       + +  F+V Y   L  V +   L  T  L+ L  S  +   DE+RKFI  R  K R    +E 
Sbjct:   14 MAVEEVLKQFNTDQSRGLSNDEIERRRMLHGWNEFDVVEEKALWKKYLDQFKEPMILLLLASGFV-----SICMGQFDDA--FSITVAILIVVTVAFV------QEYRSDKSVEAITKLVPPQCHCVRAGKMFNFLARCLVPGDLVCISIGDRVPADIRLTEAVDLEIDESSFTGEMEPASKTTLPIPAVNSGSGVSARRNIAFMGTLVRSGRGKGVVIGTGENSEFGEIFKLMKAEETPKTPLQKSMDSLGKQLSFYSLCIIGLIVLLGWIQKRAILE--MFTIGVSLAVAAIPEGLPIVVTVTLALGVMRMAKRNAIVKKLPIVETLGCSSVICSDKTGTLTKNEMTVSQIFTADGFYAEATGVGYSPLGEVILNEDPITYTS---NSSIAKTVEAGYLCNNASIRNG----VLY-----GQPTEGAIVTVAQ--KASTFTCGIDFVRVDERPFSSEKKLMAVKCRRKHRSSAMAEIARDIYYVKGAPENVMRQCTSYYKNGSAVPMTAKDVERIGDAVLAMSSRGLRVIAFAHGE-------------------DLQQLTYLGIMGLLDPPRNGVREAVRTLLDSGVQVKMITGDSRETAITIAELLGIHF------------KGRP------------TLSGEELEALDGLQLSTIIDQVS--VFYRVSPRHKVAIVKALQQHGHVVAMTGDGVNDAVALKRADIGIAMGKSGTDVSKEAAEMILVDDDFNTIMAAIEEGKGIFYNIKNFVRFQLSTSIAAISLITISTFLKLPNPLNAMQILWINIIMDGPPAQSLGVEPVDSDVMRRPPRN-VKSPMITKTLIAKVISA-ALLIVCGTLWVFWREMRDNIITP------------------RDT-----------TMTFTCFVFF-------DMFNALSCRSQEKSIFQVGFLTNRMFLYAVGGSLIGQFLVIYFAPLQAVFQTEALHITDILLLLAVSSSVFIVDEIRKFITYRVSKRRRQAAKEK 904          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Nematostella
Match: EDO47465 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM93])

HSP 1 Score: 329.331 bits (843), Expect = 1.049e-96
Identity = 306/1042 (29.37%), Postives = 487/1042 (46.74%), Query Frame = 2
Query:  125 SHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILL----WVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCR---SGILIDVATETLVVGDIVEVKFGDRIPADVRI--IKSSGFKVDNAALTGES----EPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXX------XWLDAVLFLIGVIVANV----PEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSE-----------NQIGLTNKQ----VDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGEL-------AKGKT-TEYREENPKVIEVPFN-------STNKYQVSIH--ETNDGDPRYL-----LVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADE--VNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALS-RGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQ-RKQLEYTCYSAYF---------VSVMVQ-QWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIF-IVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIR 3025
            +H   + E+   F     KGL   +     ++ G N L   +G P      K +L  F  LL     V A++ F+    + G  Q          IV++ +++       +Q+  +   + +  +  P+ A V R   SGI + +    LV GDIVEV  GD++PAD+RI  IKS+  +VD + LTGES    +     P+  + N  + +N+ F  TN   G C  VVV TG +T +G+I +        +TP+ ++++ F   +S +   + I  + I     +       WL   ++   + VA      PEG+ A VT+ L L  ++MA+KN +V++L +VETLG TS+ICSDKTGTLT N M+V H ++  K      +E           + +G   K         +++L   A +C+     + + + V    E  G+++E+AL+   E         +GKT  +      + I+  FN       S ++  +S++     DG   +L     + +KGAPE IL+R   + +  K+  +    K +  +     G   + +       +D+ + P     +A E  VN+  +   FVG+  M+DPPRP V DA+  C  AGI+VI++TGD+  TA+AI + + +F  D  T     LS  G    ++ P E +   +                       +F+R  P  K +IV   Q +G I A+TGDGVND+PALKKA+IG+AMG SG+ V+K A++MIL DDNF++IV  +E+GR I+DN K+ I Y++   I E+V       + +P AL  + +L ++L TD  PA AL++   +S+IM + PR+P                     Q   S + FF  +A   ++    VG    W     N  K SY Q   + Q      +    A F         +SV+V  +  N L       SL     W +    +    + L  F I+Y P  NT+ ++  L +  W+  L FSF ++  DE+ KFI R
Sbjct:    4 AHTKPVPEILKYFNVSESKGLDPAQVKQFQKKFGPNELPAEDGKP----LWKLVLEQFDDLLVKILLVAAVISFVLALFEEGEDQTTA---FVEPIVILVILILNAIIGVWQERNAESAIEALKEYEPEIAKVQRQDKSGIQM-IKARDLVPGDIVEVAVGDKVPADIRITTIKSTTLRVDQSILTGESISVVKHTDAIPDERAVN-QDKTNMLFSGTNIASGKCSGVVVGTGLSTQIGKIRDQMIPSDDERTPLQQKLDEFGEQLSKVITIICIAVWAINIGHFNDPIHGGSWLKGAIYYFKIAVALAVAAIPEGLPAVVTICLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV-HKFFVMKDISRGRAEFHEFEVEGTTYDPVGDITKDGRNVTTSDYEVLPEFATICSLCNDSSVDYNNVRDSYEKVGESTETALIVLVEKLNVLNVDLEGKTKAQLATICNESIKNHFNKEFTLEFSRDRKSMSVYCVPQKDGPNSFLDGKPKMFVKGAPEGILDRCDFVRVGNKKHPMTPKMKAQILDLIKAYGTGADTLRCLALATVDDPIAPSKMDLEASEKFVNYE-SHMTFVGVAGMLDPPRPEVTDAIKLCAKAGIRVIVITGDNKATAEAICRRIEVFGQDEDT---TGLSYSGREFDDLTPSEQREACLRAR--------------------LFSRVEPSHKSKIVTYLQEEGEISAMTGDGVNDAPALKKAEIGVAMG-SGTAVAKTASEMILADDNFSTIVAAVEEGRSIYDNTKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLMTDGPPATALSFNPPDSDIMSKPPRSPR--------------------QPLISGWLFFRYLAIGVYVGCATVGASAWWFMFYENGPKVSYYQLTHHMQCGTDPSFGLDCAVFGDLHPMTMALSVLVTIEMFNALNSLAENESLLTMPPWRNPSLLTAIAASFLMHFLILYFPITNTIFRITPLNWVEWMAVLKFSFPVILLDEVLKFISR 990          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Nematostella
Match: EDO41775 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3I0])

HSP 1 Score: 206.838 bits (525), Expect = 1.356e-54
Identity = 202/594 (34.01%), Postives = 291/594 (48.99%), Query Frame = 2
Query:  947 WLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDE-----SWDLLMRVAILCNRAAFKAGEEDKVVWK--REC----SGDASESALLKYGELAKGKTTEYREENPKVIEVP---FNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTILIDGKEIE--IDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKG-----FPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEG-----CQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYIL-VKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLIS--LTHGQLGIIQAFGSFFA---FFVIMAENGFL 2632
            +++A +  + V+V  VPEG+   VT+ L  + KKM   N LV++L+A ET+G+ + ICSDKTGTLT N MTV   +              +G  +K + E     S +LL    ILC   A  +      V    RE      G+ +E ALL           +YR+ NP+   V    FNS+ K   +     DG   Y L  KGA E +L R  +I+    + E    +       +    M   G R +    YR      P G      P D D+    L+    + +  + DP R  VP A+ KC+ AGI V MVTGD+  TA++IA   GI  PD    +D  +  G    E N       +I  S+ + ++  + DEI  +    V AR+SP+ K  +V+G           IVAVTGDG ND PALKKAD+G AMGI+G+DV+K+A+D+IL DDNF SIV+ +  GR ++D++ K + + L V  +  ++ F+   V+ +    GT  +L ++L  D   ++ALA E     ++ RKP    K  L+T  +I   L HG   II  F   F    FF I  E+GFL
Sbjct:  384 YVNAFITGLTVLVVAVPEGLPLAVTISLAYSVKKMLDDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQLY-------------TMGQHHKTIPENPKEFSPELL---EILCKGIALNSSYASNCVVNGGREILPMQVGNKTECALLGLVLDLGDTYQDYRDNNPESTFVKVYTFNSSRKSMSTAIRMPDGG--YRLFSKGASEILLSRCTSIIGRNGQPEPFSSQDCLSLVQSVIEPMASDGLRTICMA-YR---DFPPTGKDHDDTPPDWDDEAGILSEMTAIAIAGIEDPVRQEVPAAIKKCQQAGIVVRMVTGDNVNTARSIAGKCGILEPD----KDFLVLDG---KEFNK------LIRDSNGR-VSQKKFDEI--WPRLRVLARSSPEDKYTLVKGIIDSKLNPAREIVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFRSIVMAVMWGRNVYDSISKFLQFQLTVNLVAIVIAFVGACVVEVSPLTGT-QLLWVNLIMDSFASLALATEPPTEELLTRKPYGRTKP-LITRTMIRNILGHGVYQIIVLFVLVFKGAEFFDI--EDGFL 935          

HSP 2 Score: 56.6102 bits (135), Expect = 5.066e-8
Identity = 40/154 (25.97%), Postives = 75/154 (48.70%), Query Frame = 2
Query:  398 IVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKE 859
            ++ V +V        YQ  +  + + S  ++   K +V R+G   ++    +VVGD+ ++K+GD +PAD  +++S+  KVD ++LTGES+   +          E   +    T+ +EG+ + +V   G N+  G I  L  +    K   G +
Sbjct:  148 LIAVCIVALVTAVNDYQKEQQFRGLQSKIEL-EHKFTVIRNGDAKEILNSEIVVGDLCQIKYGDLLPADGVVVQSNDLKVDESSLTGESDMVKKG---------EKDPLFLAGTHIMEGSGKMIVTAVGLNSQSGIIFTLLGATHPDKIDSGDD 291          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Medaka
Match: atp1a3a (sodium/potassium-transporting ATPase subunit alpha-3 [Source:NCBI gene;Acc:101168472])

HSP 1 Score: 1269.22 bits (3283), Expect = 0.000e+0
Identity = 641/975 (65.74%), Postives = 778/975 (79.79%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETND-GDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRR 3028
            ++V    H +++EE+  ++ TD  +GLT+  AA  L RDG N+LTP   TPE VKF + L GGFSILLW+GAILCF+AY IQ  T  +   DNLYLGIVL  VV+ TGCF Y+Q+AKSSKIM SF  MVPQ+A V R G  + +  E +V GD+VEVK GDRIPAD+R+I S G KVDN++LTGESEPQ+R+P+CT +N LET NIAFFSTN VEGT R +VV TGD TVMGRIA LTS L TGKTPI KEIEHFI II+G+ V LG+ FFI++ +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q G +  +   +W  L R+A LCNRA FKAG++   + KRE +GDASESALLK  EL+ G     R++N KV E+PFNSTNKYQ+SIHE  D  D RYLLVMKGAPERIL+R  TI+I GKE  +D+  ++ F NAY+E+GG+GERVLGFC   + E  +PKGF FD D+VNF      FVGLISMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+S+VNPR+AKACVIHG+DLK++T  Q+D+IL  H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGISGSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + +++IPL LGTITILCIDLGTDM+PAI+LAYE AES+IM+R+PRNPL+D LV  RLIS+ +GQ+G+IQA G FFA+FVIMAENGFLP  LVGIR +W++   NDL+DSYGQ+WTY+QRK +E+TC++A+FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+ +WW  A P+SF +  +DE+RK I+RR
Sbjct:   36 KEVPITEHKMSVEEVCRKYNTDIVQGLTNALAAEYLARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYAIQAATEDEPAGDNLYLGIVLSAVVIITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKMQINAEQVVAGDLVEVKGGDRIPADLRVISSHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNIAFFSTNCVEGTARGIVVCTGDRTVMGRIATLTSGLETGKTPIAKEIEHFIQIITGVAVFLGVTFFILSIVLGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGSSFDKSSTTWVSLARIAALCNRAVFKAGQDALPILKREVAGDASESALLKCIELSCGPIKVIRDKNKKVAEIPFNSTNKYQLSIHENEDENDNRYLLVMKGAPERILDRCSTIMIQGKEQPMDDEMREAFQNAYLELGGLGERVLGFCHLFMPEDKYPKGFAFDTDDVNFSTENLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDLTQEQMDDILRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFILVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPLRDKLVNERLISIAYGQIGMIQALGGFFAYFVIMAENGFLPSLLVGIRLNWDDRSNNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKVILRR 1010          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Medaka
Match: atp1a3a (sodium/potassium-transporting ATPase subunit alpha-3 [Source:NCBI gene;Acc:101168472])

HSP 1 Score: 1268.45 bits (3281), Expect = 0.000e+0
Identity = 643/985 (65.28%), Postives = 781/985 (79.29%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETND-GDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            ++V    H +++EE+  ++ TD  +GLT+  AA  L RDG N+LTP   TPE VKF + L GGFSILLW+GAILCF+AY IQ  T  +   DNLYLGIVL  VV+ TGCF Y+Q+AKSSKIM SF  MVPQ+A V R G  + +  E +V GD+VEVK GDRIPAD+R+I S G KVDN++LTGESEPQ+R+P+CT +N LET NIAFFSTN VEGT R +VV TGD TVMGRIA LTS L TGKTPI KEIEHFI II+G+ V LG+ FFI++ +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MARKNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q G +  +   +W  L R+A LCNRA FKAG++   + KRE +GDASESALLK  EL+ G     R++N KV E+PFNSTNKYQ+SIHE  D  D RYLLVMKGAPERIL+R  TI+I GKE  +D+  ++ F NAY+E+GG+GERVLGFC   + E  +PKGF FD D+VNF      FVGLISMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+S+VNPR+AKACVIHG+DLK++T  Q+D+IL  H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGISGSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + +++IPL LGTITILCIDLGTDM+PAI+LAYE AES+IM+R+PRNPL+D LV  RLIS+ +GQ+G+IQA G FFA+FVIMAENGFLP  LVGIR +W++   NDL+DSYGQ+WTY+QRK +E+TC++A+FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+ +WW  A P+SF +  +DE+RK I+RR     W  +E
Sbjct:   36 KEVPITEHKMSVEEVCRKYNTDIVQGLTNALAAEYLARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYAIQAATEDEPAGDNLYLGIVLSAVVIITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKMQINAEQVVAGDLVEVKGGDRIPADLRVISSHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNIAFFSTNCVEGTARGIVVCTGDRTVMGRIATLTSGLETGKTPIAKEIEHFIQIITGVAVFLGVTFFILSIVLGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGSSFDKSSTTWVSLARIAALCNRAVFKAGQDALPILKREVAGDASESALLKCIELSCGPIKVIRDKNKKVAEIPFNSTNKYQLSIHENEDENDNRYLLVMKGAPERILDRCSTIMIQGKEQPMDDEMREAFQNAYLELGGLGERVLGFCHLFMPEDKYPKGFAFDTDDVNFSTENLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDLTQEQMDDILRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFILVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPLRDKLVNERLISIAYGQIGMIQALGGFFAYFVIMAENGFLPSLLVGIRLNWDDRSNNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKVILRRSPG-GWVEKE 1019          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Medaka
Match: ENSORLT00000046641.1 (sodium/potassium-transporting ATPase subunit alpha-3 [Source:NCBI gene;Acc:101159291])

HSP 1 Score: 1266.52 bits (3276), Expect = 0.000e+0
Identity = 641/985 (65.08%), Postives = 780/985 (79.19%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETND-GDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            ++V    H ++IEE+  +  TD  +GLT+ +AA  L RDG N+LTP   TPE VKF + L GGFSILLW GAILCF+AY IQ  T  +   DNLYLGIVL  VVV TGCF Y+Q+AKSSKIM SF  MVPQ+A V R G  + +  E +V GD++EVK GDRIPAD+RI+ + G KVDN++LTGESEPQ+R+P+CT +N LET NIAFFSTN VEGT R +V+ TGD T MGRIA L S L TGKTPI KEIEHFIHII+G+ V LGI FFI+A +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MA+KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q G +  +   +W  L R+A LCNRA FKAG++   + KR+ +GDASESALLK  EL+ G     R+ N KV E+PFNSTNKYQ+S+HET D  D RYLLVMKGAPERIL+R  TI++ GKE  +DE  K+ FNNAYME+GG+GERVLGFC   L E  +PKGF FD D+VNF  +   FVGL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+S+VNPR+AKACVIHG+DLK+++  Q+D+IL  H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALK ADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + +++IPL LGTITILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP +D LV  RLIS+ +GQ+G+IQA G FF +FVI+AENGFLP RLVGIR  W++   NDL+DSYGQ+WTY+QRK +E+TC++A+FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+ TWW  A+P+SF +  +DE+RK +IRR+    W  RE
Sbjct:   24 KEVPITEHKMSIEEICRKLNTDIVQGLTNAKAAEFLIRDGPNALTPPPTTPEWVKFCRQLFGGFSILLWTGAILCFLAYAIQAATEDEPAGDNLYLGIVLTAVVVITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKVQINAEEVVAGDLIEVKGGDRIPADIRIVSAHGCKVDNSSLTGESEPQNRSPDCTHDNPLETRNIAFFSTNCVEGTARGIVIYTGDRTAMGRIATLASGLDTGKTPIAKEIEHFIHIITGVAVFLGISFFILAIILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGASFDKSSLTWQALSRIAALCNRAQFKAGQDPIPILKRDVAGDASESALLKCIELSCGSVRAMRDRNKKVAEIPFNSTNKYQLSVHETEDPNDNRYLLVMKGAPERILDRCSTIMLQGKEQPMDEEMKEAFNNAYMELGGLGERVLGFCHILLPEDQYPKGFAFDTDDVNFQTSNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDLSQEQIDDILRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKMADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFIIVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPFRDKLVNERLISIAYGQIGMIQALGGFFTYFVILAENGFLPSRLVGIRIDWDDRAQNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILVFGLFEETALAAFLSYCPGMDVALRMYPLKPTWWFCAVPYSFLIFVYDEVRKLLIRRNPG-GWVERE 1007          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Medaka
Match: ENSORLT00000016540.2 (sodium/potassium-transporting ATPase subunit alpha-3 [Source:NCBI gene;Acc:101159291])

HSP 1 Score: 1253.43 bits (3242), Expect = 0.000e+0
Identity = 634/960 (66.04%), Postives = 766/960 (79.79%), Query Frame = 2
Query:  182 GLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETND-GDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            GLT+ +AA  L RDG N+LTP   TPE VKF + L GGFSILLW GAILCF+AY IQ  T  +   DNLYLGIVL  VVV TGCF Y+Q+AKSSKIM SF  MVPQ+A V R G  + +  E +V GD++EVK GDRIPAD+RI+ + G KVDN++LTGESEPQ+R+P+CT +N LET NIAFFSTN VEGT R +V+ TGD T MGRIA L S L TGKTPI KEIEHFIHII+G+ V LGI FFI+A +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MA+KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q G +  +   +W  L R+A LCNRA FKAG++   + KR+ +GDASESALLK  EL+ G     R+ N KV E+PFNSTNKYQ+S+HET D  D RYLLVMKGAPERIL+R  TI++ GKE  +DE  K+ FNNAYME+GG+GERVLGFC   L E  +PKGF FD D+VNF  +   FVGL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+S+VNPR+AKACVIHG+DLK+++  Q+D+IL  H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALK ADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + +++IPL LGTITILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP +D LV  RLIS+ +GQ+G+IQA G FF +FVI+AENGFLP RLVGIR  W++   NDL+DSYGQ+WTY+QRK +E+TC++A+FVS++V QW ++++ KTRRNS+FQQGM N  L F +F ET LA F+ Y PG++  L++  L+ TWW  A+P+SF +  +DE+RK +IRR+    W  RE
Sbjct:   39 GLTNAKAAEFLIRDGPNALTPPPTTPEWVKFCRQLFGGFSILLWTGAILCFLAYAIQAATEDEPAGDNLYLGIVLTAVVVITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKVQINAEEVVAGDLIEVKGGDRIPADIRIVSAHGCKVDNSSLTGESEPQNRSPDCTHDNPLETRNIAFFSTNCVEGTARGIVIYTGDRTAMGRIATLASGLDTGKTPIAKEIEHFIHIITGVAVFLGISFFILAIILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGASFDKSSLTWQALSRIAALCNRAQFKAGQDPIPILKRDVAGDASESALLKCIELSCGSVRAMRDRNKKVAEIPFNSTNKYQLSVHETEDPNDNRYLLVMKGAPERILDRCSTIMLQGKEQPMDEEMKEAFNNAYMELGGLGERVLGFCHILLPEDQYPKGFAFDTDDVNFQTSNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDLSQEQIDDILRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKMADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFIIVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPFRDKLVNERLISIAYGQIGMIQALGGFFTYFVILAENGFLPSRLVGIRIDWDDRAQNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILVFGLFEETALAAFLSYCPGMDVALRMYPLKPTWWFCAVPYSFLIFVYDEVRKLLIRRNPG-GWVERE 997          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Medaka
Match: atp1a2a (sodium/potassium-transporting ATPase subunit alpha-2 [Source:NCBI gene;Acc:101161996])

HSP 1 Score: 1235.32 bits (3195), Expect = 0.000e+0
Identity = 619/974 (63.55%), Postives = 761/974 (78.13%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRR 3028
            ++V  D H +++EEL  R+  D  +GLTS  AA  L +DGLN+LTP   TPE VKF + L GGFSILLW+GAILCF+AY IQV T  D   DNLYLG+VL  VV+ TGCF Y+Q+AKSS+IM SF KMVPQ+A V R G  + +  E +V+GD+VEVK GDRIPAD+R+I S+G KVDN++LTGESEPQ+R+PE   +N LET NI F+STN VEGT R +V+ TGD TVMGRIA L S L   +TPI  EIEHFI +I+G+ V LG+ FFI++ +LG  WL+AV+FLIG+IVANVPEG+LATVTV LTLTAK+MA+KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++N+I+++ T+E+Q G    +   +W  L RVA LCNRA FKAG+E   +  R+  GDASESALLK  E+  G   + R  NPKV E+PFNSTNKYQ+SIHE  D    ++LVMKGAPERIL+R  TI+I G+E  +DE+W++ F NAYME+GG+GERVLGFC   L    FP+GF FD ++ NFP     F+GLISMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAIAK VGI S  N+T+EDIA    +P+S+VNPR+AKACV+HG DLK+M+   LD++L  H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + + S+PL LGT+TILCIDLGTDM+PAI+LAYE AES+IM+R+PRNP  D LV  RLIS+ +GQ+G++QA   FF +FVI+AENGFLP  LVGIR  W++   NDL+DSYGQ+WTY+QRK +E+TC++A+F S+++ QW ++++ KTRRNSLFQQGM N  L F +F ET LA F+ Y PG++  L++  L+  WW   +P+S  +  +DE+RKFI+RR
Sbjct:   25 KEVSLDDHRLSLEELGKRYGVDLARGLTSARAAEMLAKDGLNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYSIQVATEDDPLNDNLYLGVVLAAVVIITGCFSYFQEAKSSRIMDSFKKMVPQQAMVIRDGEKLQINAEVVVLGDLVEVKGGDRIPADLRVISSNGCKVDNSSLTGESEPQTRSPEFNHDNPLETRNICFYSTNCVEGTARGIVIATGDRTVMGRIATLASELEVRRTPINIEIEHFIRLITGVAVFLGLSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQRGCGFDKSSGTWPALSRVAGLCNRADFKAGQEHLPMMMRDTVGDASESALLKCIEVCCGSVHDMRASNPKVAEIPFNSTNKYQLSIHEVEDNPSGHILVMKGAPERILDRCSTIMIHGQEEPLDENWREAFQNAYMELGGLGERVLGFCHLNLSSSQFPRGFEFDCNDTNFPTEQLCFLGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAERLIIPLSQVNPRDAKACVVHGYDLKDMSPEYLDDLLRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGITGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLFFILASVPLPLGTVTILCIDLGTDMVPAISLAYETAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMMQAVAGFFTYFVILAENGFLPSHLVGIRIPWDDRETNDLEDSYGQQWTYEQRKIVEFTCHTAFFTSIVIVQWADLIICKTRRNSLFQQGMKNRVLIFGLFVETALAAFLSYCPGMDVALRMYPLKLMWWFCGIPYSILIFVYDEVRKFILRR 998          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Planmine SMEST
Match: SMESG000032753.1 (SMESG000032753.1)

HSP 1 Score: 1962.19 bits (5082), Expect = 0.000e+0
Identity = 1016/1017 (99.90%), Postives = 1016/1017 (99.90%), Query Frame = 2
Query:   14 MTVPDEKRVQKPREXXXXXXXXXXXXXXXXXRDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRENP 3064
            MTVPDEK VQKPREKIANNDKKKKKNVNELKRDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFIHIISGIGVSLGIIFFIIAFLLGSFWLDAVLFLIGVIVANVPEGMLATVTVMLTLTAKKMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRENP
Sbjct:    1 MTVPDEKGVQKPREKIANNDKKKKKNVNELKRDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFIHIISGIGVSLGIIFFIIAFLLGSFWLDAVLFLIGVIVANVPEGMLATVTVMLTLTAKKMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRENP 1017          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Planmine SMEST
Match: SMESG000008146.1 (SMESG000008146.1)

HSP 1 Score: 1449.11 bits (3750), Expect = 0.000e+0
Identity = 721/1019 (70.76%), Postives = 848/1019 (83.22%), Query Frame = 2
Query:   14 MTVPDEKRV---QKPREXXXXXXXXXXXXXXXXXRDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTREN 3061
            MTV D K V   +KP  K     K K        +D+++DSH I IEELY R ++DP  GLT  EA  RLE DG N+L P +  PEIVKF+K L GGFS+LL  GAILC+IAY IQ     +   DNLYLG VL+ +V+FTGCFCYYQ+AKSS I+ SFGKMVPQK++V R   + +V T  LVVGD+VEVKFGDRIPAD+RIIK+S FKVDN+ALTGESEPQ+RTPECT+ NILETSNIAFFSTNAVEGTCR +++  GDNT+MGRIA+LTS L  G+TPIG+EI HF++II+ IG++LG++FFIIA  LG +WLD +LFLIG+IVA +P G+LATVTVMLTLTAK+MARKNCLVKNLEAVETLGSTS+ICSDKTGTLTQNVMTVAHTWY+N+I++ P SE++I     +   +W +L+R+AILCNRA FKA +EDKVVWKRECSGDASESALLK GE + G +++YRE N K++E+PFNS NKYQVSIHET D DPRYLLVMKGAPERILE+  TILI   E EID+HWKDEFNNAYME+GGMGERVLGFCDYRLD   FPKGF FD DEVNFPL G RF GLISMIDPPRPSVPDAV KCRSAGIKVIMVTGDHPITAKAI++AVGI    +KTIED+A  + +PISEVNPR+A ACV+HGSDLKEMTS QLDEIL+YH EIVFARTSPQQKLQIV+GCQRQG+IVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIV GIEQGR IFDNLKK+++Y  +KTIPE+VPFL Y  +SIPL LG +TILCID+GTDM+P+I+LAYE +ESNIM+RKPR+P+K  LVT RLISLTH Q+GII+A G+ F +F+IMAE GFLPDRL+G+R  WE   INDLKDSY QEWTY QRK+LEYTCY+++F+++MVQQW N+LVVKTRRNS+FQ GMWN+ LTF+MFFET LA+F+VY PG++ +LK+  LRFTWWLIA+PF  YL  FDE +K+I+ + K   W  RE+
Sbjct:    1 MTVIDGKNVNEIEKPPIKDGKKTKNKGSKTPIENKDLDTDSHKIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVARDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQNRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFVNIITVIGITLGVVFFIIALSLGYYWLDGILFLIGIIVAVIPVGLLATVTVMLTLTAKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVREH 1019          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Planmine SMEST
Match: SMESG000041937.1 (SMESG000041937.1)

HSP 1 Score: 1413.28 bits (3657), Expect = 0.000e+0
Identity = 698/983 (71.01%), Postives = 829/983 (84.33%), Query Frame = 2
Query:  110 DVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            +++ DSH I+I++LY R QTDP+KGL+ EEA  RL RDG N+LTP + TPE VKF + L GGFS+LLW+GA LCF+AY I  G  +D P DNLYLGIVL  VVV TGCF YYQ+AKSSKIM SFGKMVPQKA+V R G ++++A E LV GDI++VKFGDR+PAD+R+I++S FKVDN+ALTGESE Q R+ E T++N LET NIAFFSTNAVEGTC+ VV+ TGDNTVMGRIANL S L  G TPI KEI HFIHII+G+ V LG+ FF+IAF+LG FWLDAV+FLIG+IVANVPEG+LATVTV LTLTAKKMA+KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++NKI +S TSENQI  + KQ  E+W +L RVA+LCNRA FK+GEE+K V KREC+GDASESALLK  EL+ G  T+YR EN K++E+PFNSTNKYQVSIHET+DG+  YLL MKGAPERILER  TILIDGKE+E+D+HW+ EFNNAY+E+GGMGERVLGFCDYRLDE  FP+GF F+ DEVNFPL G RFVGL+SMIDPPR +VPDAVAKCRSAGIKVIMVTGDHPITAKAIAK VGI S  NKT++DIA  RG+  SEVNPR+A+ACVIHGSDL++M+S QLDE+L++H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + +  +PL LGTITILCIDLGTDM+PAI+LAYE AES+IM+RKPR+P  D LV  RLIS+ +GQ+G+IQA G FF +FVIMAE GF P RL+G+R+ W++  +NDL DSYGQEWT+ QRK+LEYTC++A+FVS+++ QW ++++ KTRRNS+FQQGMWNHQ+TF +FFET LA F+ Y PGL+  LK+  LRFTWWL A+PFS  +  +DE+RKF++R+ K+ +W   E
Sbjct:   37 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENE 1019          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Planmine SMEST
Match: SMESG000008152.1 (SMESG000008152.1)

HSP 1 Score: 1275 bits (3298), Expect = 0.000e+0
Identity = 638/984 (64.84%), Postives = 777/984 (78.96%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            +D+E D H I++ +L+ R  +DP KGL+ EEA  R +++G N+L P +  PEIVKF+K L GGFS+LL  G+ILCF++Y IQ  T   AP DNL LG+ L+ +V+FTGCFCY+Q+AKSSKI+ SFG MVP KA+V R G L ++ T  LVVGDIVEVK+GDRIPAD+R++KSS FKVDN+ALTGESEPQ RT E T+ NILETSN+AFFSTNAVEGTCR VV++TGDNT+MGRIA LTSSL  GKTPIG EI +F++II+GIG+SLG+IFFI++  +G FWLD  LFLIG+I A +P G+LA                                       T T++  + +++    N K      SEN++       + +W  L+RVA+LCNRA FKA +EDK+VWKREC+GDASESALLK  E       ++R ENPKV E+PFNSTNKYQ+SIHET D D R LLVMKGAPE+ILER  +I IDGKEIEID++W++EF NAYM +GGMGERVLGF D RLD + +PKG+ F+ +EVNFPL GFRFVGLISMIDPPRPSVPDAV+KCRSAG+KV+MVTGDHPITAKAI+KAVGI S  +KT+EDIAL R V +S+VNPREA ACV++GS+LK+M+S QLDEIL+YH EIVFARTSPQQKLQIVEG QRQGAIVAVTGDGVNDSPALKKADIGIAMGI+GSDVSKQAADMILLDDNFASIV GIEQGR IFDNLKKS+IY  +KTIPE++P + Y V+SIPL LGTITILCID+GTDM+PAI+LAYE AESNIMRRKPR+P+   LVT++LISLTHGQ+GII+A G  F +FVIMAENGF+P RL+GIR  WE+   NDL DSYGQEWTY QRK LEYTCY+A+FV+++VQQW N+L+VKTRRNS+FQ GMWN+ LTF++FFET LA+FIVY PG++ VLK   L+F+WW IALPF  Y+   DE++KFI+R    ++W++RE
Sbjct:   32 QDLEIDLHKISLTDLFERLNSDPIKGLSQEEAKIRYDKNGPNALKPPKDVPEIVKFLKELTGGFSLLLLAGSILCFVSYIIQAETDPSAPKDNLCLGLALLVIVLFTGCFCYFQEAKSSKIIKSFGNMVPDKANVIRDGELSEILTTFLVVGDIVEVKYGDRIPADLRLLKSSSFKVDNSALTGESEPQIRTVEFTNENILETSNVAFFSTNAVEGTCRGVVINTGDNTIMGRIALLTSSLKMGKTPIGNEINNFVNIITGIGISLGVIFFIVSLSIGYFWLDCFLFLIGIICAVIPVGLLA---------------------------------------TLTVSLKIQSIS---LNTK------SENEVD------NIAWSNLLRVAMLCNRAQFKADQEDKIVWKRECTGDASESALLKCAEHENQGVMKFRTENPKVFEIPFNSTNKYQISIHETTDQDERLLLVMKGAPEQILERCSSIFIDGKEIEIDDYWRNEFTNAYMSLGGMGERVLGFSDCRLDLEKYPKGYEFNGEEVNFPLNGFRFVGLISMIDPPRPSVPDAVSKCRSAGVKVVMVTGDHPITAKAISKAVGIISETSKTLEDIALERNVNLSQVNPREANACVVNGSELKKMSSEQLDEILKYHDEIVFARTSPQQKLQIVEGFQRQGAIVAVTGDGVNDSPALKKADIGIAMGIAGSDVSKQAADMILLDDNFASIVTGIEQGRIIFDNLKKSVIYNFIKTIPELIPVMLYIVLSIPLPLGTITILCIDIGTDMLPAISLAYEEAESNIMRRKPRDPISGKLVTNKLISLTHGQMGIIEAVGGMFVYFVIMAENGFMPGRLIGIRPQWESTTNNDLMDSYGQEWTYHQRKNLEYTCYTAFFVAIVVQQWFNLLIVKTRRNSIFQSGMWNNHLTFALFFETTLALFIVYCPGMDIVLKTQPLKFSWWFIALPFGVYIFLCDELKKFILRHQNSKSWFSRE 961          
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Planmine SMEST
Match: SMESG000078146.1 (SMESG000078146.1)

HSP 1 Score: 1154.43 bits (2985), Expect = 0.000e+0
Identity = 583/987 (59.07%), Postives = 756/987 (76.60%), Query Frame = 2
Query:  107 RDVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDA--PMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFXXXXXXXXXXXXXXXXXXXXXXXXXWLDAVLFLIGVIVANVPEGXXXXXXXXXXXXXXXMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDK-VVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 3058
            ++++ + H I I++LY +  TDPD G+T EEA  RL+  G N LTP   TP  + + K L GGF++LLW+G+ILCFIA+GI+ G+      PM NL++GIVL+ +VV +  F +YQ+ KS+KIM SF ++VP KA+V R+G   ++  E LVVGD++ VK GDRIPAD+RII ++ FKVDN++LTGESE Q R+ E T+ N LET N+AFFSTNAVEG CR VV++TGD+TVMGRIANL S L  G TPI KEI  FI+II+ I V L +IF I AFLLG +W+DA++FLI +I+A+VPEG+LATVTV LTLTAK+MA+KNCLVK+LEA+ETLGST +IC DKTGTLT N MTV+H ++++ +Y+   + N++          W +L R  +LCN + F   EED+ ++  R C+GD+SESALLK+ E++ G   ++REEN KV E+PFNS NKYQ S+HETNDG+   LLV+KGAPE++LE   T+LID +E +I + W+  F   Y ++G +GERV+GF D RL EK+FP GF F+ +E N    G RF+G+ISM+DPPR +VPDAV KCRSAGIKVIMVTGDHPITAKA+AK VGI    NKT+ED+A  RG+ + +V+P++A+ACVIHG+DLK+M+   LDE++ +H EIVFART+PQQKL IVE CQR G +VAVTGDGVNDSPALKKADIGIAMG+SGSDVSKQ+ADMILLDDNFA+IV+GIE+GR IFDNLKKSI Y L   IPE+ PFL + ++ +PL LGTIT+L IDLGTDM PAI+LAYE AES+IM+R PR+P  D LVT  L+S+ +GQ+GI++A   FFA+F++MAENGF P RLVG+R+ W++P IND+ DSYGQEW ++QRKQLE+TC +A+FV+++  QW N+L+ KTRR SLF QGMWNH LT +MF    LA+   Y PGL+T L    LRFTWWL ALP+   +L +DE+RK+IIRR K  +W  RE
Sbjct:   41 QELDLEDHRIPIDDLYYKLDTDPDNGITEEEANIRLKEYGQNLLTPVSSTPTSIIYCKNLFGGFNLLLWIGSILCFIAFGIEAGSYAYTYLPMRNLWMGIVLIVIVVLSATFSFYQEIKSNKIMESFVRLVPHKATVIRNGRTKEILAENLVVGDVITVKCGDRIPADIRIISATSFKVDNSSLTGESEAQVRSTEYTNENSLETKNLAFFSTNAVEGVCRGVVINTGDSTVMGRIANLASGLEIGMTPIAKEINFFIYIITIISVILAVIFIIAAFLLGYYWIDAIIFLIAIIIASVPEGLLATVTVCLTLTAKRMAKKNCLVKHLEAIETLGSTKVICCDKTGTLTMNKMTVSHVFFDDIVYEVDMNNNELEGEIDVTKTGWKMLARGCMLCNHSNFIQSEEDEALILNRLCTGDSSESALLKFMEISYGNVEKFREENKKVYEMPFNSINKYQFSVHETNDGNESLLLVLKGAPEKVLEYCSTVLIDEEEHKITDEWRKLFYKNYDDLGILGERVIGFADTRLSEKIFPHGFDFNEEEHNVLNGGMRFLGMISMVDPPRSTVPDAVEKCRSAGIKVIMVTGDHPITAKAVAKLVGIIDEGNKTVEDLAKERGITVHDVDPKDARACVIHGNDLKDMSPETLDEVINHHNEIVFARTTPQQKLLIVESCQRLGDVVAVTGDGVNDSPALKKADIGIAMGLSGSDVSKQSADMILLDDNFATIVIGIEEGRLIFDNLKKSIAYTLTSNIPEVTPFLLFIILGLPLPLGTITVLLIDLGTDMFPAISLAYEEAESDIMQRSPRDPKTDKLVTHSLLSMAYGQIGIMEAVAGFFAYFIVMAENGFWPQRLVGLRQEWDSPAINDVIDSYGQEWGFRQRKQLEHTCQTAFFVAIVTTQWANLLICKTRRISLFTQGMWNHYLTGAMFISATLALIFTYVPGLDTALHTAPLRFTWWLPALPYFLIILVYDEIRKYIIRRMKPNSWLERE 1027          
The following BLAST results are available for this feature:
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP1A30.000e+065.38ATPase Na+/K+ transporting subunit alpha 3 [Source... [more]
ATP1A30.000e+065.38ATPase Na+/K+ transporting subunit alpha 3 [Source... [more]
AC010616.10.000e+065.78novel protein, ATP1A3-RABAC1 readthrough[more]
ATP1A30.000e+065.38ATPase Na+/K+ transporting subunit alpha 3 [Source... [more]
ATP1A30.000e+065.75ATPase Na+/K+ transporting subunit alpha 3 [Source... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eat-60.000e+065.14Sodium/potassium-transporting ATPase subunit alpha... [more]
eat-60.000e+065.14Sodium/potassium-transporting ATPase subunit alpha... [more]
catp-40.000e+049.70Sodium/potassium-transporting ATPase subunit alpha... [more]
catp-35.658e-17236.06Cation transporting ATPase [Source:UniProtKB/TrEM... [more]
catp-21.028e-16434.38Cation transporting ATPase [Source:UniProtKB/TrEM... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atpalpha0.000e+065.48gene:FBgn0002921 transcript:FBtr0089515[more]
Atpalpha0.000e+065.48gene:FBgn0002921 transcript:FBtr0089516[more]
Atpalpha0.000e+065.48gene:FBgn0002921 transcript:FBtr0089514[more]
Atpalpha0.000e+065.48gene:FBgn0002921 transcript:FBtr0300191[more]
Atpalpha0.000e+065.38gene:FBgn0002921 transcript:FBtr0089510[more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp1a3b0.000e+065.58ATPase Na+/K+ transporting subunit alpha 3b [Sourc... [more]
atp1a3b0.000e+065.58ATPase Na+/K+ transporting subunit alpha 3b [Sourc... [more]
atp1a3a0.000e+064.77ATPase Na+/K+ transporting subunit alpha 3a [Sourc... [more]
atp1a2a0.000e+064.44ATPase Na+/K+ transporting subunit alpha 2 [Source... [more]
atp1a2a0.000e+064.44ATPase Na+/K+ transporting subunit alpha 2 [Source... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdk20.000e+064.16cyclin-dependent kinase 2 [Source:Xenbase;Acc:XB-G... [more]
naif10.000e+064.68nuclear apoptosis inducing factor 1 [Source:Xenbas... [more]
rab8b0.000e+065.03RAB8B, member RAS oncogene family [Source:Xenbase;... [more]
rab8b0.000e+065.03RAB8B, member RAS oncogene family [Source:Xenbase;... [more]
rab8b0.000e+063.72RAB8B, member RAS oncogene family [Source:Xenbase;... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp1a30.000e+065.38ATPase, Na+/K+ transporting, alpha 3 polypeptide [... [more]
Atp1a30.000e+065.78ATPase, Na+/K+ transporting, alpha 3 polypeptide [... [more]
Atp1a30.000e+065.38ATPase, Na+/K+ transporting, alpha 3 polypeptide [... [more]
Atp1a20.000e+065.30ATPase, Na+/K+ transporting, alpha 2 polypeptide [... [more]
Atp1a10.000e+064.26ATPase, Na+/K+ transporting, alpha 1 polypeptide [... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6RWA9|AT1A_TAESO0.000e+067.82Sodium/potassium-transporting ATPase subunit alpha... [more]
sp|P13607|ATNA_DROME0.000e+065.38Sodium/potassium-transporting ATPase subunit alpha... [more]
sp|P13637|AT1A3_HUMAN0.000e+065.38Sodium/potassium-transporting ATPase subunit alpha... [more]
sp|P24798|AT1A3_CHICK0.000e+065.28Sodium/potassium-transporting ATPase subunit alpha... [more]
sp|P06687|AT1A3_RAT0.000e+065.38Sodium/potassium-transporting ATPase subunit alpha... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
O761540.000e+070.91Sodium/potassium-transporting ATPase subunit alpha... [more]
M4LUP70.000e+071.01Sodium/potassium-transporting ATPase subunit alpha... [more]
A0A0R3UN071.924e-11669.69Uncharacterized protein (Fragment) OS=Mesocestoide... [more]
Q95WT40.000e+068.90Sodium/potassium-transporting ATPase subunit alpha... [more]
A0A3Q0KLP20.000e+068.80Sodium/potassium-transporting ATPase subunit alpha... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp1a3a0.000e+065.38sodium/potassium-transporting ATPase subunit alpha... [more]
atp1a3b0.000e+065.58ATPase Na+/K+ transporting subunit alpha 3 [Source... [more]
atp1a3a0.000e+066.35sodium/potassium-transporting ATPase subunit alpha... [more]
atp1a3b0.000e+066.46ATPase Na+/K+ transporting subunit alpha 3 [Source... [more]
atp1a1b0.000e+063.39sodium/potassium-transporting ATPase subunit alpha... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002888.10.000e+063.49pep scaffold:Pmarinus_7.0:GL478641:194938:205936:1... [more]
ENSPMAT00000002145.10.000e+066.91pep scaffold:Pmarinus_7.0:GL482157:124:4919:1 gene... [more]
ENSPMAT00000009058.11.353e-15062.50pep scaffold:Pmarinus_7.0:GL480374:1:11062:-1 gene... [more]
ENSPMAT00000001612.13.311e-8348.64pep scaffold:Pmarinus_7.0:GL478157:83838:93675:1 g... [more]
ENSPMAT00000010373.13.977e-7229.15pep scaffold:Pmarinus_7.0:GL481096:3909:20014:1 ge... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PMR12.449e-11030.52High affinity Ca2+/Mn2+ P-type ATPase; required fo... [more]
ENA29.165e-7627.46P-type ATPase sodium pump; involved in Na+ efflux ... [more]
ENA51.096e-7528.01Protein with similarity to P-type ATPase sodium pu... [more]
ENA11.727e-7427.12P-type ATPase sodium pump; involved in Na+ and Li+... [more]
PMA12.094e-5425.52Plasma membrane P2-type H+-ATPase; pumps protons o... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO406800.000e+063.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364550.000e+062.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356168.820e-10128.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474651.049e-9629.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417751.356e-5434.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp1a3a0.000e+065.74sodium/potassium-transporting ATPase subunit alpha... [more]
atp1a3a0.000e+065.28sodium/potassium-transporting ATPase subunit alpha... [more]
ENSORLT00000046641.10.000e+065.08sodium/potassium-transporting ATPase subunit alpha... [more]
ENSORLT00000016540.20.000e+066.04sodium/potassium-transporting ATPase subunit alpha... [more]
atp1a2a0.000e+063.55sodium/potassium-transporting ATPase subunit alpha... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032753.10.000e+099.90SMESG000032753.1[more]
SMESG000008146.10.000e+070.76SMESG000008146.1[more]
SMESG000041937.10.000e+071.01SMESG000041937.1[more]
SMESG000008152.10.000e+064.84SMESG000008152.1[more]
SMESG000078146.10.000e+059.07SMESG000078146.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020220 ID=SMED30020220|Name=Sodium/potassium-transporting ATPase subunit alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=3220bp
GTGAAACAAGAATATGACGGTTCCAGATGAAAAAAGAGTTCAAAAGCCTC
GAGAGAAAATCGCAAATAACGATAAAAAGAAAAAGAAAAATGTTAATGAA
TTAAAACGGGACGTCGAAAGTGATTCTCACATCATCACGATAGAAGAGCT
GTATGCGAGATTCCAAACCGATCCTGATAAAGGTTTGACATCTGAAGAGG
CCGCGTTTCGGCTCGAACGGGATGGTTTAAACTCACTGACCCCCGCTGAG
GGTACTCCTGAAATTGTCAAATTTATAAAAACCCTTCTTGGAGGATTTTC
AATTTTACTTTGGGTAGGAGCAATTCTCTGCTTCATAGCCTACGGAATTC
AAGTGGGAACTACACAAGACGCACCGATGGACAATTTGTACCTCGGTATT
GTGCTGGTATTTGTCGTTGTGTTTACCGGTTGCTTCTGTTATTATCAGGA
CGCTAAATCCTCCAAAATCATGCACTCATTTGGGAAAATGGTCCCCCAAA
AAGCAAGCGTATGCAGGAGCGGGATTCTAATAGATGTCGCAACAGAAACT
TTGGTGGTAGGAGATATCGTGGAGGTTAAGTTTGGGGATCGGATCCCGGC
AGATGTTAGAATAATCAAATCTAGTGGATTTAAGGTGGATAATGCTGCTC
TTACCGGGGAGTCAGAACCCCAATCTCGCACTCCAGAATGTACGAGTAAT
AATATATTAGAGACCTCTAATATAGCCTTTTTCTCAACCAATGCTGTAGA
AGGCACTTGTCGATGCGTGGTCGTTGACACGGGAGACAACACAGTCATGG
GGAGGATCGCAAATTTGACAAGTAGCCTTACAACAGGCAAAACTCCAATT
GGAAAAGAAATTGAACATTTCATTCACATCATTAGTGGAATAGGAGTCTC
ACTTGGGATAATATTCTTTATCATTGCTTTCCTATTAGGATCATTTTGGC
TAGATGCAGTCCTATTCCTGATCGGTGTCATTGTAGCCAATGTTCCGGAA
GGAATGCTTGCCACCGTAACAGTAATGCTGACTCTCACTGCAAAGAAAAT
GGCTCGAAAGAACTGCTTAGTTAAGAATTTGGAAGCAGTGGAAACCCTTG
GATCGACAAGTATTATATGTTCTGACAAAACTGGAACCCTTACCCAGAAT
GTGATGACTGTCGCCCACACTTGGTACAACAACAAGATCTATGACTCCCC
AACGTCAGAAAATCAAATAGGGTTGACCAATAAACAGGTTGATGAATCCT
GGGACTTATTAATGCGTGTTGCCATTTTATGCAACCGAGCGGCGTTTAAA
GCAGGAGAGGAAGATAAAGTAGTATGGAAACGTGAATGTTCCGGGGATGC
TTCAGAATCTGCTTTGCTAAAGTACGGCGAGCTGGCAAAAGGAAAAACAA
CTGAATATCGGGAAGAAAATCCAAAGGTTATAGAGGTCCCATTCAATTCC
ACAAACAAATATCAAGTATCCATTCATGAGACCAATGATGGCGACCCTCG
ATATCTACTTGTGATGAAAGGAGCACCAGAGAGAATCCTCGAGCGTTCTC
AAACGATCTTGATAGATGGGAAGGAAATAGAAATTGACGAACACTGGAAA
GATGAATTTAACAATGCATATATGGAAATGGGGGGAATGGGGGAACGAGT
GCTTGGATTCTGTGACTATCGGCTTGACGAGAAATTGTTCCCCAAAGGTT
TTCCTTTTGATGCGGACGAAGTTAACTTTCCGTTGACAGGATTCAGATTC
GTTGGATTAATCTCAATGATAGATCCGCCTCGACCTTCAGTACCAGACGC
AGTGGCAAAATGTCGATCGGCTGGGATAAAGGTTATCATGGTTACAGGGG
ATCATCCAATTACTGCAAAGGCAATTGCCAAAGCAGTTGGGATATTCAGT
CCGGACAACAAAACAATTGAAGATATAGCCCTATCGCGAGGAGTTCCAAT
ATCAGAGGTTAATCCTAGAGAAGCTAAAGCTTGCGTAATTCACGGATCCG
ATTTGAAGGAAATGACATCTGTGCAGCTAGATGAAATTCTAGAGTACCAT
TTGGAGATCGTGTTTGCCCGAACTAGCCCACAGCAGAAACTGCAAATAGT
CGAAGGATGTCAAAGACAAGGAGCAATAGTGGCAGTTACAGGAGATGGAG
TTAATGACAGTCCTGCTCTGAAAAAGGCTGATATTGGAATTGCAATGGGA
ATTTCTGGTAGTGATGTCAGTAAGCAGGCGGCGGACATGATCCTTCTGGA
CGACAATTTTGCTTCCATTGTTGTTGGCATCGAGCAAGGCAGGAAAATCT
TTGACAACCTGAAAAAATCAATTATCTACATTTTGGTGAAAACAATTCCG
GAAATTGTTCCGTTCCTGGCTTACACGGTGATCAGCATTCCTTTGGCACT
TGGCACAATAACGATCCTCTGCATCGACTTGGGAACAGATATGATGCCCG
CCATCGCGTTAGCGTACGAAGGAGCTGAATCAAACATCATGAGAAGGAAG
CCTCGTAATCCACTAAAGGACAATTTAGTGACAAGCCGGTTGATATCCTT
AACACATGGGCAATTGGGAATTATTCAGGCCTTTGGGTCATTCTTTGCAT
TTTTTGTGATCATGGCTGAGAACGGATTTCTGCCCGACAGGCTGGTCGGG
ATCAGGGAAAGCTGGGAAAATCCAGTAATAAACGATCTTAAAGATTCCTA
CGGTCAAGAATGGACTTACAAGCAAAGGAAACAATTGGAATACACTTGCT
ATAGCGCTTACTTTGTGTCGGTCATGGTTCAGCAGTGGTGCAACATCCTT
GTTGTAAAGACCAGAAGGAACTCCTTGTTCCAGCAAGGAATGTGGAATCA
CCAACTCACGTTTTCCATGTTTTTTGAAACTGGGCTCGCAATATTTATAG
TGTATACACCTGGGCTTAACACGGTGCTGAAACTGGTCAACCTGAGGTTC
ACTTGGTGGTTGATCGCGCTTCCATTCAGTTTCTACCTGTTAGCCTTTGA
CGAAATGAGGAAATTCATTATCCGCCGGGACAAGGACAGGAACTGGTGGA
CAAGGGAAAATCCTTGAAGCTCCTCCTTTGATTTTTATAGAAATTTTAAA
AAACGCTTCGAAATATTTTATCTTCCTTAAATGAGCTCTTATTTGATAAA
TGTTTTTCAGATGAGTAAATATTGGACTTGCGGTGGGCAAATAAATGCTC
GATGGACAATATGTTCTTTG
back to top

protein sequence of SMED30020220-orf-1

>SMED30020220-orf-1 ID=SMED30020220-orf-1|Name=SMED30020220-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1018bp
MTVPDEKRVQKPREKIANNDKKKKKNVNELKRDVESDSHIITIEELYARF
QTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLW
VGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSS
KIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRI
IKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCR
CVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFIHIISGIGVSLGII
FFIIAFLLGSFWLDAVLFLIGVIVANVPEGMLATVTVMLTLTAKKMARKN
CLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSEN
QIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESA
LLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDPRYLLV
MKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFC
DYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKC
RSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVN
PREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQ
RQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFA
SIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTIT
ILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQ
LGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEW
TYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTF
SMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRK
FIIRRDKDRNWWTRENP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008556potassium-transporting ATPase activity
GO:0046872metal ion binding
GO:0000166nucleotide binding
GO:0005391sodium:potassium-exchanging ATPase activity
GO:0005524ATP binding
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0071805potassium ion transmembrane transport
GO:0006810transport
GO:0006811ion transport
GO:0006813potassium ion transport
GO:0006814sodium ion transport
GO:0010248establishment or maintenance of transmembrane electrochemical gradient
GO:0090662ATP hydrolysis coupled transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000136whole organism
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001757P_typ_ATPase
IPR005775P-type_ATPase_IIC
IPR036412HAD-like_sf
IPR004014ATPase_P-typ_cation-transptr_N
IPR008250ATPase_P-typ_transduc_dom_A_sf
IPR023298ATPase_P-typ_TM_dom_sf
IPR023299ATPase_P-typ_cyto_dom_N
IPR006068ATPase_P-typ_cation-transptr_C
IPR018303ATPase_P-typ_P_site
IPR023214HAD_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 13..33
NoneNo IPR availablePRINTSPR00121NAKATPASEcoord: 499..517
score: 76.74
coord: 362..383
score: 91.12
coord: 944..968
score: 42.51
coord: 125..145
score: 71.32
coord: 781..802
score: 59.3
coord: 289..311
score: 44.19
coord: 848..868
score: 56.04
coord: 910..930
score: 40.09
coord: 98..112
score: 78.29
NoneNo IPR availablePRINTSPR00119CATATPASEcoord: 581..592
score: 53.07
coord: 733..745
score: 54.06
coord: 709..728
score: 84.33
coord: 209..223
score: 51.0
coord: 369..383
score: 78.62
coord: 603..613
score: 73.19
NoneNo IPR availablePFAMPF00702Hydrolasecoord: 678..723
e-value: 1.0E-6
score: 29.2
NoneNo IPR availableGENE3DG3DSA:1.20.1110.10coord: 89..1007
e-value: 0.0
score: 1449.5
NoneNo IPR availablePFAMPF00122E1-E2_ATPasecoord: 158..349
e-value: 1.6E-44
score: 151.6
NoneNo IPR availablePFAMPF13246Cation_ATPasecoord: 421..514
e-value: 7.8E-22
score: 77.2
NoneNo IPR availableGENE3DG3DSA:2.70.150.10coord: 37..271
e-value: 0.0
score: 1449.5
NoneNo IPR availableSFLDSFLDF00027p-type_atpasecoord: 350..762
e-value: 0.0
score: 261.6
NoneNo IPR availableSFLDSFLDS00003Haloacid_Dehalogenasecoord: 350..762
e-value: 0.0
score: 261.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..29
NoneNo IPR availablePANTHERPTHR43294FAMILY NOT NAMEDcoord: 13..1014
NoneNo IPR availablePANTHERPTHR43294:SF15SODIUM/POTASSIUM-TRANSPORTING ATPASE SUBUNIT ALPHA-3coord: 13..1014
NoneNo IPR availableTMHMMTMhelixcoord: 942..964
NoneNo IPR availableTMHMMTMhelixcoord: 851..873
NoneNo IPR availableTMHMMTMhelixcoord: 782..804
NoneNo IPR availableTMHMMTMhelixcoord: 93..115
NoneNo IPR availableTMHMMTMhelixcoord: 125..144
NoneNo IPR availableTMHMMTMhelixcoord: 318..340
NoneNo IPR availableTMHMMTMhelixcoord: 286..308
NoneNo IPR availableTMHMMTMhelixcoord: 979..995
IPR004014Cation-transporting P-type ATPase, N-terminalSMARTSM00831Cation_ATPase_N_a_2coord: 37..111
e-value: 1.7E-22
score: 90.7
IPR004014Cation-transporting P-type ATPase, N-terminalPFAMPF00690Cation_ATPase_Ncoord: 39..106
e-value: 3.7E-16
score: 58.5
IPR006068Cation-transporting P-type ATPase, C-terminalPFAMPF00689Cation_ATPase_Ccoord: 793..1002
e-value: 3.3E-43
score: 147.5
IPR001757P-type ATPaseTIGRFAMTIGR01494TIGR01494coord: 131..399
e-value: 1.2E-38
score: 130.8
coord: 683..795
e-value: 8.7E-32
score: 108.1
IPR023214HAD superfamilyGENE3DG3DSA:3.40.50.1000coord: 366..749
e-value: 0.0
score: 1449.5
IPR005775P-type ATPase subfamily IIC, subunit alphaTIGRFAMTIGR01106TIGR01106coord: 22..1015
e-value: 0.0
score: 1642.9
IPR005775P-type ATPase subfamily IIC, subunit alphaCDDcd02608P-type_ATPase_Na-K_likecoord: 57..1015
e-value: 0.0
score: 1655.55
IPR023299P-type ATPase, cytoplasmic domain NGENE3DG3DSA:3.40.1110.10coord: 379..588
e-value: 0.0
score: 1449.5
IPR023299P-type ATPase, cytoplasmic domain NSUPERFAMILYSSF81660Metal cation-transporting ATPase, ATP-binding domain Ncoord: 378..589
IPR018303P-type ATPase, phosphorylation sitePROSITEPS00154ATPASE_E1_E2coord: 371..377
IPR023298P-type ATPase, transmembrane domain superfamilySUPERFAMILYSSF81665Calcium ATPase, transmembrane domain Mcoord: 37..1006
IPR036412HAD-like superfamilySUPERFAMILYSSF56784HAD-likecoord: 357..753
IPR008250P-type ATPase, A domain superfamilySUPERFAMILYSSF81653Calcium ATPase, transduction domain Acoord: 161..268