Ubiquitin carboxyl-terminal hydrolase

Overview
NameUbiquitin carboxyl-terminal hydrolase
Smed IDSMED30020218
Length (bp)1460
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ubiquitin carboxyl-terminal hydrolase (SMED30020218) t-SNE clustered cells

Violin plots show distribution of expression levels for Ubiquitin carboxyl-terminal hydrolase (SMED30020218) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ubiquitin carboxyl-terminal hydrolase (SMED30020218) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ubiquitin carboxyl-terminal hydrolase (SMED30020218) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020218

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30020218SMESG000036070.1 SMESG000036047.1 SMESG000036045.1 dd_Smed_v4_2238_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020218SMESG000036070.1 SMESG000036047.1 SMESG000036045.1 dd_Smed_v4_2238_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020218SMESG000036070.1 SMESG000036047.1 SMESG000036045.1 dd_Smed_v4_2238_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP2 (ubiquitin specific peptidase 2 [Source:HGNC Symbol;Acc:HGNC:12618])

HSP 1 Score: 78.1814 bits (191), Expect = 4.707e-15
Identity = 92/374 (24.60%), Postives = 160/374 (42.78%), Query Frame = 2
Query:  254 TRCFGKKRKNRNKITDIIQQNPVSHIDKPMGFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDDTED-----SVFVKGLFNLIQALRKSDKKNLDKSLE---TVQQYITE---------SSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVA-QSESQILLESCVESFFSKSQVEVSD--PLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIEIK----DSTNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFK 1294
            TR + KKR+N      +             G  N    C++N ++Q L++    T+++ +   Q+ ++ D        +  V+    LIQ +  S   ++    E    +Q+Y              F   +     N ++RV+   K+N E  +    LP    EK +Q + K+  R    + D F GQL   +TC  C   C+  F     + L +A +   ++ L  C+   F+K  V   D  P  C C      +K  + +   PK L ++L R S +    +K+ TF+    + ++++    ++TN  + Y L +V +H G T  GHY  YCRS   G +W   ND+ V   S  +V T +A +  ++
Sbjct:    7 TRPYSKKRQNSKSAQGLA------------GLRNLGNTCFMNSILQCLSN----TRELRDYCLQRLYMRDLHHGSNAHTALVEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVTLRPKSNPENLD---HLP--DDEKGRQMWRKYLEREDSRIGDLFVGQLKSSLTCTDC-GYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMR-LFTKEDVLDGDEKPTCCRCRGRKRCIKKFS-IQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRDLDLREFASENTNHAV-YNLYAVSNHSGTTMGGHYTAYCRSPGTG-EWHTFNDSSVTPMSSSQVRTSDAYLLFYE 354          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP2 (ubiquitin specific peptidase 2 [Source:HGNC Symbol;Acc:HGNC:12618])

HSP 1 Score: 75.485 bits (184), Expect = 4.403e-14
Identity = 86/344 (25.00%), Postives = 151/344 (43.90%), Query Frame = 2
Query:  344 GFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDDTED-----SVFVKGLFNLIQALRKSDKKNLDKSLE---TVQQYITE---------SSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVA-QSESQILLESCVESFFSKSQVEVSD--PLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIEIK----DSTNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFK 1294
            G  N    C++N ++Q L++    T+++ +   Q+ ++ D        +  V+    LIQ +  S   ++    E    +Q+Y              F   +     N ++RV+   K+N E  +    LP    EK +Q + K+  R    + D F GQL   +TC  C   C+  F     + L +A +   ++ L  C+   F+K  V   D  P  C C      +K  + +   PK L ++L R S +    +K+ TF+    + ++++    ++TN  + Y L +V +H G T  GHY  YCRS   G +W   ND+ V   S  +V T +A +  ++
Sbjct:   59 GLRNLGNTCFMNSILQCLSN----TRELRDYCLQRLYMRDLHHGSNAHTALVEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVTLRPKSNPENLD---HLP--DDEKGRQMWRKYLEREDSRIGDLFVGQLKSSLTCTDC-GYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMR-LFTKEDVLDGDEKPTCCRCRGRKRCIKKFS-IQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRDLDLREFASENTNHAV-YNLYAVSNHSGTTMGGHYTAYCRSPGTG-EWHTFNDSSVTPMSSSQVRTSDAYLLFYE 388          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP2 (ubiquitin specific peptidase 2 [Source:HGNC Symbol;Acc:HGNC:12618])

HSP 1 Score: 75.485 bits (184), Expect = 8.489e-14
Identity = 86/344 (25.00%), Postives = 151/344 (43.90%), Query Frame = 2
Query:  344 GFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDD-----TEDSVFVKGLFNLIQALRKSDKKNLDKSLE---TVQQYITE---------SSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVA-QSESQILLESCVESFFSKSQVEVSD--PLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIEIK----DSTNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFK 1294
            G  N    C++N ++Q L++    T+++ +   Q+ ++ D        +  V+    LIQ +  S   ++    E    +Q+Y              F   +     N ++RV+   K+N E  +    LP    EK +Q + K+  R    + D F GQL   +TC  C   C+  F     + L +A +   ++ L  C+   F+K  V   D  P  C C      +K  + +   PK L ++L R S +    +K+ TF+    + ++++    ++TN  + Y L +V +H G T  GHY  YCRS   G +W   ND+ V   S  +V T +A +  ++
Sbjct:  268 GLRNLGNTCFMNSILQCLSN----TRELRDYCLQRLYMRDLHHGSNAHTALVEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVTLRPKSNPENLDH---LP--DDEKGRQMWRKYLEREDSRIGDLFVGQLKSSLTCTDC-GYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMR-LFTKEDVLDGDEKPTCCRCRGRKRCIKKFS-IQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRDLDLREFASENTNHAV-YNLYAVSNHSGTTMGGHYTAYCRSPGTG-EWHTFNDSSVTPMSSSQVRTSDAYLLFYE 597          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP21 (ubiquitin specific peptidase 21 [Source:HGNC Symbol;Acc:HGNC:12620])

HSP 1 Score: 63.1586 bits (152), Expect = 6.398e-10
Identity = 75/351 (21.37%), Postives = 138/351 (39.32%), Query Frame = 2
Query:  341 MGFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDDTEDSVFVKGLFNLIQALRKSD---KKNLDKSLETVQQYITE-SSFGDDVYKCFMNIL-----------SRVSKVIKTN------IERSNDSFSLPATSTE-KAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVAQ---SESQILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLT--HGPKYLFIYLNRGSYTDNGAKIDTF-ITCSEKRIEIKDSTN---STIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFK 1294
            +G  N    C+LN V+Q L+S           D +Q            +   ++I AL   D     N  +     Q+Y+   S +     + F+ +L            R +  I  N        R       P  S + +A   ++++  R    + D F GQL   + C  C    + +F+V   + L + +   +  ++ L  C   F  + ++E  +     CD      +S  KLT    P+ L ++LNR S +    K  +  +    +R+ + D  +    +  Y+L ++ +H G+  YGHY   CR     + W + ND+ V   S+++V +    V  ++
Sbjct:  212 VGLRNLGNTCFLNAVLQCLSSTRPLRDFCLRRDFRQEVPGGGRAQELTEAFADVIGALWHPDSCEAVNPTRFRAVFQKYVPSFSGYSQQDAQEFLKLLMERLHLEINRRGRRAPPILANGPVPSPPRRGGALLEEPELSDDDRANLMWKRYLEREDSKIVDLFVGQLKSCLKCQAC-GYRSTTFEVFCDLSLPIPKKGFAGGKVSLRDCFNLFTKEEELESEN--APVCDRCRQKTRSTKKLTVQRFPRILVLHLNRFSASRGSIKKSSVGVDFPLQRLSLGDFASDKAGSPVYQLYALCNHSGSVHYGHYTALCRCQ---TGWHVYNDSRVSPVSENQVASSEGYVLFYQ 556          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP21 (ubiquitin specific peptidase 21 [Source:HGNC Symbol;Acc:HGNC:12620])

HSP 1 Score: 63.1586 bits (152), Expect = 6.398e-10
Identity = 75/351 (21.37%), Postives = 138/351 (39.32%), Query Frame = 2
Query:  341 MGFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDDTEDSVFVKGLFNLIQALRKSD---KKNLDKSLETVQQYITE-SSFGDDVYKCFMNIL-----------SRVSKVIKTN------IERSNDSFSLPATSTE-KAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVAQ---SESQILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLT--HGPKYLFIYLNRGSYTDNGAKIDTF-ITCSEKRIEIKDSTN---STIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFK 1294
            +G  N    C+LN V+Q L+S           D +Q            +   ++I AL   D     N  +     Q+Y+   S +     + F+ +L            R +  I  N        R       P  S + +A   ++++  R    + D F GQL   + C  C    + +F+V   + L + +   +  ++ L  C   F  + ++E  +     CD      +S  KLT    P+ L ++LNR S +    K  +  +    +R+ + D  +    +  Y+L ++ +H G+  YGHY   CR     + W + ND+ V   S+++V +    V  ++
Sbjct:  212 VGLRNLGNTCFLNAVLQCLSSTRPLRDFCLRRDFRQEVPGGGRAQELTEAFADVIGALWHPDSCEAVNPTRFRAVFQKYVPSFSGYSQQDAQEFLKLLMERLHLEINRRGRRAPPILANGPVPSPPRRGGALLEEPELSDDDRANLMWKRYLEREDSKIVDLFVGQLKSCLKCQAC-GYRSTTFEVFCDLSLPIPKKGFAGGKVSLRDCFNLFTKEEELESEN--APVCDRCRQKTRSTKKLTVQRFPRILVLHLNRFSASRGSIKKSSVGVDFPLQRLSLGDFASDKAGSPVYQLYALCNHSGSVHYGHYTALCRCQ---TGWHVYNDSRVSPVSENQVASSEGYVLFYQ 556          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: usp-3 (Ubiquitinyl hydrolase 1 [Source:UniProtKB/TrEMBL;Acc:Q9GRV2])

HSP 1 Score: 67.0106 bits (162), Expect = 1.255e-11
Identity = 80/339 (23.60%), Postives = 137/339 (40.41%), Query Frame = 2
Query:  335 KPMGFNNPKGYCYLNCVIQVLASCGDFTKDIEN-SDCQQYFVDDTEDSVFVKGLFNLIQALRKSDKKNLDKSLETVQQYITESSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDN-------FYGQLTFQMTCDICDNICNESFQVMK-SMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKCA-CDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTDNGAKIDTFITCSEKRIEIK-----DSTNSTIKYRLISVIDHVG-NTFYGHYYCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFKKEI 1303
            +P G  N    C++N V+Q LAS  +F + I + S  + Y  D+ E     K   N      +  K  + +S  + ++    + F +     F+++  R          R +DS        +       K + + PG   D        F G L   + C  C N  N+  + M  S+ +   ++ S++ L  C+ +FF    +E  +  +CA C    T  K    +   P+ L +++ R  + DNG K D  I     ++++      DS  +   Y L S+I H+G     GHY       G  W+  +D  V+   +  V  + A V L+ K I
Sbjct:  227 RPRGMRNVGNTCFMNAVLQALASISEFREYIMSLSSLEDYIHDEKEP----KNGGNYCYLTDEYRKLLISQSARSFREPTAPNEFRE----AFISVCPRFRGF------RQHDSHEFMRYFMDSLHTEMRKCR-KLPGMPDDKHTPISKYFEGTLQSSVICQTCRNCSNKIDEFMDLSLDIPAQRNASKVRLSDCLSTFFKLEMLEKGEKPECAKCKTKQTCSK-QMFIRKLPQVLCLHMKR--FRDNGGKNDAIIDFPMGQLDVTQFLTDDSDEAPCTYSLQSIIVHIGYGCGSGHYIAFGKRNGR-WFQFDDTVVKGVDEAHVSKQKAYVLLYTKII 546          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp2 (gene:FBgn0031187 transcript:FBtr0339506)

HSP 1 Score: 65.0846 bits (157), Expect = 7.228e-11
Identity = 80/336 (23.81%), Postives = 148/336 (44.05%), Query Frame = 2
Query:  344 GFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDDTEDSVFVKGLFNLIQALRKSD-----KKNLDKSLETVQQYITESSFGD--DVYKCFMNIL-SRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDN--ICNESFQVMKSMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKCA-CDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTDNGAKIDTFITCSEKRIEIK-----DSTNSTIKYRLISVIDHVGNTFYGHYYCRSNFEGS-DWWLLNDAHV-EKCSDDEVVTKNAIVFLFKK 1297
            G  N    C++N VIQ L+   + T+ + +    +     T+D   +     LIQ +  ++        L ++  T  +  ++ +  D  +  + F++ L S ++  +K      +D+ S      +KA   +E +       V D F GQL   + C  C N  +  + F  + S+PL    S S+  LE+C++ F  +  ++  +   CA C       KS T +   PKYL I+L R S T   +K+   +       E+       ++NS + Y L ++ +H+G+T  GHY        S  W   ND  V +  S++ +V+ +A +  +++
Sbjct:  241 GLRNIGNTCFMNSVIQCLSHTQELTRFLRSHHGSRSL--STKDQQILHEFAKLIQEMWTANVHTVTPMELKRAFSTKHRMYSDYNQQDAQEFLRFFLDSLHSALNSGVKGETLNIDDNLS----DNKKADLTWEWYTRHENSLVRDLFVGQLKSTLKCTTCGNTSVTFDPFWDL-SVPLP---SSSRCKLEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFT-IQRFPKYLVIHLKRFSET-RWSKLSNIVEFPTSDSELNMGSYGANSNSNVHYSLYAISNHMGSTAGGHYVALCKHPVSRKWHEFNDNIVSDALSENHLVSSSAYILFYER 564          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp2 (gene:FBgn0031187 transcript:FBtr0339507)

HSP 1 Score: 63.929 bits (154), Expect = 1.877e-10
Identity = 80/337 (23.74%), Postives = 149/337 (44.21%), Query Frame = 2
Query:  344 GFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDDTEDSVFVKGLFNLIQALRKSD-----KKNLDKSLETVQQYITESSFGD--DVYKCFMNIL-SRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDN--ICNESFQVMKSMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKCA-CDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTDNGAKIDTFITCSEKRIEIK-----DSTNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHV-EKCSDDEVVTKNAIVFLFKK 1297
            G  N    C++N VIQ L+   + T+ + +    +     T+D   +     LIQ +  ++        L ++  T  +  ++ +  D  +  + F++ L S ++  +K      +D+ S      +KA   +E +       V D F GQL   + C  C N  +  + F  + S+PL    S S+  LE+C++ F  +  ++  +   CA C       KS T +   PKYL I+L R S T   +K+   +       E+       ++NS + Y L ++ +H+G+T  GHY   C+       W   ND  V +  S++ +V+ +A +  +++
Sbjct:  626 GLRNIGNTCFMNSVIQCLSHTQELTRFLRSHHGSRSL--STKDQQILHEFAKLIQEMWTANVHTVTPMELKRAFSTKHRMYSDYNQQDAQEFLRFFLDSLHSALNSGVKGETLNIDDNLS----DNKKADLTWEWYTRHENSLVRDLFVGQLKSTLKCTTCGNTSVTFDPFWDL-SVPLP---SSSRCKLEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFT-IQRFPKYLVIHLKRFSET-RWSKLSNIVEFPTSDSELNMGSYGANSNSNVHYSLYAISNHMGSTAGGHYVALCKHPVS-RKWHEFNDNIVSDALSENHLVSSSAYILFYER 949          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp2 (gene:FBgn0031187 transcript:FBtr0309238)

HSP 1 Score: 63.929 bits (154), Expect = 1.969e-10
Identity = 80/337 (23.74%), Postives = 149/337 (44.21%), Query Frame = 2
Query:  344 GFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDDTEDSVFVKGLFNLIQALRKSD-----KKNLDKSLETVQQYITESSFGD--DVYKCFMNIL-SRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDN--ICNESFQVMKSMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKCA-CDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTDNGAKIDTFITCSEKRIEIK-----DSTNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHV-EKCSDDEVVTKNAIVFLFKK 1297
            G  N    C++N VIQ L+   + T+ + +    +     T+D   +     LIQ +  ++        L ++  T  +  ++ +  D  +  + F++ L S ++  +K      +D+ S      +KA   +E +       V D F GQL   + C  C N  +  + F  + S+PL    S S+  LE+C++ F  +  ++  +   CA C       KS T +   PKYL I+L R S T   +K+   +       E+       ++NS + Y L ++ +H+G+T  GHY   C+       W   ND  V +  S++ +V+ +A +  +++
Sbjct:  614 GLRNIGNTCFMNSVIQCLSHTQELTRFLRSHHGSRSL--STKDQQILHEFAKLIQEMWTANVHTVTPMELKRAFSTKHRMYSDYNQQDAQEFLRFFLDSLHSALNSGVKGETLNIDDNLS----DNKKADLTWEWYTRHENSLVRDLFVGQLKSTLKCTTCGNTSVTFDPFWDL-SVPLP---SSSRCKLEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFT-IQRFPKYLVIHLKRFSET-RWSKLSNIVEFPTSDSELNMGSYGANSNSNVHYSLYAISNHMGSTAGGHYVALCKHPVS-RKWHEFNDNIVSDALSENHLVSSSAYILFYER 937          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp2 (gene:FBgn0031187 transcript:FBtr0077349)

HSP 1 Score: 63.929 bits (154), Expect = 1.969e-10
Identity = 80/337 (23.74%), Postives = 149/337 (44.21%), Query Frame = 2
Query:  344 GFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDDTEDSVFVKGLFNLIQALRKSD-----KKNLDKSLETVQQYITESSFGD--DVYKCFMNIL-SRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDN--ICNESFQVMKSMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKCA-CDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTDNGAKIDTFITCSEKRIEIK-----DSTNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHV-EKCSDDEVVTKNAIVFLFKK 1297
            G  N    C++N VIQ L+   + T+ + +    +     T+D   +     LIQ +  ++        L ++  T  +  ++ +  D  +  + F++ L S ++  +K      +D+ S      +KA   +E +       V D F GQL   + C  C N  +  + F  + S+PL    S S+  LE+C++ F  +  ++  +   CA C       KS T +   PKYL I+L R S T   +K+   +       E+       ++NS + Y L ++ +H+G+T  GHY   C+       W   ND  V +  S++ +V+ +A +  +++
Sbjct:  614 GLRNIGNTCFMNSVIQCLSHTQELTRFLRSHHGSRSL--STKDQQILHEFAKLIQEMWTANVHTVTPMELKRAFSTKHRMYSDYNQQDAQEFLRFFLDSLHSALNSGVKGETLNIDDNLS----DNKKADLTWEWYTRHENSLVRDLFVGQLKSTLKCTTCGNTSVTFDPFWDL-SVPLP---SSSRCKLEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFT-IQRFPKYLVIHLKRFSET-RWSKLSNIVEFPTSDSELNMGSYGANSNSNVHYSLYAISNHMGSTAGGHYVALCKHPVS-RKWHEFNDNIVSDALSENHLVSSSAYILFYER 937          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp2 (gene:FBgn0031187 transcript:FBtr0309239)

HSP 1 Score: 63.929 bits (154), Expect = 1.969e-10
Identity = 80/337 (23.74%), Postives = 149/337 (44.21%), Query Frame = 2
Query:  344 GFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDDTEDSVFVKGLFNLIQALRKSD-----KKNLDKSLETVQQYITESSFGD--DVYKCFMNIL-SRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDN--ICNESFQVMKSMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKCA-CDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTDNGAKIDTFITCSEKRIEIK-----DSTNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHV-EKCSDDEVVTKNAIVFLFKK 1297
            G  N    C++N VIQ L+   + T+ + +    +     T+D   +     LIQ +  ++        L ++  T  +  ++ +  D  +  + F++ L S ++  +K      +D+ S      +KA   +E +       V D F GQL   + C  C N  +  + F  + S+PL    S S+  LE+C++ F  +  ++  +   CA C       KS T +   PKYL I+L R S T   +K+   +       E+       ++NS + Y L ++ +H+G+T  GHY   C+       W   ND  V +  S++ +V+ +A +  +++
Sbjct:  614 GLRNIGNTCFMNSVIQCLSHTQELTRFLRSHHGSRSL--STKDQQILHEFAKLIQEMWTANVHTVTPMELKRAFSTKHRMYSDYNQQDAQEFLRFFLDSLHSALNSGVKGETLNIDDNLS----DNKKADLTWEWYTRHENSLVRDLFVGQLKSTLKCTTCGNTSVTFDPFWDL-SVPLP---SSSRCKLEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFT-IQRFPKYLVIHLKRFSET-RWSKLSNIVEFPTSDSELNMGSYGANSNSNVHYSLYAISNHMGSTAGGHYVALCKHPVS-RKWHEFNDNIVSDALSENHLVSSSAYILFYER 937          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp2a (ubiquitin specific peptidase 2a [Source:ZFIN;Acc:ZDB-GENE-041212-59])

HSP 1 Score: 75.0998 bits (183), Expect = 3.663e-14
Identity = 85/342 (24.85%), Postives = 144/342 (42.11%), Query Frame = 2
Query:  341 MGFNNPKGYCYLNCVIQVLA---SCGDFTKDIENSDCQQYFVDDTEDSVFVKGLFNLIQALRKSDKKNLDKSLE---TVQQYITE---------SSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVAQSESQILLESCVESFFSKSQVEVSD--PLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIEIKD---STNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFKK 1297
            +G  N    C++N ++Q L+   S  D+   + NS  +    ++   +  ++    LIQ +  S         E    +Q+Y              F   +     N ++RV+   + N E   D   LP    EK K+ + K+  R    + D F GQL   +TC  C   C+  F     + L +A+   ++ L  C+   F+K  V   D  P    C       K  T +   PK L ++L R S      +K+ TF+    K +++++     +S+  Y L +V +H G T  GHY  YC  N E  +W+  ND+ V   S  +V + +A V  +++
Sbjct:   61 VGLRNLGNTCFMNSILQCLSNTQSLRDYC--LHNSHRRDLNNNNRTHTALMEEFAKLIQTMWTSSSSEAVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVTVRPRGNTE---DFDHLP--DEEKGKKMWSKYLEREDSKIVDLFVGQLKSSLTCSEC-GYCSTVFDPFWDLSLPIAKGYGEVSLMDCMR-LFTKEDVLDGDEKPTCYRCKARRRCTKKFT-VQKFPKILVLHLKRFSEARIRTSKLSTFVNFPMKDLDLREFASDRSSSAVYNLYAVSNHSGTTMGGHYTAYC-CNPENGEWYTYNDSRVTPMSASQVRSSDAYVLFYER 391          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp2b (ubiquitin specific peptidase 2b [Source:ZFIN;Acc:ZDB-GENE-100208-2])

HSP 1 Score: 75.0998 bits (183), Expect = 3.746e-14
Identity = 59/207 (28.50%), Postives = 98/207 (47.34%), Query Frame = 2
Query:  698 EKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLT--HGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIEIKD--STNST-IKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFK 1294
            EK K+ + K+       V D F GQL   +TC  C   C+  F     + L +A++  ++ L  C+  F  +  ++ ++  +  C    T  K   K T    PK L ++L R S      +K+ TF+    K +++++  S NS    Y L +V +H G +  GHY  YCRS   G +W+  ND+ V   S  +V + +A V  ++
Sbjct:  189 EKGKRMWNKYLESEDSKVVDLFVGQLKSSLTCSEC-GFCSTVFDPFWDLSLPIAKTSGEVSLNDCLRLFTKEDVLDGNE--RPTCHRCKTRRKCTKKFTIQKFPKILVLHLKRFSECRVRTSKLSTFVNFPLKELDLREFASDNSVNAVYNLYAVSNHTGTSLGGHYTAYCRSPCTG-EWYTYNDSRVSPMSSSQVCSSDAYVLFYE 391          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp11 (ubiquitin specific peptidase 11 [Source:ZFIN;Acc:ZDB-GENE-081104-421])

HSP 1 Score: 67.0106 bits (162), Expect = 4.501e-12
Identity = 47/173 (27.17%), Postives = 83/173 (47.98%), Query Frame = 2
Query:  815 NESFQVMKSMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIE-----IKDSTNST---IKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFKKE 1300
            NE+ + +K   + V   ++ + L+ C+E F +   +E  +P  C       L      L   P+ L I+L R SYT  +  K+DT +    + ++     +K + NST     Y LISV +H G    GHY  Y R N +   W+  +D+ V    ++++VT  A +  ++++
Sbjct:   41 NEAEKYIKHQSMDVPHQQTTVQLQECIELFTTVETLEEENPWYCPTCKRHQLATKKLDLWSLPEVLIIHLKRFSYTKYSREKLDTIVEFPLRDLDFSGFLLKKTVNSTEPPCPYDLISVSNHYGGLRDGHYTSYAR-NKDNGQWYYFDDSKVTYAREEQIVTSAAYLLFYQRQ 212          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp11 (ubiquitin specific peptidase 11 [Source:ZFIN;Acc:ZDB-GENE-081104-421])

HSP 1 Score: 66.6254 bits (161), Expect = 3.551e-11
Identity = 47/173 (27.17%), Postives = 83/173 (47.98%), Query Frame = 2
Query:  815 NESFQVMKSMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIE-----IKDSTNST---IKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFKKE 1300
            NE+ + +K   + V   ++ + L+ C+E F +   +E  +P  C       L      L   P+ L I+L R SYT  +  K+DT +    + ++     +K + NST     Y LISV +H G    GHY  Y R N +   W+  +D+ V    ++++VT  A +  ++++
Sbjct:  777 NEAEKYIKHQSMDVPHQQTTVQLQECIELFTTVETLEEENPWYCPTCKRHQLATKKLDLWSLPEVLIIHLKRFSYTKYSREKLDTIVEFPLRDLDFSGFLLKKTVNSTEPPCPYDLISVSNHYGGLRDGHYTSYAR-NKDNGQWYYFDDSKVTYAREEQIVTSAAYLLFYQRQ 948          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp18 (ubiquitin specific peptidase 18 [Source:ZFIN;Acc:ZDB-GENE-100210-2])

HSP 1 Score: 56.6102 bits (135), Expect = 2.547e-8
Identity = 54/195 (27.69%), Postives = 90/195 (46.15%), Query Frame = 2
Query:  785 MTCDICDNICNESFQVMKSMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTDNG--AKIDTFITCSEK---------RIEIKDSTNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVV-----TKNAIVFLF-KKEIDSA 1312
            M C     + N  F    S+PL + + E+   LESC++SFF K ++EVS+   C             KL   P+ L ++L R    ++G   K+D+ +T  E          + E   S +    Y L +VI H+G+  +GHY  + R   +   W+  ND+ V + +  +V       + A + L+ KK +DS+
Sbjct:  150 MDCTFIHRLPNSYF----SLPLVIHEGENT--LESCIKSFFKKQKLEVSEKFFCDRCEKKQPCAYEQKLVSLPQILCVHLKRFR-NEHGLIKKLDSKVTFPETLKISVFAAGQSENAASDSPQADYSLFAVIVHIGSAMFGHYTAFIRQT-QDQMWYYANDSRVNQATWKDVQDTYKGRETAYLLLYRKKSLDSS 336          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: med4 (mediator complex subunit 4 [Source:Xenbase;Acc:XB-GENE-972352])

HSP 1 Score: 80.4925 bits (197), Expect = 6.208e-16
Identity = 87/353 (24.65%), Postives = 155/353 (43.91%), Query Frame = 2
Query:  326 HIDKPMGFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDDTE----DSVFVKGLFNLIQALRKSDKKNLDKSLE---TVQQYITE-SSFGDDVYKCFMNIL-----SRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVA-QSESQILLESCVESFFSKSQVEVSD--PLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIEIKD---STNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFKKEIDSAVM 1318
            H+   +G  N    C++N ++Q L++    TKD+ +   Q  +  D      ++  ++    L+QA+  S    +    E    +Q+Y      +     + F+  L     + V++V       S D   +P   +EK K  ++++  R    + + F GQL   +TC  C   C+  F     + L +A +S S++ L  C+   F+K  V   D  P  C C       K  T +   PK L ++L R S       K+ TF+    K +++++    +N    Y L +V +H G T  GHY  YC++   G +W+  ND+ V   S ++V + +A V  ++    S+ M
Sbjct:    9 HVQGLVGLRNLGNTCFMNSILQCLSN----TKDLRDYCLQNSYRRDLSSKKCNTAIMEEFARLLQAIWTSSANEVVSPSEFKTQIQKYAPRFMGYNQQDAQEFLRFLLDGLHNEVNRVTVKPRPSSQDLDHMP--DSEKGKHMWKRYLEREDSRIVELFVGQLKSSLTCTEC-GYCSTVFDPFWDLSLPIAKKSASEVSLVDCMR-LFTKEDVLDGDEKPTCCRCKARRRCTKKFT-IQKFPKILVLHLKRFSEGRIRSGKLSTFVNFPLKDLDLREFSSESNPHATYNLYAVSNHSGTTMGGHYTAYCKNPSNG-EWYTFNDSRVTAMSSNQVRSSDAYVLFYELSGPSSRM 351          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: med4 (mediator complex subunit 4 [Source:Xenbase;Acc:XB-GENE-972352])

HSP 1 Score: 80.4925 bits (197), Expect = 1.785e-15
Identity = 87/353 (24.65%), Postives = 155/353 (43.91%), Query Frame = 2
Query:  326 HIDKPMGFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDDTE----DSVFVKGLFNLIQALRKSDKKNLDKSLE---TVQQYITE-SSFGDDVYKCFMNIL-----SRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVA-QSESQILLESCVESFFSKSQVEVSD--PLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIEIKD---STNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFKKEIDSAVM 1318
            H+   +G  N    C++N ++Q L++    TKD+ +   Q  +  D      ++  ++    L+QA+  S    +    E    +Q+Y      +     + F+  L     + V++V       S D   +P   +EK K  ++++  R    + + F GQL   +TC  C   C+  F     + L +A +S S++ L  C+   F+K  V   D  P  C C       K  T +   PK L ++L R S       K+ TF+    K +++++    +N    Y L +V +H G T  GHY  YC++   G +W+  ND+ V   S ++V + +A V  ++    S+ M
Sbjct:  222 HVQGLVGLRNLGNTCFMNSILQCLSN----TKDLRDYCLQNSYRRDLSSKKCNTAIMEEFARLLQAIWTSSANEVVSPSEFKTQIQKYAPRFMGYNQQDAQEFLRFLLDGLHNEVNRVTVKPRPSSQDLDHMP--DSEKGKHMWKRYLEREDSRIVELFVGQLKSSLTCTEC-GYCSTVFDPFWDLSLPIAKKSASEVSLVDCMR-LFTKEDVLDGDEKPTCCRCKARRRCTKKFT-IQKFPKILVLHLKRFSEGRIRSGKLSTFVNFPLKDLDLREFSSESNPHATYNLYAVSNHSGTTMGGHYTAYCKNPSNG-EWYTFNDSRVTAMSSNQVRSSDAYVLFYELSGPSSRM 564          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: med4 (mediator complex subunit 4 [Source:Xenbase;Acc:XB-GENE-972352])

HSP 1 Score: 79.337 bits (194), Expect = 2.824e-15
Identity = 85/345 (24.64%), Postives = 152/345 (44.06%), Query Frame = 2
Query:  326 HIDKPMGFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDDTE----DSVFVKGLFNLIQALRKSDKKNLDKSLE---TVQQYITE-SSFGDDVYKCFMNIL-----SRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVA-QSESQILLESCVESFFSKSQVEVSD--PLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIEIKD---STNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFK 1294
            H+   +G  N    C++N ++Q L++    TKD+ +   Q  +  D      ++  ++    L+QA+  S    +    E    +Q+Y      +     + F+  L     + V++V       S D   +P   +EK K  ++++  R    + + F GQL   +TC  C   C+  F     + L +A +S S++ L  C+   F+K  V   D  P  C C       K  T +   PK L ++L R S       K+ TF+    K +++++    +N    Y L +V +H G T  GHY  YC++   G +W+  ND+ V   S ++V + +A V  ++
Sbjct:   11 HVQGLVGLRNLGNTCFMNSILQCLSN----TKDLRDYCLQNSYRRDLSSKKCNTAIMEEFARLLQAIWTSSANEVVSPSEFKTQIQKYAPRFMGYNQQDAQEFLRFLLDGLHNEVNRVTVKPRPSSQDLDHMP--DSEKGKHMWKRYLEREDSRIVELFVGQLKSSLTCTEC-GYCSTVFDPFWDLSLPIAKKSASEVSLVDCMR-LFTKEDVLDGDEKPTCCRCKARRRCTKKFT-IQKFPKILVLHLKRFSEGRIRSGKLSTFVNFPLKDLDLREFSSESNPHATYNLYAVSNHSGTTMGGHYTAYCKNPSNG-EWYTFNDSRVTAMSSNQVRSSDAYVLFYE 345          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: med4 (mediator complex subunit 4 [Source:Xenbase;Acc:XB-GENE-972352])

HSP 1 Score: 55.0694 bits (131), Expect = 1.247e-7
Identity = 55/228 (24.12%), Postives = 99/228 (43.42%), Query Frame = 2
Query:  695 TEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVAQ-SESQILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLTHGPKYLF-----------IYLNRGSYTDN---GAKIDTFITCSEKRIEIKD---STNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFKKEIDSAVM 1318
            +EK K  ++++  R    + + F GQL   +TC  C   C+  F     + L +A+ S S++ L  C+   F+K  V   D           ++      T  PK  F             L+   +++      K+ TF+    K +++++    +N    Y L +V +H G T  GHY  YC++   G +W+  ND+ V   S ++V + +A V  ++    S+ M
Sbjct:  141 SEKGKHMWKRYLEREDSRIVELFVGQLKSSLTCTEC-GYCSTVFDPFWDLSLPIAKKSASEVSLVDCMR-LFTKEDVLDGDE--------KPVIFFTCFRTKSPKIYFQSFCSVLLDLLQNLDLKRFSEGRIRSGKLSTFVNFPLKDLDLREFSSESNPHATYNLYAVSNHSGTTMGGHYTAYCKNPSNG-EWYTFNDSRVTAMSSNQVRSSDAYVLFYELSGPSSRM 357          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: usp33 (ubiquitin specific peptidase 33 [Source:NCBI gene;Acc:548982])

HSP 1 Score: 52.373 bits (124), Expect = 1.494e-6
Identity = 44/154 (28.57%), Postives = 72/154 (46.75%), Query Frame = 2
Query:  875 ILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTDN-GAKIDTFITCSEKRIEI-----KDSTNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFKKEIDSA 1312
            + L+ C+ +FF++      D LK    NG    K    +   P+ L I+L R  +      KI T ++   + +++     KDS +  + Y L+SVI H G    GHY  YCR+N   + W+  +D  V + S+  V    A V  ++K  + A
Sbjct:  513 VTLQDCLAAFFAR------DELKGELRNGVKFCK----VQKFPEILCIHLKRFRHELMFSTKIGTHVSFPLEGLDLQPFLAKDSPSQIVTYDLLSVICHHGTASSGHYIAYCRNNL-NNLWYEFDDQSVTEVSEATVQNAEAYVLFYRKASEEA 655          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp2 (ubiquitin specific peptidase 2 [Source:MGI Symbol;Acc:MGI:1858178])

HSP 1 Score: 73.559 bits (179), Expect = 1.293e-13
Identity = 83/344 (24.13%), Postives = 151/344 (43.90%), Query Frame = 2
Query:  344 GFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDD-----TEDSVFVKGLFNLIQALRKSDKKNLDKSLE---TVQQYITE---------SSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVA-QSESQILLESCVESFFSKSQVEVSD--PLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIEIK----DSTNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFK 1294
            G  N    C++N ++Q L++    T+++ +   Q+ ++ D     +  +  ++    LIQ +  S   ++    E    +Q+Y              F   +     N ++RV+   K + E  +    LP    EK +Q + K+  R    + D F GQL   +TC  C   C+  F     + L +A +   ++ L  C+   F+K  +   D  P  C C      +K  + +   PK L ++L R S +    +K+ TF+    + ++++    ++TN  + Y L +V +H G T  GHY  YCRS   G +W   ND+ V   S  +V T +A +  ++
Sbjct:   56 GLRNLGNTCFMNSILQCLSN----TRELRDYCLQRLYMRDLGHTSSAHTALMEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFMGYNQQDAQEFLRFLLDGLHNEVNRVAARPKASPETLDH---LP--DEEKGRQMWRKYLEREDSRIGDLFVGQLKSSLTCTDC-GYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMR-LFTKEDILDGDEKPTCCRCRARKRCIKKFS-VQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRDLDLREFASENTNHAV-YNLYAVSNHSGTTMGGHYTAYCRSPVTG-EWHTFNDSSVTPMSSSQVRTSDAYLLFYE 385          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp2 (ubiquitin specific peptidase 2 [Source:MGI Symbol;Acc:MGI:1858178])

HSP 1 Score: 73.559 bits (179), Expect = 1.325e-13
Identity = 83/344 (24.13%), Postives = 151/344 (43.90%), Query Frame = 2
Query:  344 GFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDD-----TEDSVFVKGLFNLIQALRKSDKKNLDKSLE---TVQQYITE---------SSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVA-QSESQILLESCVESFFSKSQVEVSD--PLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIEIK----DSTNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFK 1294
            G  N    C++N ++Q L++    T+++ +   Q+ ++ D     +  +  ++    LIQ +  S   ++    E    +Q+Y              F   +     N ++RV+   K + E  +    LP    EK +Q + K+  R    + D F GQL   +TC  C   C+  F     + L +A +   ++ L  C+   F+K  +   D  P  C C      +K  + +   PK L ++L R S +    +K+ TF+    + ++++    ++TN  + Y L +V +H G T  GHY  YCRS   G +W   ND+ V   S  +V T +A +  ++
Sbjct:   59 GLRNLGNTCFMNSILQCLSN----TRELRDYCLQRLYMRDLGHTSSAHTALMEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFMGYNQQDAQEFLRFLLDGLHNEVNRVAARPKASPETLDH---LP--DEEKGRQMWRKYLEREDSRIGDLFVGQLKSSLTCTDC-GYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMR-LFTKEDILDGDEKPTCCRCRARKRCIKKFS-VQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRDLDLREFASENTNHAV-YNLYAVSNHSGTTMGGHYTAYCRSPVTG-EWHTFNDSSVTPMSSSQVRTSDAYLLFYE 388          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp2 (ubiquitin specific peptidase 2 [Source:MGI Symbol;Acc:MGI:1858178])

HSP 1 Score: 73.1738 bits (178), Expect = 2.724e-13
Identity = 83/344 (24.13%), Postives = 151/344 (43.90%), Query Frame = 2
Query:  344 GFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDD-----TEDSVFVKGLFNLIQALRKSDKKNLDKSLE---TVQQYITE---------SSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVA-QSESQILLESCVESFFSKSQVEVSD--PLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIEIK----DSTNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFK 1294
            G  N    C++N ++Q L++    T+++ +   Q+ ++ D     +  +  ++    LIQ +  S   ++    E    +Q+Y              F   +     N ++RV+   K + E  +    LP    EK +Q + K+  R    + D F GQL   +TC  C   C+  F     + L +A +   ++ L  C+   F+K  +   D  P  C C      +K  + +   PK L ++L R S +    +K+ TF+    + ++++    ++TN  + Y L +V +H G T  GHY  YCRS   G +W   ND+ V   S  +V T +A +  ++
Sbjct:  282 GLRNLGNTCFMNSILQCLSN----TRELRDYCLQRLYMRDLGHTSSAHTALMEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFMGYNQQDAQEFLRFLLDGLHNEVNRVAARPKASPETLDH---LP--DEEKGRQMWRKYLEREDSRIGDLFVGQLKSSLTCTDC-GYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMR-LFTKEDILDGDEKPTCCRCRARKRCIKKFS-VQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRDLDLREFASENTNHAV-YNLYAVSNHSGTTMGGHYTAYCRSPVTG-EWHTFNDSSVTPMSSSQVRTSDAYLLFYE 611          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp2 (ubiquitin specific peptidase 2 [Source:MGI Symbol;Acc:MGI:1858178])

HSP 1 Score: 73.1738 bits (178), Expect = 2.724e-13
Identity = 83/344 (24.13%), Postives = 151/344 (43.90%), Query Frame = 2
Query:  344 GFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDD-----TEDSVFVKGLFNLIQALRKSDKKNLDKSLE---TVQQYITE---------SSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVA-QSESQILLESCVESFFSKSQVEVSD--PLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIEIK----DSTNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFK 1294
            G  N    C++N ++Q L++    T+++ +   Q+ ++ D     +  +  ++    LIQ +  S   ++    E    +Q+Y              F   +     N ++RV+   K + E  +    LP    EK +Q + K+  R    + D F GQL   +TC  C   C+  F     + L +A +   ++ L  C+   F+K  +   D  P  C C      +K  + +   PK L ++L R S +    +K+ TF+    + ++++    ++TN  + Y L +V +H G T  GHY  YCRS   G +W   ND+ V   S  +V T +A +  ++
Sbjct:  282 GLRNLGNTCFMNSILQCLSN----TRELRDYCLQRLYMRDLGHTSSAHTALMEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFMGYNQQDAQEFLRFLLDGLHNEVNRVAARPKASPETLDH---LP--DEEKGRQMWRKYLEREDSRIGDLFVGQLKSSLTCTDC-GYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMR-LFTKEDILDGDEKPTCCRCRARKRCIKKFS-VQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRDLDLREFASENTNHAV-YNLYAVSNHSGTTMGGHYTAYCRSPVTG-EWHTFNDSSVTPMSSSQVRTSDAYLLFYE 611          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp2 (ubiquitin specific peptidase 2 [Source:MGI Symbol;Acc:MGI:1858178])

HSP 1 Score: 73.1738 bits (178), Expect = 2.724e-13
Identity = 83/344 (24.13%), Postives = 151/344 (43.90%), Query Frame = 2
Query:  344 GFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDD-----TEDSVFVKGLFNLIQALRKSDKKNLDKSLE---TVQQYITE---------SSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVA-QSESQILLESCVESFFSKSQVEVSD--PLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIEIK----DSTNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFK 1294
            G  N    C++N ++Q L++    T+++ +   Q+ ++ D     +  +  ++    LIQ +  S   ++    E    +Q+Y              F   +     N ++RV+   K + E  +    LP    EK +Q + K+  R    + D F GQL   +TC  C   C+  F     + L +A +   ++ L  C+   F+K  +   D  P  C C      +K  + +   PK L ++L R S +    +K+ TF+    + ++++    ++TN  + Y L +V +H G T  GHY  YCRS   G +W   ND+ V   S  +V T +A +  ++
Sbjct:  282 GLRNLGNTCFMNSILQCLSN----TRELRDYCLQRLYMRDLGHTSSAHTALMEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFMGYNQQDAQEFLRFLLDGLHNEVNRVAARPKASPETLDH---LP--DEEKGRQMWRKYLEREDSRIGDLFVGQLKSSLTCTDC-GYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMR-LFTKEDILDGDEKPTCCRCRARKRCIKKFS-VQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRDLDLREFASENTNHAV-YNLYAVSNHSGTTMGGHYTAYCRSPVTG-EWHTFNDSSVTPMSSSQVRTSDAYLLFYE 611          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|O57429|UBP2_CHICK (Ubiquitin carboxyl-terminal hydrolase 2 OS=Gallus gallus OX=9031 GN=USP2 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 7.061e-14
Identity = 88/349 (25.21%), Postives = 151/349 (43.27%), Query Frame = 2
Query:  344 GFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQ-QYFVDDTEDSVFVKGLFN----LIQALRKSDKKNLDKSLE---TVQQYITE-SSFGDDVYKCFMNIL-----SRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVA-QSESQILLESCVESFFSKSQVEVSD--PLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIEIKD----STNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFKKEIDSAVM 1318
            G  N    C++N ++Q L++    TK++ +   Q QY  D   +S     L +    LIQ L  S   +     E    +Q+Y      +     + F+  L       V++V+      ++    LP    EK++Q + +++ R    V D F GQL   +TC  C   C+ +F     + L +  +   ++ L  C+   F+K  V   D  P  C C   +   K  + +   PK L ++L R S      +K+ TF+    K +++++    S N  + Y L +V +H G T  GHY  YC+S    S+W   ND+ V   S   V + +A +  ++    S+ M
Sbjct:   20 GLRNLGNTCFMNSILQCLSN----TKELRDYCLQNQYLRDLNNNSRMRTALMSEFAKLIQLLWTSSPNDSVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHGEVNRVLVRPRANADTLDHLP--DDEKSRQMWRRYQEREDSRVSDLFVGQLKSSLTCSEC-GYCSTAFDPFWDLSLPIPKKGYGEVTLMDCLR-LFTKEDVLDGDEKPTCCRCKARTRCTKKFS-IQKFPKILVLHLKRFSEARIRASKLTTFVNFPLKDLDLREFASQSCNHAV-YNLYAVSNHSGTTMGGHYTAYCKSPI-SSEWHSFNDSRVTPMSSSHVRSSDAYLLFYELASPSSRM 357          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|O75604|UBP2_HUMAN (Ubiquitin carboxyl-terminal hydrolase 2 OS=Homo sapiens OX=9606 GN=USP2 PE=1 SV=2)

HSP 1 Score: 75.485 bits (184), Expect = 4.077e-13
Identity = 86/344 (25.00%), Postives = 151/344 (43.90%), Query Frame = 2
Query:  344 GFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDD-----TEDSVFVKGLFNLIQALRKSDKKNLDKSLE---TVQQYITE---------SSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVA-QSESQILLESCVESFFSKSQVEVSD--PLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIEIK----DSTNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFK 1294
            G  N    C++N ++Q L++    T+++ +   Q+ ++ D        +  V+    LIQ +  S   ++    E    +Q+Y              F   +     N ++RV+   K+N E  +    LP    EK +Q + K+  R    + D F GQL   +TC  C   C+  F     + L +A +   ++ L  C+   F+K  V   D  P  C C      +K  + +   PK L ++L R S +    +K+ TF+    + ++++    ++TN  + Y L +V +H G T  GHY  YCRS   G +W   ND+ V   S  +V T +A +  ++
Sbjct:  268 GLRNLGNTCFMNSILQCLSN----TRELRDYCLQRLYMRDLHHGSNAHTALVEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVTLRPKSNPENLDH---LP--DDEKGRQMWRKYLEREDSRIGDLFVGQLKSSLTCTDC-GYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMR-LFTKEDVLDGDEKPTCCRCRGRKRCIKKFS-IQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRDLDLREFASENTNHAV-YNLYAVSNHSGTTMGGHYTAYCRSPGTG-EWHTFNDSSVTPMSSSQVRTSDAYLLFYE 597          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q5U349|UBP2_RAT (Ubiquitin carboxyl-terminal hydrolase 2 OS=Rattus norvegicus OX=10116 GN=Usp2 PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.624e-12
Identity = 84/344 (24.42%), Postives = 151/344 (43.90%), Query Frame = 2
Query:  344 GFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDD-----TEDSVFVKGLFNLIQALRKSDKKNLDKSLE---TVQQYITE---------SSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVA-QSESQILLESCVESFFSKSQVEVSD--PLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIEIK----DSTNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFK 1294
            G  N    C++N ++Q L++    T+++ +   Q+ ++ D     +  +  ++    LIQ +  S   ++    E    +Q+Y              F   +     N ++RV+   K + E  +    LP    EK +Q + K+  R    + D F GQL   +TC  C   C+  F     + L +A +   ++ L  C+   F+K  V   D  P  C C      +K  + +   PK L ++L R S +    +K+ TF+    + ++++    ++TN  + Y L +V +H G T  GHY  YCRS   G +W   ND+ V   S  +V T +A +  ++
Sbjct:  281 GLRNLGNTCFMNSILQCLSN----TRELRDYCLQRLYMRDLGHTSSAHTALMEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVAARPKPSPESLDH---LP--DEEKGRQMWRKYLEREDSRIGDLFVGQLKSSLTCTDC-GYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMR-LFTKEDVLDGDEKPTCCRCRARKRCIKKFS-VQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRDLDLREFASENTNHAV-YNLYAVSNHSGTTMGGHYTAYCRSPVTG-EWHTFNDSSVTPMSSSQVRTSDAYLLFYE 610          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|O88623|UBP2_MOUSE (Ubiquitin carboxyl-terminal hydrolase 2 OS=Mus musculus OX=10090 GN=Usp2 PE=1 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 1.793e-12
Identity = 83/344 (24.13%), Postives = 151/344 (43.90%), Query Frame = 2
Query:  344 GFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDD-----TEDSVFVKGLFNLIQALRKSDKKNLDKSLE---TVQQYITE---------SSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVA-QSESQILLESCVESFFSKSQVEVSD--PLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIEIK----DSTNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFK 1294
            G  N    C++N ++Q L++    T+++ +   Q+ ++ D     +  +  ++    LIQ +  S   ++    E    +Q+Y              F   +     N ++RV+   K + E  +    LP    EK +Q + K+  R    + D F GQL   +TC  C   C+  F     + L +A +   ++ L  C+   F+K  +   D  P  C C      +K  + +   PK L ++L R S +    +K+ TF+    + ++++    ++TN  + Y L +V +H G T  GHY  YCRS   G +W   ND+ V   S  +V T +A +  ++
Sbjct:  276 GLRNLGNTCFMNSILQCLSN----TRELRDYCLQRLYMRDLGHTSSAHTALMEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFMGYNQQDAQEFLRFLLDGLHNEVNRVAARPKASPETLDH---LP--DEEKGRQMWRKYLEREDSRIGDLFVGQLKSSLTCTDC-GYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMR-LFTKEDILDGDEKPTCCRCRARKRCIKKFS-VQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRDLDLREFASENTNHAV-YNLYAVSNHSGTTMGGHYTAYCRSPVTG-EWHTFNDSSVTPMSSSQVRTSDAYLLFYE 605          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q2KHV7|UBP2_BOVIN (Ubiquitin carboxyl-terminal hydrolase 2 OS=Bos taurus OX=9913 GN=USP2 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 2.015e-10
Identity = 82/341 (24.05%), Postives = 149/341 (43.70%), Query Frame = 2
Query:  344 GFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDDTEDS-----VFVKGLFNLIQALRKSDKKNLDKSLE---TVQQYITE-SSFGDDVYKCFMNIL-----SRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVA-QSESQILLESCVESFFSKSQVEVSD--PLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIEIK----DSTNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFK 1294
            G  N    C++N ++Q L++    T+++ +   Q+ ++ D   S       ++    LIQ +  S   ++    E    +Q+Y      +     + F+  L     + V++VI      + +   LP    EK +Q + K+  R    + D F GQL   +TC  C   C+  F     + L +  +   ++ L  C+   F+K  V   D  P  C C      +K  + +   PK L ++L R S +    +K+  F+    + ++++    ++TN  + Y L +V +H G T  GHY  YCRS   G +W   ND+ V   S  +V T +A +  ++
Sbjct:  269 GLRNLGNTCFMNSILQCLSN----TRELRDYCLQRLYLRDLSHSSRAHTALMEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVIARPKSNTENLDHLP--DDEKGRQMWRKYLEREDSRIGDLFVGQLKSSLTCTDC-GYCSTVFDPFWDLSLPITKRGYPEVTLMDCMR-LFTKEDVLDGDEKPTCCRCRARKRCIKKFS-IQRFPKILVLHLKRFSESRIRTSKLTAFVNFPLRDLDLREFASENTNHAV-YNLYAVSNHSGTTMGGHYTAYCRSPVTG-EWHTFNDSSVSPMSSSQVRTSDAYLLFYE 598          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0EB12 (Uncharacterized protein OS=Paramecium tetraurelia OX=5888 GN=GSPATT00025213001 PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 5.455e-16
Identity = 84/327 (25.69%), Postives = 153/327 (46.79%), Query Frame = 2
Query:  341 MGFNNPKGYCYLNCVIQVLASCGDFTKDI---ENSDCQQYFVDDTEDSVFVK--GLFNLIQALRKSDKKNLDKSLETVQQYITESSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKC-ACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTDNGAKIDTFITCSEKRIEIKD--STNSTIKYRLISVIDHVGNTFYGHYYCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFKK 1297
            +G  NP+ YCYLN  +QVL S    ++ I   +    Q+Y V   E    +K  G F+ I A  +S  +N     +  QQ         D ++  +  L ++ + +    +   +  S        A+Q +  + ++N   V   F GQ T Q  C  C+ +C E +  +  + L +++S + + L  C++S++ +    ++D  KC  C   +  VK    ++  PKYL I   R +      KI+  I+  EK ++I++  S     KY+L ++I H+G+   GHY   +     +W+L +D  V K +  ++  ++A V L++K
Sbjct:  267 VGLRNPRYYCYLNSALQVLLSIDSLSEGILAVQPKQGQKYLVAYQELLRTIKRSGSFSAIAA--QSVWENCSGKFQFNQQ--------QDSHEFLLFFLGKIQEELVGKYKNKQEFNS--------AEQAWSDYTSKNYDIVDTIFAGQSTSQSFCKSCNQVC-EGYDPIWDLSLPISKSYTGVDLMDCLKSYYREE--VINDTWKCDKCKKTNKSVKRRMFISQTPKYLIIQFKRFTTFPTSQKINDSISYPEK-LDIQEFCSKGLQTKYKLKALITHMGSINGGHYKAYAE-RYDNWYLFDDETVSKINGKQLSDRSAYVLLYQK 570          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A507D784 (Ubiquitin carboxyl-terminal hydrolase OS=Synchytrium endobioticum OX=286115 GN=SeLEV6574_g04234 PE=3 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.467e-15
Identity = 54/216 (25.00%), Postives = 105/216 (48.61%), Query Frame = 2
Query:  704 AKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVAQS------ESQILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIEIKDST-NSTIKYRLISVIDHVGNTFYGHY--YCRSNFEG-SDWWLLNDAHVEKCSDDEVVTKNAIVFLFKKEIDSAVM 1318
            A +N++++  RN   + D F GQL  Q+ C+ C + C  +F  M  + + V  S         + L+ C+ +F  +  +E SD   C   N          +   P  L ++L R S++   G K+DT +    +++++   T  ++  + L++V +H+G+   GHY  Y +  F G  +W+L +DA V K     +V+++A +  + +  + A +
Sbjct:  383 AARNWDRYLARNKSVIVDLFQGQLKSQLGCETCGHRCT-TFDSMMYLSVPVPSSVSVPYKSGAVTLDDCLATFHQEETLEASDAWHCPQCNAKRRATKQLSIQKLPAILLVHLKRFSFSGMRGRKVDTLVHFPLEKLDLGQYTAGASAAFDLVAVSNHIGSASGGHYTAYVQRTFRGCREWYLFDDARVAKVDASSIVSRDAYILFYVRRAEKACL 597          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0CEF3 (Uncharacterized protein OS=Paramecium tetraurelia OX=5888 GN=GSPATT00037607001 PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 4.433e-14
Identity = 88/345 (25.51%), Postives = 155/345 (44.93%), Query Frame = 2
Query:  296 TDIIQQNPVSHIDKPMGFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDDTEDSVFVKGLFNLIQ----ALRKSDKKNLDKSLETVQQYITESSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVM--KSMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKC-ACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTDNGAKIDTFITCSEKRIEIKDSTNSTI---KYRLISVIDHVGNTFYGHYYCRSNFEGSDWWLLNDAHVEKCSDDEVVT-KNAIVFLFKK 1297
            T+ I+ NP  +    +G NNPK YCY+N ++Q L S  +    +     QQ          F+K + N I     ++ K     L+K   T QQ         D ++  + +LS + + +    +   + F         A++ ++ +K+RNP  + D F GQ+  +  C  C  I +E F  +   ++PL       +  L  C++++F + Q  ++D  KC  C+  +  V    KLT  PKYL ++L R +      KI   +   E  ++IK+     +   KY L  VI H+G    GHY   +  +   W+  +D  V K   ++ ++ K A + L+++
Sbjct:  251 TNSIKINPKPYELPYVGLNNPKYYCYMNSILQCLLSIKELNNSLIKYPKQQNKKFTMAYQEFLKVVQNSIPGSSISVEKLQNMCLNKFKYTQQQ---------DAHEFLLYLLSEIQEELVGKKQYKKEEFP-------NAQEAWDIYKSRNPDIITDLFAGQIASKSYCSKCKQI-SEGFDPILDLNLPLQKNSIPKEYKLYDCLQNYFKEEQ--INDVWKCDRCNFVNKSVLRKIKLTQTPKYLILHLKRFTQIPRSQKITDEVKYPE-ILDIKEFCEENVEYTKYTLKGVISHMGQLNGGHYVAYTQRQNQ-WYNFDDNVVTKDKTNQHLSDKGAYIILYEQ 574          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A452HB34 (Ubiquitin carboxyl-terminal hydrolase OS=Gopherus agassizii OX=38772 GN=USP2 PE=3 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 6.175e-14
Identity = 99/373 (26.54%), Postives = 161/373 (43.16%), Query Frame = 2
Query:  254 TRCFGKKRKNRNKITDIIQQNPVSH--IDKPMGFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQ-QYFVDDTEDSVFVKGLF----NLIQALRKSDKKNLDKSLE---TVQQYITE-SSFGDDVYKCFMNIL-----SRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVA-QSESQILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLT--HGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIEIKD----STNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFK 1294
            +RC  +  +     TD   ++P +   +    G  N    C++N ++Q L++    TK++ +   Q QY  D   +S     L      LIQ L  S    +    E    +Q+Y      +     + F+  L     S V++V+     RSN          EK +Q ++K++ R    + D F GQL   +TC  C   C+ +F     + L +A +S S++ L  C+   F+K  V   D  K  C    T  +   K +    PK L ++L R S      +K+ TFI+   K +++++    S N  I Y L +V +H G T  GHY  YC+S   G +W   ND+ V   S   V   NA +  ++
Sbjct:  225 SRCASQPWERSESRTDSPARDPSNSKTVQGLTGLRNLGNTCFMNSILQCLSN----TKELRDYCLQNQYMQDLNSNSRMHTALMAEFAKLIQLLWTSSPNEVVSPSEFKTQIQRYAPGFVGYNQQDAQEFLRFLLDGLHSEVNRVLVQ--PRSNLDDLDHLPDDEKGRQMWQKYQEREDSRIGDLFVGQLKSSLTCSEC-GYCSTAFDPFWDLSLPIAKKSYSEVTLLDCMR-LFTKEDVLDGDE-KPTCFRCKTRTRCTKKFSIQRFPKILVLHLKRFSEARIRTSKLTTFISFQLKDLDLREFAAQSCNHAI-YNLYAVSNHSGTTIGGHYTAYCKSPVSG-EWHTFNDSRVTPMSSSHVCHSNAYLLFYE 586          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0CPE0 (Uncharacterized protein OS=Paramecium tetraurelia OX=5888 GN=GSPATT00009048001 PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 9.104e-14
Identity = 76/324 (23.46%), Postives = 153/324 (47.22%), Query Frame = 2
Query:  341 MGFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDDTEDSVFVKGLFNLIQALRKSDKKN--LDKSLETVQQYITESSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKC-ACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTDNGAKIDTFITCSEKRIEIKD--STNSTIKYRLISVIDHVGNTFYGHYYCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFKK 1297
            +G +NP+ YCYLN  +QVL S    T+ I         +       F+     L+++++K+   +    KS+        + +   D ++  +  L ++ + +    +   +  S        A+Q +  + ++N   +   F GQ T Q  C  C+ +C E +  +  + L++ +S + I L  C++S++ + +V ++D  KC  C   +  VK    ++  P+YL I   R +      KI+  I+  EK ++I++  S     +Y+L ++I H+G    GHY   +     +W+L +D +V K +  ++  ++A V L++K
Sbjct:  279 IGLSNPRYYCYLNSALQVLLSIDSLTEGI-------LAIQPKYGQKFLTAYQELLRSIKKTGSYSSIAAKSVWDACSGKFQFNQQQDSHEFLLFFLGKIQEELVGKYKNKQEFNS--------AEQAWSDYTSKNQDIIDLIFAGQSTSQSYCKSCNQVC-EGYDPIWDLSLSINKSYTGIDLMDCLKSYY-REEV-INDTWKCDKCKKSNKSVKRRMFISQTPRYLIIQFKRFTTFPTSQKINDSISYPEK-LDIQEFCSKGLQTQYKLKALITHMGQINGGHYKAYAE-RYDNWYLFDDENVSKINGKQLSDRSAYVLLYEK 582          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp2b (ubiquitin carboxyl-terminal hydrolase 2-like [Source:NCBI gene;Acc:103044554])

HSP 1 Score: 82.8037 bits (203), Expect = 8.298e-17
Identity = 59/209 (28.23%), Postives = 97/209 (46.41%), Query Frame = 2
Query:  698 EKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIEIKD--STNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFKKEIDS 1309
            EKAK+ + K+  R    V D F GQL   +TC  C   C+  F     + L +A+S  ++ L  C+  F  +  ++ ++   C              +   PK L ++L R S      AK+ TF+    K +++++  S N    Y L +V +H G T  GHY  YCR+   G +W+  ND+ V   S  +V + +A V  ++  + S
Sbjct:  168 EKAKRMWNKYLEREDSKVVDLFVGQLKSSLTCSEC-GFCSTVFDPFWDLSLPIAKSSGEVALIDCLRLFTKEDVLDGNEKPTCQRCKARRKCTKKFSIQKFPKVLVLHLKRFSEARVKTAKLSTFVNFPIKELDLREFASDNMNAIYNLYAVSNHTGTTLGGHYTAYCRNPSTG-EWYTYNDSRVSPMSSSQVRSSDAYVLFYELALSS 374          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp2b (ubiquitin carboxyl-terminal hydrolase 2-like [Source:NCBI gene;Acc:103044554])

HSP 1 Score: 80.8777 bits (198), Expect = 4.392e-16
Identity = 60/210 (28.57%), Postives = 98/210 (46.67%), Query Frame = 2
Query:  698 EKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIEIKD--STNST-IKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFKKEIDS 1309
            EKAK+ + K+  R    V D F GQL   +TC  C   C+  F     + L +A+S  ++ L  C+  F  +  ++ ++   C              +   PK L ++L R S      AK+ TF+    K +++++  S NS    Y L +V +H G T  GHY  YCR+   G +W+  ND+ V   S  +V + +A V  ++  + S
Sbjct:  189 EKAKRMWNKYLEREDSKVVDLFVGQLKSSLTCSEC-GFCSTVFDPFWDLSLPIAKSSGEVALIDCLRLFTKEDVLDGNEKPTCQRCKARRKCTKKFSIQKFPKVLVLHLKRFSEARVKTAKLSTFVNFPIKELDLREFASDNSMNAIYNLYAVSNHTGTTLGGHYTAYCRNPSTG-EWYTYNDSRVSPMSSSQVRSSDAYVLFYELALSS 396          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp2b (ubiquitin carboxyl-terminal hydrolase 2-like [Source:NCBI gene;Acc:103044554])

HSP 1 Score: 80.4925 bits (197), Expect = 9.995e-16
Identity = 60/212 (28.30%), Postives = 99/212 (46.70%), Query Frame = 2
Query:  698 EKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIEIKD--STNS-TIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFKKEIDSAV 1315
            EKAK+ + K+  R    V D F GQL   +TC  C   C+  F     + L +A+S  ++ L  C+  F  +  ++ ++   C              +   PK L ++L R S      AK+ TF+    K +++++  S NS    Y L +V +H G T  GHY  YCR+   G +W+  ND+ V   S  +V + +A V  ++  + S +
Sbjct:  309 EKAKRMWNKYLEREDSKVVDLFVGQLKSSLTCSEC-GFCSTVFDPFWDLSLPIAKSSGEVALIDCLRLFTKEDVLDGNEKPTCQRCKARRKCTKKFSIQKFPKVLVLHLKRFSEARVKTAKLSTFVNFPIKELDLREFASDNSMNAIYNLYAVSNHTGTTLGGHYTAYCRNPSTG-EWYTYNDSRVSPMSSSQVRSSDAYVLFYELALSSRM 518          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp2a (ubiquitin carboxyl-terminal hydrolase 2-like [Source:NCBI gene;Acc:103025848])

HSP 1 Score: 77.0258 bits (188), Expect = 7.492e-15
Identity = 84/339 (24.78%), Postives = 144/339 (42.48%), Query Frame = 2
Query:  341 MGFNNPKGYCYLNCVIQVLA---SCGDFTKDIENSDCQQYFVDDTEDSVFVKGLFNLIQALRKSDKKNLDKSLE---TVQQYITE-SSFGDDVYKCFMNIL-----SRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVAQSESQILLESCVESFFSKSQVEVSD--PLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIEIKD---STNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFKK 1297
            +G  N    C++N ++Q L+   S  D+   + NS  +    +   ++  ++    LIQA+  S         E    +Q+Y      +     + F+  L     + V++V       + D   LP    EK K+ + K+  R    + D F GQL   +TC  C   C+  F     + L +A+   ++ L  CV   F+K  V   D  P    C       K  T +   PK L ++L R S      +K+ TF+    K +++++     +S+  Y L +V +H G T  GHY  YC  N    +W+  ND+ V   S  +V + +A V  +++
Sbjct:   62 VGLKNLGNTCFMNSILQCLSNTHSLRDYC--LHNSHRRDLNNNSRTNTALMEEFARLIQAMWMSSGSEAVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVTVRPRATTEDFDHLP--DEEKGKKMWSKYLEREDSKIVDLFVGQLKSSLTCTEC-GYCSTVFDPFWDLSLPIAKGYGEVSLMDCVR-LFTKEDVLDGDEKPTCYRCKARRRCTKKFT-IQRFPKILVLHLKRFSEARVRSSKLSTFVNFPMKDLDLREFASDRSSSAVYNLYAVSNHSGTTMGGHYTAYC-CNPATGEWYTYNDSRVTPMSSSQVRSSDAYVLFYER 392          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp2a (ubiquitin carboxyl-terminal hydrolase 2-like [Source:NCBI gene;Acc:103025848])

HSP 1 Score: 72.7886 bits (177), Expect = 3.197e-13
Identity = 84/340 (24.71%), Postives = 144/340 (42.35%), Query Frame = 2
Query:  341 MGFNNPKGYCYLNCVIQVLA---SCGDFTKDIENSDCQQYFVDDTEDSVFVKGLFNLIQALRKSDKKNLDKSLE---TVQQYITE-SSFGDDVYKCFMNIL-----SRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVA-QSESQILLESCVESFFSKSQVEVSD--PLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIEIKD---STNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFKK 1297
            +G  N    C++N ++Q L+   S  D+   + NS  +    +   ++  ++    LIQA+  S         E    +Q+Y      +     + F+  L     + V++V       + D   LP    EK K+ + K+  R    + D F GQL   +TC  C   C+  F     + L +A +   ++ L  CV   F+K  V   D  P    C       K  T +   PK L ++L R S      +K+ TF+    K +++++     +S+  Y L +V +H G T  GHY  YC  N    +W+  ND+ V   S  +V + +A V  +++
Sbjct:  234 VGLKNLGNTCFMNSILQCLSNTHSLRDYC--LHNSHRRDLNNNSRTNTALMEEFARLIQAMWMSSGSEAVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVTVRPRATTEDFDHLP--DEEKGKKMWSKYLEREDSKIVDLFVGQLKSSLTCTEC-GYCSTVFDPFWDLSLPIAKKGYGEVSLMDCVR-LFTKEDVLDGDEKPTCYRCKARRRCTKKFT-IQRFPKILVLHLKRFSEARVRSSKLSTFVNFPMKDLDLREFASDRSSSAVYNLYAVSNHSGTTMGGHYTAYC-CNPATGEWYTYNDSRVTPMSSSQVRSSDAYVLFYER 565          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: usp4 (ubiquitin specific peptidase 4 (proto-oncogene) [Source:ZFIN;Acc:ZDB-GENE-041008-187])

HSP 1 Score: 56.6102 bits (135), Expect = 9.994e-9
Identity = 45/173 (26.01%), Postives = 85/173 (49.13%), Query Frame = 2
Query:  803 DNICNESFQVMKSMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKCA-CDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTDNGA-KIDTFITCSEKRIEIKD----STNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFKK 1297
            +N  ++ F+   SM     + ++ + L+ C+E F +K ++  +DP  C  C       K    L   PK L ++L R SY      K+DT +    + +++ +    + +    Y LI+V +H G    GHY  Y ++  E S W+  +D+ V   ++D++V+K A V  +++
Sbjct:  751 NNNVDKEFEKHDSMLAQPLKKKNPVKLKECIELFTTKEELAATDPWYCPNCKKHKQATKKF-DLWALPKVLVVHLKRFSYNKYWRDKLDTLVDFPIRDLDMSEFVIGTQDVPCTYDLIAVSNHYGGMGGGHYTAYAKNKGENS-WYYFDDSSVSSSAEDQIVSKAAYVLFYQR 921          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP13 (Ubiquitin-specific protease that cleaves Ub-protein fusions; UBP13 has a paralog, UBP9, that arose from the whole genome duplication [Source:SGD;Acc:S000000163])

HSP 1 Score: 58.5362 bits (140), Expect = 1.500e-9
Identity = 70/291 (24.05%), Postives = 122/291 (41.92%), Query Frame = 2
Query:  473 SVFVKG-LFNLIQALRKSDKKNLDKSLETVQQYITESSFGDDVYK--CFMNILSRVSKVIKTN-------------------IERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTFITCSEK-RIEIKDSTNSTI--KYRLISVIDHVGN-TFYGHYYCRSNFEGSDWWLLNDAHVEKCSDDEVV 1264
            S  ++G + N+  +L  SDK  L  SL  + + ITE+++   V     F+++L R + +  T                    IER N   +    +++      E  K++N  F+ D F G LT Q+ C  CDNI +     +   P+ V Q + +  ++  ++S+  +  +  S+   C    G    +    L   P  L ++L R  Y++     I  F        + +  S NS +  KY L  ++ H+G    +GHY      E   W L +D  VE   ++ V+
Sbjct:  367 SALIRGPVLNIDHSLNGSDKATLYSSLRDIFECITENTYLTGVVSPSSFVDVLKRENVLFNTTMHQDAHEFFNFLLNELSEYIERENKKIAASDINSDS-----EPSKSKN--FISDLFQGTLTNQIKCLTCDNITSRDEPFL-DFPIEV-QGDEETDIQEILKSYHQREMLNGSNKFYCDECCGLQEAERLVGLKQLPDTLTLHLKRFKYSEKQNCNIKLFNNIHYPLTLNVCSSINSKVCQKYELAGIVVHMGGGPQHGHYVSLCKHEKFGWLLFDDETVEAVKEETVL 648          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP8 (Ubiquitin-specific protease component of the SAGA acetylation complex; required for SAGA (Spt-Ada-Gcn5-Acetyltransferase)-mediated deubiquitination of histone H2B [Source:SGD;Acc:S000004836])

HSP 1 Score: 51.6026 bits (122), Expect = 1.617e-7
Identity = 50/192 (26.04%), Postives = 81/192 (42.19%), Query Frame = 2
Query:  761 FYGQLTFQMTCDICDNICNESFQVMKSMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTDNGA--KIDTFIT----------CSEKRIEIKDSTNSTIK---YRLISVIDHVGNTFYGHYYCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLF 1291
            F G L   + C  C N  N    +   + L++   + + L E C++SF  K Q++  +     C++    +K    +   P  L + L R  +  NG+  K+D FI           CS K  + K S N  +    Y LI ++ H G    GHY       G  W+  ND+ V   S +EV+ + A +  +
Sbjct:  279 FEGSLESSIVCPGCQN--NSKTTIDPFLDLSLDIKDKKKLYE-CLDSFHKKEQLKDFNYHCGECNSTQDAIK-QLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKEKD-KHSENGKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFY 465          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP9 (Ubiquitin-specific protease that cleaves ubiquitin-protein fusions; UBP9 has a paralog, UBP13, that arose from the whole genome duplication [Source:SGD;Acc:S000000900])

HSP 1 Score: 51.9878 bits (123), Expect = 1.675e-7
Identity = 46/187 (24.60%), Postives = 84/187 (44.92%), Query Frame = 2
Query:  719 EKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTF-ITCSEKRIEIKDSTNSTI--KYRLISVIDHVGN-TFYGHYYCRSNFEGSDWWLLNDAHVEKCSDDEVV 1264
            +K  N N  F+ D F G LT ++ C  CDNI +     +   P+ V Q + +  ++  ++S+  +  +   +   C    G    +    L   P  L ++L R  Y++   + I  F        +++  + N+++  KY L  V+ H+G+   +GHY C    E   W L +D  VE   ++ V+
Sbjct:  463 QKTDNSNDNFITDLFKGTLTNRIKCLTCDNITSRDEPFL-DFPIEV-QGDEETDIQKMLKSYHQREMLNGVNKFYCNKCYGLQEAERMVGLKQLPHILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFNTSVYKKYELSGVVIHMGSGPQHGHYVCICRNEKFGWLLYDDETVESIKEETVL 647          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO44454 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7RVV5])

HSP 1 Score: 56.225 bits (134), Expect = 2.343e-8
Identity = 45/161 (27.95%), Postives = 75/161 (46.58%), Query Frame = 2
Query:  836 KSMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTDNGA-KIDTFITCSEKRIEIKD----STNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFKK 1297
            +S+     Q +S + L  C++ F ++ ++  +DP  C              L   P+ L I+L R SYT     KIDT +      +++ D           Y LI V +H G    GHY  YCR N E   W+  +D+ V + +++++V+K A V  +K+
Sbjct:  768 ESVARKPTQRKSVVQLNDCIQLFLTREKLGANDPWYCPQCKKHQQASKKFDLWCLPEVLVIHLKRFSYTSLWRDKIDTLVNFPLCGLDMSDYVIGKDGPPPLYDLIGVSNHYGGMGGGHYTAYCR-NHEDDHWYSYDDSSVSQINEEQIVSKAAYVLFYKR 927          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO34837 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7SN67])

HSP 1 Score: 49.6766 bits (117), Expect = 1.371e-6
Identity = 73/365 (20.00%), Postives = 135/365 (36.99%), Query Frame = 2
Query:  332 DKPMGFNNPKGYCYLNCVIQVLASC---------GDFTKDIENSDCQQYFVDDTEDSVFVKGLFNLIQALRKSDKKNLDKSLETVQQYITESS-----FGDDVYKCFMNIL--------SRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVAQSE------------SQILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTDNGAKIDT---FITCSEKRI---EIKDSTNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFKKE 1300
            D  +G  N    C++N ++Q L+S          G +   I N    +           V+   +LI+++ K D      S    +  I   +     F     + F++ L        ++V +  K  +   ++S S      EKAK+ ++ +  R+   + D F G L   + C  C    + +F     + L + +                + +  C+E F  +  ++  +   C              +   P+ L I+L R S     +K+ T   F   S + +       S   +  Y L +V +H G+T+ GHY  YC+   +   W   ND+ V++ S   V    A +  F+K 
Sbjct:    3 DGLVGLRNLGNTCFMNSILQCLSSTWLLTNIVLKGTYVSSINNKSSMK--------GRLVQAFADLIKSMWKHDATESAISAHAFKTQIQRFAPRFVGFNQQDAQEFLHFLLEGLHDDLNKVQEKPKYKMCEFDNSLS----DLEKAKKAWKLYIERDNSLITDLFVGVLKSTLICLEC-GFKSVTFDPFWDLSLPIPRKSGSRYSSSRYTDGGDVDIRDCMELFTKEEVLDGDERPTCEKCKKKRKSTKKFTVQRFPRILVIHLKRFSGYGFRSKLQTNVVFPVTSPQELGEFAADPSEGQSAVYSLYAVSNHSGSTYGGHYTAYCKHP-QSRQWHCFNDSRVDQISSSRVTGPQAYILFFEKH 353          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp2b (ubiquitin carboxyl-terminal hydrolase 2 [Source:NCBI gene;Acc:101165751])

HSP 1 Score: 75.485 bits (184), Expect = 2.062e-14
Identity = 78/340 (22.94%), Postives = 151/340 (44.41%), Query Frame = 2
Query:  341 MGFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDDTEDSVFVKGLFNLIQAL--------------RKSDKKNLDKSLETVQQYITESSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVAQSE-SQILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTDN-GAKIDTFITCSEKRIEIK----DSTNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFK 1294
            +G  N    C++N ++Q L++  +  +D    +  +  V++  ++  ++    L Q+L              R   ++   K +   QQ   E  F   +     N ++RV+   ++++E   D +S      EK+K+ +  +  R    V D F GQL   +TC +C    +  F     + + +AQ    ++ L+ C+  F  +  ++  +   C              +   P+ L I+L R S +++  +K+ TF+    K ++++    D++   + Y L +V +H GNT  GHY  YCR+   G +W+  ND+ V   S  +V T NA V  ++
Sbjct:   59 VGLRNLGNTCFMNSILQCLSNTSEL-RDYCLRNVHRLDVNNRTNAALMEEFAKLTQSLWTSVNIEAISPSDFRSEIQRVAPKFVGCNQQDAQE--FLRSLLDGLHNEVNRVTVRPRSSVE-DFDHYS----DEEKSKRMWNLYLAREDSKVVDLFVGQLKSSLTCTVC-GFRSTMFDPFWDLSIPIAQERPGEVTLKDCLRLFTKEDVLDGEEKPTCNKCKARRKCTKRFSIQKFPQILVIHLKRFSDSNSRSSKLSTFVNFPLKELDLREFSADNSEHPV-YNLYAVSNHTGNTLGGHYTAYCRNPALG-EWYSYNDSRVSPISSGQVRTSNAYVLFYE 387          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp2a (ubiquitin carboxyl-terminal hydrolase 2 [Source:NCBI gene;Acc:101158874])

HSP 1 Score: 68.9366 bits (167), Expect = 5.569e-12
Identity = 52/186 (27.96%), Postives = 86/186 (46.24%), Query Frame = 2
Query:  698 EKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVA-QSESQILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTDNGAKIDTFITCSEKRIEIKD--STNST-IKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHV 1237
            EK K+ + K+  R    + D F GQL   +TC  C   C+  F     + L ++ +S  ++ L  C+  F  +  ++  +   C             ++   PK L ++L R S     +K+ TF+    K +++++  S NST   Y L +V +H G T  GHY  YCR N    +W+  ND+ V
Sbjct:  385 EKGKKMWSKYVEREDSKIVDLFVGQLKSSLTCSHC-GFCSTVFDPFWDLSLPISKKSYGEVSLMDCMRLFTKEDVLDGDEKPTCYRCKARRRCTKKFRIQKFPKILVLHLKRFSEARRTSKLSTFVNFPLKDLDLREFASGNSTNAMYNLYAVSNHSGTTMGGHYTAYCR-NPNSGEWYTFNDSRV 568          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp11 (ubiquitin carboxyl-terminal hydrolase 11 [Source:NCBI gene;Acc:101166285])

HSP 1 Score: 67.781 bits (164), Expect = 1.591e-11
Identity = 44/172 (25.58%), Postives = 80/172 (46.51%), Query Frame = 2
Query:  815 NESFQVMKSMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIEIKD--------STNSTIKYRLISVIDHVGNTFYGHYYCRS-NFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFKKE 1300
            NE+ + +K   + V Q ++ + L+ C+E F +   +E  +P  C       L      L   P+ L I+L R SYT     K+D+ +    + ++  D        S     +Y LI+V +H G    GHY   + N + + W+  +D+ V   S+D+++T  A V  + ++
Sbjct:  671 NEAEKYVKHSSMEVPQQQATVQLQECIELFTTVETLEEENPWYCPVCKKHQLATKKLDLWSLPEVLIIHLKRFSYTKFTREKLDSIVDFPLRDLDFSDFLLRKSLSSEEPPSRYDLIAVSNHYGGLRDGHYTSYAKNKDNAQWYYFDDSKVTYASEDQIMTNAAYVLFYHRQ 842          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp11 (ubiquitin carboxyl-terminal hydrolase 11 [Source:NCBI gene;Acc:101166285])

HSP 1 Score: 67.3958 bits (163), Expect = 2.263e-11
Identity = 44/172 (25.58%), Postives = 80/172 (46.51%), Query Frame = 2
Query:  815 NESFQVMKSMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTD-NGAKIDTFITCSEKRIEIKD--------STNSTIKYRLISVIDHVGNTFYGHYYCRS-NFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFKKE 1300
            NE+ + +K   + V Q ++ + L+ C+E F +   +E  +P  C       L      L   P+ L I+L R SYT     K+D+ +    + ++  D        S     +Y LI+V +H G    GHY   + N + + W+  +D+ V   S+D+++T  A V  + ++
Sbjct:  796 NEAEKYVKHSSMEVPQQQATVQLQECIELFTTVETLEEENPWYCPVCKKHQLATKKLDLWSLPEVLIIHLKRFSYTKFTREKLDSIVDFPLRDLDFSDFLLRKSLSSEEPPSRYDLIAVSNHYGGLRDGHYTSYAKNKDNAQWYYFDDSKVTYASEDQIMTNAAYVLFYHRQ 967          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp4 (ubiquitin specific peptidase 4 [Source:NCBI gene;Acc:101173051])

HSP 1 Score: 56.225 bits (134), Expect = 5.532e-8
Identity = 45/172 (26.16%), Postives = 79/172 (45.93%), Query Frame = 2
Query:  818 ESFQVMKSMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTDNGA-KIDTFITCSEKRIEIK----DSTNSTIKYRLISVIDHVGNTFYGHY--YCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFKKEIDSA 1312
            E+++  +SM L   + ++ + L  C+E F +   +   DP  C              L   P+ L ++L R SY      K+DT +    + + +     D   S   Y LI+V +H G    GHY  Y ++  +G  W+  +D+ V   +DD++VTK A V  +++  + A
Sbjct:  721 EAYEKHESM-LQPQKKKTTVALRDCIELFTTMETLGEHDPWYCPTCKKHQQATKKFDLWSLPRILVVHLKRFSYNRCWRDKLDTVVDFPIRDLNMSEFVCDPKASPYIYDLIAVSNHYGGMGGGHYTAYAKNKLDGK-WYYFDDSSVSSATDDQIVTKAAYVLFYQRRDEDA 890          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000036117.1 (SMESG000036117.1)

HSP 1 Score: 740.725 bits (1911), Expect = 0.000e+0
Identity = 361/402 (89.80%), Postives = 373/402 (92.79%), Query Frame = 2
Query:  113 MGKSQKPPTSEGTTRTSDLLLYILKKQILFILEVSKSKSNLHIKHIFTRCFGKKRKNRNKITDIIQQNPVSHIDKPMGFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDDTEDSVFVKGLFNLIQALRKSDKKNLDKSLETVQQYITESSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTDNGAKIDTFITCSEKRIEIKDSTNSTIKYRLISVIDHVGNTFYGHYYCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFKKEIDSAVM 1318
            MGKSQKPPTSEGTTRT                +VSKSKSNLHIKHIFTRCFGKKRKNRNKITDIIQQNPVSHIDKPMGFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDD EDSVFVKGLFNLIQALRKSDKKNLDKSLETVQQYITESSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVA S+  I LE+CV++FFS SQ+EV++PLKCAC+NGST VKS TKLTHGPKYLFIYLNRGSYTDNG+KIDTF+TCSEK IEIKDSTNSTIKYRLISVIDHVGNTFYGHYYCRSNFEGSDWWLLNDAHVEKC DDEVVTKN IVFLFK+EI S VM
Sbjct:    1 MGKSQKPPTSEGTTRT----------------KVSKSKSNLHIKHIFTRCFGKKRKNRNKITDIIQQNPVSHIDKPMGFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDDIEDSVFVKGLFNLIQALRKSDKKNLDKSLETVQQYITESSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVANSKFPIPLENCVKAFFSDSQIEVTEPLKCACENGSTSVKSLTKLTHGPKYLFIYLNRGSYTDNGSKIDTFVTCSEKSIEIKDSTNSTIKYRLISVIDHVGNTFYGHYYCRSNFEGSDWWLLNDAHVEKCRDDEVVTKNTIVFLFKREIYSTVM 386          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000036117.1 (SMESG000036117.1)

HSP 1 Score: 731.865 bits (1888), Expect = 0.000e+0
Identity = 362/407 (88.94%), Postives = 374/407 (91.89%), Query Frame = 2
Query:   98 SENSIMGKSQKPPTSEGTTRTSDLLLYILKKQILFILEVSKSKSNLHIKHIFTRCFGKKRKNRNKITDIIQQNPVSHIDKPMGFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDDTEDSVFVKGLFNLIQALRKSDKKNLDKSLETVQQYITESSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTDNGAKIDTFITCSEKRIEIKDSTNSTIKYRLISVIDHVGNTFYGHYYCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFKKEIDSAVM 1318
            SENSIMGKSQKPPTSEGTTRT                +VSKSKSNLHIKHIFTRCFGKKRKNRNKITDIIQQNP    DKPMGFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDD EDSVFVKGLFNLIQALRKSDKKNLDKSLETVQQYITESSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVA S+  I LE+CV++FFS SQ+EV++PLKCAC+NGST VKS TKLTHGPKYLFIYLNRGSYTDNG+KIDTF+TCSEK IEIKDSTNSTIKYRLISVIDHVGNTFYGHYYCRSNFEGSDWWLLNDAHVEKC DDEVVTKN IVFLFK+EI S VM
Sbjct:  403 SENSIMGKSQKPPTSEGTTRT----------------KVSKSKSNLHIKHIFTRCFGKKRKNRNKITDIIQQNP----DKPMGFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDDIEDSVFVKGLFNLIQALRKSDKKNLDKSLETVQQYITESSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVANSKFPIPLENCVKAFFSDSQIEVTEPLKCACENGSTSVKSLTKLTHGPKYLFIYLNRGSYTDNGSKIDTFVTCSEKSIEIKDSTNSTIKYRLISVIDHVGNTFYGHYYCRSNFEGSDWWLLNDAHVEKCRDDEVVTKNTIVFLFKREIYSTVM 789          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000036117.1 (SMESG000036117.1)

HSP 1 Score: 731.095 bits (1886), Expect = 0.000e+0
Identity = 362/407 (88.94%), Postives = 374/407 (91.89%), Query Frame = 2
Query:   98 SENSIMGKSQKPPTSEGTTRTSDLLLYILKKQILFILEVSKSKSNLHIKHIFTRCFGKKRKNRNKITDIIQQNPVSHIDKPMGFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDDTEDSVFVKGLFNLIQALRKSDKKNLDKSLETVQQYITESSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTDNGAKIDTFITCSEKRIEIKDSTNSTIKYRLISVIDHVGNTFYGHYYCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFKKEIDSAVM 1318
            SENSIMGKSQKPPTSEGTTRT                +VSKSKSNLHIKHIFTRCFGKKRKNRNKITDIIQQNP    DKPMGFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDD EDSVFVKGLFNLIQALRKSDKKNLDKSLETVQQYITESSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVA S+  I LE+CV++FFS SQ+EV++PLKCAC+NGST VKS TKLTHGPKYLFIYLNRGSYTDNG+KIDTF+TCSEK IEIKDSTNSTIKYRLISVIDHVGNTFYGHYYCRSNFEGSDWWLLNDAHVEKC DDEVVTKN IVFLFK+EI S VM
Sbjct:  381 SENSIMGKSQKPPTSEGTTRT----------------KVSKSKSNLHIKHIFTRCFGKKRKNRNKITDIIQQNP----DKPMGFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDDIEDSVFVKGLFNLIQALRKSDKKNLDKSLETVQQYITESSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVANSKFPIPLENCVKAFFSDSQIEVTEPLKCACENGSTSVKSLTKLTHGPKYLFIYLNRGSYTDNGSKIDTFVTCSEKSIEIKDSTNSTIKYRLISVIDHVGNTFYGHYYCRSNFEGSDWWLLNDAHVEKCRDDEVVTKNTIVFLFKREIYSTVM 767          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000036117.1 (SMESG000036117.1)

HSP 1 Score: 726.857 bits (1875), Expect = 0.000e+0
Identity = 357/402 (88.81%), Postives = 369/402 (91.79%), Query Frame = 2
Query:  113 MGKSQKPPTSEGTTRTSDLLLYILKKQILFILEVSKSKSNLHIKHIFTRCFGKKRKNRNKITDIIQQNPVSHIDKPMGFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDDTEDSVFVKGLFNLIQALRKSDKKNLDKSLETVQQYITESSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLTHGPKYLFIYLNRGSYTDNGAKIDTFITCSEKRIEIKDSTNSTIKYRLISVIDHVGNTFYGHYYCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFKKEIDSAVM 1318
            MGKSQKPPTSEGTTRT                +VSKSKSNLHIKHIFTRCFGKKRKNRNKITDIIQQNP    DKPMGFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDD EDSVFVKGLFNLIQALRKSDKKNLDKSLETVQQYITESSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVA S+  I LE+CV++FFS SQ+EV++PLKCAC+NGST VKS TKLTHGPKYLFIYLNRGSYTDNG+KIDTF+TCSEK IEIKDSTNSTIKYRLISVIDHVGNTFYGHYYCRSNFEGSDWWLLNDAHVEKC DDEVVTKN IVFLFK+EI S VM
Sbjct:    1 MGKSQKPPTSEGTTRT----------------KVSKSKSNLHIKHIFTRCFGKKRKNRNKITDIIQQNP----DKPMGFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDDIEDSVFVKGLFNLIQALRKSDKKNLDKSLETVQQYITESSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVANSKFPIPLENCVKAFFSDSQIEVTEPLKCACENGSTSVKSLTKLTHGPKYLFIYLNRGSYTDNGSKIDTFVTCSEKSIEIKDSTNSTIKYRLISVIDHVGNTFYGHYYCRSNFEGSDWWLLNDAHVEKCRDDEVVTKNTIVFLFKREIYSTVM 382          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000036117.1 (SMESG000036117.1)

HSP 1 Score: 533.487 bits (1373), Expect = 0.000e+0
Identity = 266/304 (87.50%), Postives = 276/304 (90.79%), Query Frame = 2
Query:  113 MGKSQKPPTSEGTTRTSDLLLYILKKQILFILEVSKSKSNLHIKHIFTRCFGKKRKNRNKITDIIQQNPVSHIDKPMGFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDDTEDSVFVKGLFNLIQALRKSDKKNLDKSLETVQQYITESSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVAQSESQILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLTHGPKYLFIYL 1024
            MGKSQKPPTSEGTTRT                +VSKSKSNLHIKHIFTRCFGKKRKNRNKITDIIQQNP    DKPMGFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDD EDSVFVKGLFNLIQALRKSDKKNLDKSLETVQQYITESSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVA S+  I LE+CV++FFS SQ+EV++PLKCAC+NGST VKS TKLTHGPKYLFI+L
Sbjct:    1 MGKSQKPPTSEGTTRT----------------KVSKSKSNLHIKHIFTRCFGKKRKNRNKITDIIQQNP----DKPMGFNNPKGYCYLNCVIQVLASCGDFTKDIENSDCQQYFVDDIEDSVFVKGLFNLIQALRKSDKKNLDKSLETVQQYITESSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQNFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVANSKFPIPLENCVKAFFSDSQIEVTEPLKCACENGSTSVKSLTKLTHGPKYLFIWL 284          
The following BLAST results are available for this feature:
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
USP24.707e-1524.60ubiquitin specific peptidase 2 [Source:HGNC Symbol... [more]
USP24.403e-1425.00ubiquitin specific peptidase 2 [Source:HGNC Symbol... [more]
USP28.489e-1425.00ubiquitin specific peptidase 2 [Source:HGNC Symbol... [more]
USP216.398e-1021.37ubiquitin specific peptidase 21 [Source:HGNC Symbo... [more]
USP216.398e-1021.37ubiquitin specific peptidase 21 [Source:HGNC Symbo... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
usp-31.255e-1123.60Ubiquitinyl hydrolase 1 [Source:UniProtKB/TrEMBL;... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Usp27.228e-1123.81gene:FBgn0031187 transcript:FBtr0339506[more]
Usp21.877e-1023.74gene:FBgn0031187 transcript:FBtr0339507[more]
Usp21.969e-1023.74gene:FBgn0031187 transcript:FBtr0309238[more]
Usp21.969e-1023.74gene:FBgn0031187 transcript:FBtr0077349[more]
Usp21.969e-1023.74gene:FBgn0031187 transcript:FBtr0309239[more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp2a3.663e-1424.85ubiquitin specific peptidase 2a [Source:ZFIN;Acc:Z... [more]
usp2b3.746e-1428.50ubiquitin specific peptidase 2b [Source:ZFIN;Acc:Z... [more]
usp114.501e-1227.17ubiquitin specific peptidase 11 [Source:ZFIN;Acc:Z... [more]
usp113.551e-1127.17ubiquitin specific peptidase 11 [Source:ZFIN;Acc:Z... [more]
usp182.547e-827.69ubiquitin specific peptidase 18 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
med46.208e-1624.65mediator complex subunit 4 [Source:Xenbase;Acc:XB-... [more]
med41.785e-1524.65mediator complex subunit 4 [Source:Xenbase;Acc:XB-... [more]
med42.824e-1524.64mediator complex subunit 4 [Source:Xenbase;Acc:XB-... [more]
med41.247e-724.12mediator complex subunit 4 [Source:Xenbase;Acc:XB-... [more]
usp331.494e-628.57ubiquitin specific peptidase 33 [Source:NCBI gene;... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Usp21.293e-1324.13ubiquitin specific peptidase 2 [Source:MGI Symbol;... [more]
Usp21.325e-1324.13ubiquitin specific peptidase 2 [Source:MGI Symbol;... [more]
Usp22.724e-1324.13ubiquitin specific peptidase 2 [Source:MGI Symbol;... [more]
Usp22.724e-1324.13ubiquitin specific peptidase 2 [Source:MGI Symbol;... [more]
Usp22.724e-1324.13ubiquitin specific peptidase 2 [Source:MGI Symbol;... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O57429|UBP2_CHICK7.061e-1425.21Ubiquitin carboxyl-terminal hydrolase 2 OS=Gallus ... [more]
sp|O75604|UBP2_HUMAN4.077e-1325.00Ubiquitin carboxyl-terminal hydrolase 2 OS=Homo sa... [more]
sp|Q5U349|UBP2_RAT1.624e-1224.42Ubiquitin carboxyl-terminal hydrolase 2 OS=Rattus ... [more]
sp|O88623|UBP2_MOUSE1.793e-1224.13Ubiquitin carboxyl-terminal hydrolase 2 OS=Mus mus... [more]
sp|Q2KHV7|UBP2_BOVIN2.015e-1024.05Ubiquitin carboxyl-terminal hydrolase 2 OS=Bos tau... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0EB125.455e-1625.69Uncharacterized protein OS=Paramecium tetraurelia ... [more]
A0A507D7841.467e-1525.00Ubiquitin carboxyl-terminal hydrolase OS=Synchytri... [more]
A0CEF34.433e-1425.51Uncharacterized protein OS=Paramecium tetraurelia ... [more]
A0A452HB346.175e-1426.54Ubiquitin carboxyl-terminal hydrolase OS=Gopherus ... [more]
A0CPE09.104e-1423.46Uncharacterized protein OS=Paramecium tetraurelia ... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp2b8.298e-1728.23ubiquitin carboxyl-terminal hydrolase 2-like [Sour... [more]
usp2b4.392e-1628.57ubiquitin carboxyl-terminal hydrolase 2-like [Sour... [more]
usp2b9.995e-1628.30ubiquitin carboxyl-terminal hydrolase 2-like [Sour... [more]
usp2a7.492e-1524.78ubiquitin carboxyl-terminal hydrolase 2-like [Sour... [more]
usp2a3.197e-1324.71ubiquitin carboxyl-terminal hydrolase 2-like [Sour... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
usp49.994e-926.01ubiquitin specific peptidase 4 (proto-oncogene) [S... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
UBP131.500e-924.05Ubiquitin-specific protease that cleaves Ub-protei... [more]
UBP81.617e-726.04Ubiquitin-specific protease component of the SAGA ... [more]
UBP91.675e-724.60Ubiquitin-specific protease that cleaves ubiquitin... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO444542.343e-827.95Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
EDO348371.371e-620.00Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp2b2.062e-1422.94ubiquitin carboxyl-terminal hydrolase 2 [Source:NC... [more]
usp2a5.569e-1227.96ubiquitin carboxyl-terminal hydrolase 2 [Source:NC... [more]
usp111.591e-1125.58ubiquitin carboxyl-terminal hydrolase 11 [Source:N... [more]
usp112.263e-1125.58ubiquitin carboxyl-terminal hydrolase 11 [Source:N... [more]
usp45.532e-826.16ubiquitin specific peptidase 4 [Source:NCBI gene;A... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036117.10.000e+089.80SMESG000036117.1[more]
SMESG000036117.10.000e+088.94SMESG000036117.1[more]
SMESG000036117.10.000e+088.94SMESG000036117.1[more]
SMESG000036117.10.000e+088.81SMESG000036117.1[more]
SMESG000036117.10.000e+087.50SMESG000036117.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020218 ID=SMED30020218|Name=Ubiquitin carboxyl-terminal hydrolase|organism=Schmidtea mediterranea sexual|type=transcript|length=1460bp
CTTGAATTATTTAAATACTTTTATCCTGTAAATTCGATGTTTTGAAATAA
CCATGATTATATAGATACTTCTATTTATCTTATAATTAATTACTAGATCA
GAAAATTCTATTATGGGAAAATCTCAAAAACCACCGACATCTGAAGGTAC
TACCCGTACAAGTGACTTATTATTATACATATTAAAAAAACAAATTTTAT
TTATTTTAGAAGTAAGCAAATCAAAGTCAAATTTACATATTAAACATATT
TTTACACGTTGTTTCGGTAAGAAACGTAAAAACCGAAATAAAATCACTGA
TATTATTCAACAAAATCCAGTTTCTCACATAGACAAACCGATGGGCTTTA
ATAATCCTAAAGGCTACTGCTACCTAAATTGTGTAATTCAAGTACTTGCA
TCCTGTGGCGATTTTACAAAAGACATTGAAAATAGTGACTGCCAGCAATA
TTTTGTTGATGATACTGAGGATTCGGTTTTTGTGAAAGGTTTATTCAATT
TGATTCAAGCTTTACGAAAATCAGACAAAAAAAATCTTGATAAATCTTTG
GAAACAGTTCAGCAGTATATTACTGAGTCGTCTTTCGGAGATGACGTATA
CAAGTGCTTCATGAATATATTGAGTCGGGTAAGTAAAGTGATCAAGACGA
ACATTGAAAGGTCAAATGATTCCTTCAGCCTTCCGGCAACTTCTACTGAA
AAGGCTAAGCAAAATTTCGAAAAATTTAAAAATAGAAATCCTGGATTCGT
TTTCGATAATTTTTATGGCCAGTTGACATTCCAAATGACTTGTGATATTT
GTGACAATATTTGCAATGAGTCCTTTCAAGTGATGAAATCCATGCCCCTG
GCAGTAGCGCAATCAGAATCTCAAATACTTTTGGAAAGCTGTGTTGAATC
ATTTTTTAGCAAATCCCAAGTAGAAGTGTCGGATCCTTTGAAATGTGCAT
GTGACAACGGATCGACATTGGTGAAATCCCACACAAAATTAACTCATGGA
CCAAAATATTTATTCATATATCTCAACCGCGGATCATATACTGATAATGG
TGCAAAAATTGACACATTTATCACATGTTCTGAGAAGAGAATTGAAATAA
AAGATTCAACAAATAGTACAATCAAATACAGATTGATATCCGTAATTGAT
CACGTTGGCAATACGTTCTATGGCCATTATTATTGTAGGAGTAATTTTGA
AGGATCTGATTGGTGGTTATTAAATGATGCGCACGTGGAGAAATGTAGTG
ATGATGAAGTTGTGACTAAAAATGCGATCGTTTTCCTTTTCAAAAAAGAA
ATTGATTCAGCTGTGATGTAATCTTAAATAAAGTTAATTAATTTAATAAA
TTTTATCACATTTGCATATGTATTCTGGTTAAATCAATTTATATTTCTGT
GACTTTTATTATTCGCCTTTTTTTAATTCTGAAATCACTTGGAGATTCTT
TTAATTGATA
back to top

protein sequence of SMED30020218-orf-1

>SMED30020218-orf-1 ID=SMED30020218-orf-1|Name=SMED30020218-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=403bp
MGKSQKPPTSEGTTRTSDLLLYILKKQILFILEVSKSKSNLHIKHIFTRC
FGKKRKNRNKITDIIQQNPVSHIDKPMGFNNPKGYCYLNCVIQVLASCGD
FTKDIENSDCQQYFVDDTEDSVFVKGLFNLIQALRKSDKKNLDKSLETVQ
QYITESSFGDDVYKCFMNILSRVSKVIKTNIERSNDSFSLPATSTEKAKQ
NFEKFKNRNPGFVFDNFYGQLTFQMTCDICDNICNESFQVMKSMPLAVAQ
SESQILLESCVESFFSKSQVEVSDPLKCACDNGSTLVKSHTKLTHGPKYL
FIYLNRGSYTDNGAKIDTFITCSEKRIEIKDSTNSTIKYRLISVIDHVGN
TFYGHYYCRSNFEGSDWWLLNDAHVEKCSDDEVVTKNAIVFLFKKEIDSA
VM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0016579protein deubiquitination
GO:0006511ubiquitin-dependent protein catabolic process
Vocabulary: molecular function
TermDefinition
GO:0008233peptidase activity
GO:0008234cysteine-type peptidase activity
GO:0016787hydrolase activity
GO:0036459thiol-dependent ubiquitinyl hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR038765Papain-like_cys_pep_sf
IPR001394Peptidase_C19_UCH
IPR018200USP_CS
IPR028889USP_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.90.70.10coord: 71..400
e-value: 5.6E-39
score: 136.2
NoneNo IPR availablePANTHERPTHR21646FAMILY NOT NAMEDcoord: 53..393
NoneNo IPR availablePANTHERPTHR21646:SF23UBIQUITIN CARBOXYL-TERMINAL HYDROLASE USP2coord: 53..393
NoneNo IPR availableCDDcd02257Peptidase_C19coord: 78..384
e-value: 4.30176E-25
score: 101.021
IPR001394Peptidase C19, ubiquitin carboxyl-terminal hydrolasePFAMPF00443UCHcoord: 78..390
e-value: 6.2E-27
score: 94.7
IPR018200Ubiquitin specific protease, conserved sitePROSITEPS00973USP_2coord: 339..356
IPR028889Ubiquitin specific protease domainPROSITEPS50235USP_3coord: 77..396
score: 27.715
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 75..393