tensin isoform X3

Overview
Nametensin isoform X3
Smed IDSMED30020213
Length (bp)3767
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of tensin isoform X3 (SMED30020213) t-SNE clustered cells

Violin plots show distribution of expression levels for tensin isoform X3 (SMED30020213) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of tensin isoform X3 (SMED30020213) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for tensin isoform X3 (SMED30020213) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020213

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30020213h1SMcG0006509 dd_Smed_v4_5620_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30020213h1SMcG0006509 dd_Smed_v4_5620_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30020213h1SMcG0006509 dd_Smed_v4_5620_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020213h1SMcG0006509 dd_Smed_v4_5620_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020213h1SMcG0006509 dd_Smed_v4_5620_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30020213h1SMcG0006509 dd_Smed_v4_5620_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020213h1SMcG0006509 dd_Smed_v4_5620_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020213h1SMcG0006509 dd_Smed_v4_5620_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020213h1SMcG0006509 Contig37712newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020213h1SMcG0006509 Contig37712uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30020213h1SMcG0006509 dd_Smed_v4_5620_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of tensin isoform X3 vs. Ensembl Human
Match: TNS1 (tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973])

HSP 1 Score: 153.295 bits (386), Expect = 3.975e-37
Identity = 103/333 (30.93%), Postives = 156/333 (46.85%), Query Frame = 3
Query: 2340 TEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTN---DSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINK-LFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKENYL 3326
            + + R  ++FV +T   WY+P ++RE  I  L+D+E G+FIIR+S +F GAYGLA+KV+S P   ++ N   D   +L+RHFLIET       GV+LKG PNEP + SL+ LV  H     +LP KL++ ++     D  D           ES+      +S A +L                        Q      L++   D++ L G  AI +A ++ L     P  T V  ++ S  GIT TD  + LF+ R +P   V   D D Q R++               +   + + +    +NA HL  ELD +   S I+ F+ +  L
Sbjct:  557 SPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFLIETGPR----GVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIPNR-----DPTD-----------ESKDSSGPANSTADLLK-----------------------QGAACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW-----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVML 840          
BLAST of tensin isoform X3 vs. Ensembl Human
Match: TNS1 (tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973])

HSP 1 Score: 152.91 bits (385), Expect = 1.191e-36
Identity = 103/333 (30.93%), Postives = 156/333 (46.85%), Query Frame = 3
Query: 2340 TEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTN---DSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINK-LFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKENYL 3326
            + + R  ++FV +T   WY+P ++RE  I  L+D+E G+FIIR+S +F GAYGLA+KV+S P   ++ N   D   +L+RHFLIET       GV+LKG PNEP + SL+ LV  H     +LP KL++ ++     D  D           ES+      +S A +L                        Q      L++   D++ L G  AI +A ++ L     P  T V  ++ S  GIT TD  + LF+ R +P   V   D D Q R++               +   + + +    +NA HL  ELD +   S I+ F+ +  L
Sbjct: 1076 SPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFLIETGPR----GVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIPNR-----DPTD-----------ESKDSSGPANSTADLLK-----------------------QGAACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW-----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVML 1359          
BLAST of tensin isoform X3 vs. Ensembl Human
Match: TNS1 (tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973])

HSP 1 Score: 151.754 bits (382), Expect = 3.187e-36
Identity = 103/332 (31.02%), Postives = 156/332 (46.99%), Query Frame = 3
Query: 2340 TEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTN--DSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINK-LFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKENYL 3326
            + + R  ++FV +T   WY+P ++RE  I  L+D+E G+FIIR+S +F GAYGLA+KV+S P   ++ N  D   +L+RHFLIET       GV+LKG PNEP + SL+ LV  H     +LP KL++ ++     D  D           ES+      +S A +L                        Q      L++   D++ L G  AI +A ++ L     P  T V  ++ S  GIT TD  + LF+ R +P   V   D D Q R++               +   + + +    +NA HL  ELD +   S I+ F+ +  L
Sbjct: 1433 SPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKDMTHELVRHFLIETGPR----GVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIPNR-----DPTD-----------ESKDSSGPANSTADLLK-----------------------QGAACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW-----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVML 1715          
BLAST of tensin isoform X3 vs. Ensembl Human
Match: TNS1 (tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973])

HSP 1 Score: 151.754 bits (382), Expect = 3.187e-36
Identity = 103/332 (31.02%), Postives = 156/332 (46.99%), Query Frame = 3
Query: 2340 TEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTN--DSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINK-LFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKENYL 3326
            + + R  ++FV +T   WY+P ++RE  I  L+D+E G+FIIR+S +F GAYGLA+KV+S P   ++ N  D   +L+RHFLIET       GV+LKG PNEP + SL+ LV  H     +LP KL++ ++     D  D           ES+      +S A +L                        Q      L++   D++ L G  AI +A ++ L     P  T V  ++ S  GIT TD  + LF+ R +P   V   D D Q R++               +   + + +    +NA HL  ELD +   S I+ F+ +  L
Sbjct: 1433 SPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKDMTHELVRHFLIETGPR----GVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIPNR-----DPTD-----------ESKDSSGPANSTADLLK-----------------------QGAACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW-----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVML 1715          
BLAST of tensin isoform X3 vs. Ensembl Human
Match: TNS1 (tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973])

HSP 1 Score: 151.754 bits (382), Expect = 3.768e-36
Identity = 103/333 (30.93%), Postives = 156/333 (46.85%), Query Frame = 3
Query: 2340 TEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTN---DSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINK-LFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKENYL 3326
            + + R  ++FV +T   WY+P ++RE  I  L+D+E G+FIIR+S +F GAYGLA+KV+S P   ++ N   D   +L+RHFLIET       GV+LKG PNEP + SL+ LV  H     +LP KL++ ++     D  D           ES+      +S A +L                        Q      L++   D++ L G  AI +A ++ L     P  T V  ++ S  GIT TD  + LF+ R +P   V   D D Q R++               +   + + +    +NA HL  ELD +   S I+ F+ +  L
Sbjct: 1425 SPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFLIETGPR----GVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIPNR-----DPTD-----------ESKDSSGPANSTADLLK-----------------------QGAACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW-----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVML 1708          
BLAST of tensin isoform X3 vs. Ensembl Celegans
Match: tns-1 (TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L045])

HSP 1 Score: 130.183 bits (326), Expect = 1.142e-32
Identity = 97/327 (29.66%), Postives = 150/327 (45.87%), Query Frame = 3
Query: 2349 NRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKK---NPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREF-SSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKE 3317
            + +PL FV +T   WY+P ++RE  IN LRDK  G+F++R+S++F GA+GLALKV S P   +   D   +L+RHFLI    E S  GV+LKG  NEP + SL+ LV  H   A +LPTKL++                    +   +  +H S +   Q L                      L Q      +Y+G  DV+ L G   + ++I     +    + +  +V  ++ S+ G+T TD  + +F+ R F  Q V+ A  D   R F ++  L  +     +              ENA H+  EL+     S ++ FI +
Sbjct:   33 HHHPL-FVKDTSKYWYKPTISREQAINMLRDKPPGTFVVRDSNSFPGAFGLALKV-STPPPGVNPGDGS-ELVRHFLI----EPSPKGVKLKGCNNEPVFGSLSALVYQHSITALALPTKLVLPD------------------FDPAATPEHLSAT---QAL----------------------LEQGAACNVVYVGSVDVESLTGNECVKRSIATCSQRAINGDSRAVSVHFKV-SSQGVTLTDNTRKVFFRRHFNVQSVIFAGMDPIERRFENTRALGFHDGCIAQARLFAFVARIPSSSENACHVFAELEPEQPGSAVVNFINK 308          
BLAST of tensin isoform X3 vs. Ensembl Celegans
Match: tns-1 (TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L045])

HSP 1 Score: 129.798 bits (325), Expect = 1.093e-31
Identity = 97/327 (29.66%), Postives = 150/327 (45.87%), Query Frame = 3
Query: 2349 NRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKK---NPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREF-SSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKE 3317
            + +PL FV +T   WY+P ++RE  IN LRDK  G+F++R+S++F GA+GLALKV S P   +   D   +L+RHFLI    E S  GV+LKG  NEP + SL+ LV  H   A +LPTKL++                    +   +  +H S +   Q L                      L Q      +Y+G  DV+ L G   + ++I     +    + +  +V  ++ S+ G+T TD  + +F+ R F  Q V+ A  D   R F ++  L  +     +              ENA H+  EL+     S ++ FI +
Sbjct:  133 HHHPL-FVKDTSKYWYKPTISREQAINMLRDKPPGTFVVRDSNSFPGAFGLALKV-STPPPGVNPGDGS-ELVRHFLI----EPSPKGVKLKGCNNEPVFGSLSALVYQHSITALALPTKLVLPD------------------FDPAATPEHLSAT---QAL----------------------LEQGAACNVVYVGSVDVESLTGNECVKRSIATCSQRAINGDSRAVSVHFKV-SSQGVTLTDNTRKVFFRRHFNVQSVIFAGMDPIERRFENTRALGFHDGCIAQARLFAFVARIPSSSENACHVFAELEPEQPGSAVVNFINK 408          
BLAST of tensin isoform X3 vs. Ensembl Celegans
Match: tns-1 (TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L045])

HSP 1 Score: 129.798 bits (325), Expect = 1.093e-31
Identity = 97/327 (29.66%), Postives = 150/327 (45.87%), Query Frame = 3
Query: 2349 NRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKK---NPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREF-SSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKE 3317
            + +PL FV +T   WY+P ++RE  IN LRDK  G+F++R+S++F GA+GLALKV S P   +   D   +L+RHFLI    E S  GV+LKG  NEP + SL+ LV  H   A +LPTKL++                    +   +  +H S +   Q L                      L Q      +Y+G  DV+ L G   + ++I     +    + +  +V  ++ S+ G+T TD  + +F+ R F  Q V+ A  D   R F ++  L  +     +              ENA H+  EL+     S ++ FI +
Sbjct:  133 HHHPL-FVKDTSKYWYKPTISREQAINMLRDKPPGTFVVRDSNSFPGAFGLALKV-STPPPGVNPGDGS-ELVRHFLI----EPSPKGVKLKGCNNEPVFGSLSALVYQHSITALALPTKLVLPD------------------FDPAATPEHLSAT---QAL----------------------LEQGAACNVVYVGSVDVESLTGNECVKRSIATCSQRAINGDSRAVSVHFKV-SSQGVTLTDNTRKVFFRRHFNVQSVIFAGMDPIERRFENTRALGFHDGCIAQARLFAFVARIPSSSENACHVFAELEPEQPGSAVVNFINK 408          
BLAST of tensin isoform X3 vs. Ensembl Celegans
Match: tns-1 (TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L045])

HSP 1 Score: 131.724 bits (330), Expect = 1.920e-31
Identity = 97/325 (29.85%), Postives = 149/325 (45.85%), Query Frame = 3
Query: 2355 YPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKK---NPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREF-SSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKE 3317
            +PL FV +T   WY+P ++RE  IN LRDK  G+F++R+S++F GA+GLALKV S P   +   D   +L+RHFLIE     S  GV+LKG  NEP + SL+ LV  H   A +LPTKL++                    +   +  +H S +   Q L                      L Q      +Y+G  DV+ L G   + ++I     +    + +  +V  ++ S+ G+T TD  + +F+ R F  Q V+ A  D   R F ++  L  +     +              ENA H+  EL+     S ++ FI +
Sbjct:  288 HPL-FVKDTSKYWYKPTISREQAINMLRDKPPGTFVVRDSNSFPGAFGLALKV-STPPPGVNPGDGS-ELVRHFLIEP----SPKGVKLKGCNNEPVFGSLSALVYQHSITALALPTKLVLPD------------------FDPAATPEHLSAT---QAL----------------------LEQGAACNVVYVGSVDVESLTGNECVKRSIATCSQRAINGDSRAVSVHFKV-SSQGVTLTDNTRKVFFRRHFNVQSVIFAGMDPIERRFENTRALGFHDGCIAQARLFAFVARIPSSSENACHVFAELEPEQPGSAVVNFINK 561          
BLAST of tensin isoform X3 vs. Ensembl Celegans
Match: tns-1 (TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L045])

HSP 1 Score: 131.339 bits (329), Expect = 1.284e-30
Identity = 97/325 (29.85%), Postives = 149/325 (45.85%), Query Frame = 3
Query: 2355 YPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKK---NPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREF-SSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKE 3317
            +PL FV +T   WY+P ++RE  IN LRDK  G+F++R+S++F GA+GLALKV S P   +   D   +L+RHFLI    E S  GV+LKG  NEP + SL+ LV  H   A +LPTKL++                    +   +  +H S +   Q L                      L Q      +Y+G  DV+ L G   + ++I     +    + +  +V  ++ S+ G+T TD  + +F+ R F  Q V+ A  D   R F ++  L  +     +              ENA H+  EL+     S ++ FI +
Sbjct:  667 HPL-FVKDTSKYWYKPTISREQAINMLRDKPPGTFVVRDSNSFPGAFGLALKV-STPPPGVNPGDG-SELVRHFLI----EPSPKGVKLKGCNNEPVFGSLSALVYQHSITALALPTKLVLPD------------------FDPAATPEHLSAT---QAL----------------------LEQGAACNVVYVGSVDVESLTGNECVKRSIATCSQRAINGDSRAVSVHFKV-SSQGVTLTDNTRKVFFRRHFNVQSVIFAGMDPIERRFENTRALGFHDGCIAQARLFAFVARIPSSSENACHVFAELEPEQPGSAVVNFINK 940          
BLAST of tensin isoform X3 vs. Ensembl Fly
Match: by (gene:FBgn0000244 transcript:FBtr0302382)

HSP 1 Score: 108.227 bits (269), Expect = 1.448e-23
Identity = 82/317 (25.87%), Postives = 141/317 (44.48%), Query Frame = 3
Query: 2361 LQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKN-PKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITF 3308
            +QF  ++   WY+P+L RED I  L   + G+F++R+S+T+  +YGL ++V+  P  +        +L+RHFLIE  +     GV LKG  +EP + SL+ LV +H  +  +LP  L +  +  +    V     AQ H                                         L     T  L+L   D + L G  AI +AI +++G++  P+ T V  ++ S+ GIT TD  +  F+ + + A  +     D + R ++S      G +  + I   + +      +N  H+ C+L  S   + I++F
Sbjct:  448 VQFARSSSQFWYKPNLTREDAIALLASAQPGTFLVRDSTTYKDSYGLVVRVSQPPPGS-------QELVRHFLIEPTK----GGVHLKGCDDEPVFTSLSALVFEHSISQLALPCLLRLPDRDIV--PPVRATTPAQQHL----------------------------------------LAHGAATNVLWLYSCDTESLTGNEAIRKAIRQMYGQQPLPQPTEVHFKV-SSQGITLTDNTRKKFFRKHYKADVISHCAIDPENRMWTS-----EGESDKKTIFAFVARRSHSSTDNQCHVFCDLSVSQPAAAIVSF 705          
BLAST of tensin isoform X3 vs. Ensembl Fly
Match: by (gene:FBgn0000244 transcript:FBtr0082119)

HSP 1 Score: 108.227 bits (269), Expect = 1.448e-23
Identity = 82/317 (25.87%), Postives = 141/317 (44.48%), Query Frame = 3
Query: 2361 LQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKN-PKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITF 3308
            +QF  ++   WY+P+L RED I  L   + G+F++R+S+T+  +YGL ++V+  P  +        +L+RHFLIE  +     GV LKG  +EP + SL+ LV +H  +  +LP  L +  +  +    V     AQ H                                         L     T  L+L   D + L G  AI +AI +++G++  P+ T V  ++ S+ GIT TD  +  F+ + + A  +     D + R ++S      G +  + I   + +      +N  H+ C+L  S   + I++F
Sbjct:  448 VQFARSSSQFWYKPNLTREDAIALLASAQPGTFLVRDSTTYKDSYGLVVRVSQPPPGS-------QELVRHFLIEPTK----GGVHLKGCDDEPVFTSLSALVFEHSISQLALPCLLRLPDRDIV--PPVRATTPAQQHL----------------------------------------LAHGAATNVLWLYSCDTESLTGNEAIRKAIRQMYGQQPLPQPTEVHFKV-SSQGITLTDNTRKKFFRKHYKADVISHCAIDPENRMWTS-----EGESDKKTIFAFVARRSHSSTDNQCHVFCDLSVSQPAAAIVSF 705          
BLAST of tensin isoform X3 vs. Ensembl Fly
Match: by (gene:FBgn0000244 transcript:FBtr0301093)

HSP 1 Score: 108.227 bits (269), Expect = 1.448e-23
Identity = 82/317 (25.87%), Postives = 141/317 (44.48%), Query Frame = 3
Query: 2361 LQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKN-PKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITF 3308
            +QF  ++   WY+P+L RED I  L   + G+F++R+S+T+  +YGL ++V+  P  +        +L+RHFLIE  +     GV LKG  +EP + SL+ LV +H  +  +LP  L +  +  +    V     AQ H                                         L     T  L+L   D + L G  AI +AI +++G++  P+ T V  ++ S+ GIT TD  +  F+ + + A  +     D + R ++S      G +  + I   + +      +N  H+ C+L  S   + I++F
Sbjct:  448 VQFARSSSQFWYKPNLTREDAIALLASAQPGTFLVRDSTTYKDSYGLVVRVSQPPPGS-------QELVRHFLIEPTK----GGVHLKGCDDEPVFTSLSALVFEHSISQLALPCLLRLPDRDIV--PPVRATTPAQQHL----------------------------------------LAHGAATNVLWLYSCDTESLTGNEAIRKAIRQMYGQQPLPQPTEVHFKV-SSQGITLTDNTRKKFFRKHYKADVISHCAIDPENRMWTS-----EGESDKKTIFAFVARRSHSSTDNQCHVFCDLSVSQPAAAIVSF 705          
BLAST of tensin isoform X3 vs. Ensembl Zebrafish
Match: tns1b (tensin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-6933])

HSP 1 Score: 155.992 bits (393), Expect = 1.452e-38
Identity = 104/331 (31.42%), Postives = 158/331 (47.73%), Query Frame = 3
Query: 2337 GTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLP---ENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLF-GKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKE 3317
            G+ + R  ++FV +T   WY+P ++R+  IN L+D++ G+F+IR+S +F GAYGLA+KVAS P   +   +  D   +L+RHFLIET    S  GVRLKG PNEP +  L+ LV  H     +LP KL++ ++  +                 ES +     +  A ML       SS      D       H C V   LY+   D++ L G  AI +AI++       P  T V  ++ S  GIT TD  + LF+ R +P   V   D D Q R+++ P                + + +    +N  HL  E+D     + I+ F+ +
Sbjct:  425 GSPETRMNVKFVQDTSKFWYKPDISRDQAINMLKDQDPGAFVIRDSHSFRGAYGLAMKVASPPPTTQPTKKAGDVTNELVRHFLIET----SPKGVRLKGCPNEPYFGCLSALVYQHSITPLALPCKLVIPTRDPLE----------------ESPEIATPTNPAADMLKQGAGQKSS-----ADG------HACNV---LYINSVDMESLTGPQAIAKAISETMNASPAPSATIVHFKV-SAQGITLTDNQRKLFFRRHYPIGTVTFCDIDPQERKWNKP------EGGTAKFFGFVARKQGSTTDNVSHLFAEMDPDQPATAIVNFVSK 714          
BLAST of tensin isoform X3 vs. Ensembl Zebrafish
Match: tns1a (tensin 1a [Source:ZFIN;Acc:ZDB-GENE-120215-32])

HSP 1 Score: 157.918 bits (398), Expect = 2.708e-38
Identity = 104/337 (30.86%), Postives = 160/337 (47.48%), Query Frame = 3
Query: 2331 FSGTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGD----LIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINK-LFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKENYL 3326
            + G  D R  ++FV +T   WY+P + RE  I  L+D+E G+F+IR+S++F GAYGLA+KVAS P   ++ N   GD    L+RHFLIET    S  GVRLKG PNEP +  L+ LV  H     +LP KL++ ++                    E+ +     SS   +L                +  P P         LY+   D++ L G  A+ +AI + L  K  P  T V+ ++ ST GIT TD  + +F+ R +P   +   + D Q R+++              +   + + +    +N  HL  EL+  N  S I++F+ +  L
Sbjct: 1352 YDGPPDIRINIKFVQDTSKYWYKPEITREQAICILKDREPGAFVIRDSNSFRGAYGLAMKVAS-PPPTVQQNKKVGDITNELVRHFLIET----SAKGVRLKGCPNEPYFGCLSALVYQHAITPLALPCKLMIPTRDP----------------NEEALELATPTSSTMDLLKQG-------------AGPPKPTEDFYACNVLYINSVDMESLTGPQAVAKAITETLAAKSTPTATIVQFKV-STQGITLTDNQRKVFFRRHYPINLITYCNMDPQERKWNK------AEGGVAKLFGFVARKQGSTTDNVSHLFAELEPDNSASAIVSFVSKLML 1647          
BLAST of tensin isoform X3 vs. Ensembl Zebrafish
Match: tns1a (tensin 1a [Source:ZFIN;Acc:ZDB-GENE-120215-32])

HSP 1 Score: 157.532 bits (397), Expect = 3.165e-38
Identity = 104/337 (30.86%), Postives = 160/337 (47.48%), Query Frame = 3
Query: 2331 FSGTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGD----LIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINK-LFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKENYL 3326
            + G  D R  ++FV +T   WY+P + RE  I  L+D+E G+F+IR+S++F GAYGLA+KVAS P   ++ N   GD    L+RHFLIET    S  GVRLKG PNEP +  L+ LV  H     +LP KL++ ++                    E+ +     SS   +L                +  P P         LY+   D++ L G  A+ +AI + L  K  P  T V+ ++ ST GIT TD  + +F+ R +P   +   + D Q R+++              +   + + +    +N  HL  EL+  N  S I++F+ +  L
Sbjct: 1378 YDGPPDIRINIKFVQDTSKYWYKPEITREQAICILKDREPGAFVIRDSNSFRGAYGLAMKVAS-PPPTVQQNKKVGDITNELVRHFLIET----SAKGVRLKGCPNEPYFGCLSALVYQHAITPLALPCKLMIPTRDP----------------NEEALELATPTSSTMDLLKQG-------------AGPPKPTEDFYACNVLYINSVDMESLTGPQAVAKAITETLAAKSTPTATIVQFKV-STQGITLTDNQRKVFFRRHYPINLITYCNMDPQERKWNK------AEGGVAKLFGFVARKQGSTTDNVSHLFAELEPDNSASAIVSFVSKLML 1673          
BLAST of tensin isoform X3 vs. Ensembl Zebrafish
Match: tns3.2 (tensin 3, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-081031-95])

HSP 1 Score: 154.836 bits (390), Expect = 9.237e-38
Identity = 115/371 (31.00%), Postives = 164/371 (44.20%), Query Frame = 3
Query: 2253 TNGNRNFQSALSPVSNQESMVSANYAFSGTEDNRYP------------LQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDL----IRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKE 3317
            T+G+ N  S   P+S   S VS +YA   T  +R              ++FV +T   WY+P ++RE  I+ L+DKE GSFIIR+S +F GAYGLA+KVA+ P   ++T+   GDL    +RHFLIE   +    GVRLKG PNEP + SL  LV  H     +LP +LI+ S+  +               ++       S +S A++                       L Q       +LG  D++ L G   + +A    F K  P T+TV     S  GIT TD  + LF+ R +    V+    D Q R++               I   I +      EN  HL  E D     S I+ F+ +
Sbjct:  528 TDGSENMLSF--PLS--RSTVSTSYASHNTSPSRSTPSPDFMASKPENVKFVQDTSKFWYKPDISREQAISVLKDKEPGSFIIRDSHSFRGAYGLAMKVATPPPTVLQTSRKVGDLSNELVRHFLIECTPK----GVRLKGCPNEPYFGSLTALVCQHSITPLALPCRLIIPSRDPLE--------------EFNESPTQTSTNSAAEL-----------------------LKQGAACNVWFLGSVDLESLTGVQGVQKATTVTFNKDPPPTSTVVHFKVSAQGITLTDNQRKLFFRRHYAVSTVIFCALDPQDRKW------KRDGCTAAKIFGFIARKSGSSTENVCHLFAEHDPEQPASAIVNFVSK 847          
BLAST of tensin isoform X3 vs. Ensembl Zebrafish
Match: tns1b (tensin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-6933])

HSP 1 Score: 151.754 bits (382), Expect = 2.330e-36
Identity = 99/331 (29.91%), Postives = 153/331 (46.22%), Query Frame = 3
Query: 2337 GTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLP---ENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLF-GKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKE 3317
            G+ + R  ++FV +T   WY+P ++R+  IN L+D++ G+F+IR+S +F GAYGLA+KVAS P   +   +  D   +L+RHFLIET    S  GVRLKG PNEP +  L+ LV  H     +LP KL++ ++  +                 ES +     +  A ML                        Q      LY+   D++ L G  AI +AI++       P  T V  ++ S  GIT TD  + LF+ R +P   V   D D Q R+++ P                + + +    +N  HL  E+D     + I+ F+ +
Sbjct: 1419 GSPETRMNVKFVQDTSKFWYKPDISRDQAINMLKDQDPGAFVIRDSHSFRGAYGLAMKVASPPPTTQPTKKAGDVTNELVRHFLIET----SPKGVRLKGCPNEPYFGCLSALVYQHSITPLALPCKLVIPTRDPLE----------------ESPEIATPTNPAADMLK-----------------------QGAACNVLYINSVDMESLTGPQAIAKAISETMNASPAPSATIVHFKV-SAQGITLTDNQRKLFFRRHYPIGTVTFCDIDPQERKWNKP------EGGTAKFFGFVARKQGSTTDNVSHLFAEMDPDQPATAIVNFVSK 1699          
BLAST of tensin isoform X3 vs. Ensembl Xenopus
Match: TNS3 (tensin 3 [Source:NCBI gene;Acc:100492216])

HSP 1 Score: 138.272 bits (347), Expect = 2.919e-32
Identity = 95/328 (28.96%), Postives = 147/328 (44.82%), Query Frame = 3
Query: 2340 TEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTN----DSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFI 3311
            + D    ++FV +T   WY+P ++R+  I  L+DKE GSFI+R+S +F GAYGLA+KVA+ P + + ++    D   +L+RHFLIE V +    GVRLKG PNEP + SL  LV  H     +LP KL++  +  +               +  +     + +S A++L                        Q       YL   +++ L G  A+ +A++    ++ P  +TV     S  GIT TD  + LF+ R +P   V+    D Q R+++   L                  K     N  HL  E D     S I+ F+
Sbjct:  947 SSDKHMTVKFVQDTSKFWYKPDISRDQAIAVLKDKEPGSFIVRDSHSFKGAYGLAMKVATPPPSVLHSSKKGLDLTNELVRHFLIECVHK----GVRLKGCPNEPYFGSLTALVYQHSITPLALPCKLLIPDKDPLE--------------EIPAATPQSAANSAAELLK-----------------------QGAACNVWYLNSVEMESLTGYQAVQKALSITQLQEPPPISTVVHFKVSAQGITLTDNQRKLFFRRHYPVNTVIFCALDPQDRKWTRDGLS--------AKVFGFVARKGAGNHNICHLFAEHDPEQPASAIVNFV 1225          
BLAST of tensin isoform X3 vs. Ensembl Xenopus
Match: TNS3 (tensin 3 [Source:NCBI gene;Acc:100492216])

HSP 1 Score: 138.272 bits (347), Expect = 3.731e-32
Identity = 95/328 (28.96%), Postives = 147/328 (44.82%), Query Frame = 3
Query: 2346 DNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTN----DSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKE 3317
            D    ++FV +T   WY+P ++R+  I  L+DKE GSFI+R+S +F GAYGLA+KVA+ P + + ++    D   +L+RHFLIE V +    GVRLKG PNEP + SL  LV  H     +LP KL++  +  +               +  +     + +S A++L                        Q       YL   +++ L G  A+ +A++    ++ P  +TV     S  GIT TD  + LF+ R +P   V+    D Q R+++   L                  K     N  HL  E D     S I+ F+ +
Sbjct: 1017 DKHMTVKFVQDTSKFWYKPDISRDQAIAVLKDKEPGSFIVRDSHSFKGAYGLAMKVATPPPSVLHSSKKGLDLTNELVRHFLIECVHK----GVRLKGCPNEPYFGSLTALVYQHSITPLALPCKLLIPDKDPLE--------------EIPAATPQSAANSAAELLK-----------------------QGAACNVWYLNSVEMESLTGYQAVQKALSITQLQEPPPISTVVHFKVSAQGITLTDNQRKLFFRRHYPVNTVIFCALDPQDRKWTRDGLS--------AKVFGFVARKGAGNHNICHLFAEHDPEQPASAIVNFVSK 1295          
BLAST of tensin isoform X3 vs. Ensembl Xenopus
Match: TNS3 (tensin 3 [Source:NCBI gene;Acc:100492216])

HSP 1 Score: 137.887 bits (346), Expect = 4.298e-32
Identity = 95/326 (29.14%), Postives = 146/326 (44.79%), Query Frame = 3
Query: 2346 DNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTN----DSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFI 3311
            D    ++FV +T   WY+P ++R+  I  L+DKE GSFI+R+S +F GAYGLA+KVA+ P + + ++    D   +L+RHFLIE V +    GVRLKG PNEP + SL  LV  H     +LP KL++  +  +               +  +     + +S A++L                        Q       YL   +++ L G  A+ +A++    ++ P  +TV     S  GIT TD  + LF+ R +P   V+    D Q R+++   L                  K     N  HL  E D     S I+ F+
Sbjct:  953 DKHMTVKFVQDTSKFWYKPDISRDQAIAVLKDKEPGSFIVRDSHSFKGAYGLAMKVATPPPSVLHSSKKGLDLTNELVRHFLIECVHK----GVRLKGCPNEPYFGSLTALVYQHSITPLALPCKLLIPDKDPLE--------------EIPAATPQSAANSAAELLK-----------------------QGAACNVWYLNSVEMESLTGYQAVQKALSITQLQEPPPISTVVHFKVSAQGITLTDNQRKLFFRRHYPVNTVIFCALDPQDRKWTRDGLS--------AKVFGFVARKGAGNHNICHLFAEHDPEQPASAIVNFV 1229          
BLAST of tensin isoform X3 vs. Ensembl Xenopus
Match: TNS3 (tensin 3 [Source:NCBI gene;Acc:100492216])

HSP 1 Score: 137.887 bits (346), Expect = 4.354e-32
Identity = 95/328 (28.96%), Postives = 147/328 (44.82%), Query Frame = 3
Query: 2346 DNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTN----DSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKE 3317
            D    ++FV +T   WY+P ++R+  I  L+DKE GSFI+R+S +F GAYGLA+KVA+ P + + ++    D   +L+RHFLIE V +    GVRLKG PNEP + SL  LV  H     +LP KL++  +  +               +  +     + +S A++L                        Q       YL   +++ L G  A+ +A++    ++ P  +TV     S  GIT TD  + LF+ R +P   V+    D Q R+++   L                  K     N  HL  E D     S I+ F+ +
Sbjct: 1006 DKHMTVKFVQDTSKFWYKPDISRDQAIAVLKDKEPGSFIVRDSHSFKGAYGLAMKVATPPPSVLHSSKKGLDLTNELVRHFLIECVHK----GVRLKGCPNEPYFGSLTALVYQHSITPLALPCKLLIPDKDPLE--------------EIPAATPQSAANSAAELLK-----------------------QGAACNVWYLNSVEMESLTGYQAVQKALSITQLQEPPPISTVVHFKVSAQGITLTDNQRKLFFRRHYPVNTVIFCALDPQDRKWTRDGLS--------AKVFGFVARKGAGNHNICHLFAEHDPEQPASAIVNFVSK 1284          
BLAST of tensin isoform X3 vs. Ensembl Xenopus
Match: TNS3 (tensin 3 [Source:NCBI gene;Acc:100492216])

HSP 1 Score: 137.502 bits (345), Expect = 5.953e-32
Identity = 95/330 (28.79%), Postives = 148/330 (44.85%), Query Frame = 3
Query: 2340 TEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTN----DSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKE 3317
            + D    ++FV +T   WY+P ++R+  I  L+DKE GSFI+R+S +F GAYGLA+KVA+ P + + ++    D   +L+RHFLIE V +    GVRLKG PNEP + SL  LV  H     +LP KL++  +  +               +  +     + +S A++L                        Q       YL   +++ L G  A+ +A++    ++ P  +TV     S  GIT TD  + LF+ R +P   V+    D Q R+++   L                  K     N  HL  E D     S I+ F+ +
Sbjct: 1013 SSDKHMTVKFVQDTSKFWYKPDISRDQAIAVLKDKEPGSFIVRDSHSFKGAYGLAMKVATPPPSVLHSSKKGLDLTNELVRHFLIECVHK----GVRLKGCPNEPYFGSLTALVYQHSITPLALPCKLLIPDKDPLE--------------EIPAATPQSAANSAAELLK-----------------------QGAACNVWYLNSVEMESLTGYQAVQKALSITQLQEPPPISTVVHFKVSAQGITLTDNQRKLFFRRHYPVNTVIFCALDPQDRKWTRDGLS--------AKVFGFVARKGAGNHNICHLFAEHDPEQPASAIVNFVSK 1293          
BLAST of tensin isoform X3 vs. Ensembl Mouse
Match: Tns1 (tensin 1 [Source:MGI Symbol;Acc:MGI:104552])

HSP 1 Score: 153.68 bits (387), Expect = 4.580e-38
Identity = 111/370 (30.00%), Postives = 167/370 (45.14%), Query Frame = 3
Query: 2268 NFQSALSPVSNQESMVSANYAFSGT-------------EDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAI---RTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINK-LFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKENYL 3326
            N + + SPV+N  +  S+  +FS T              + R  ++FV +T   WY+P ++RE  I  L+D+E G+FIIR+S +F GAYGLA+KV+S P       +  D   +L+RHFLIET       GV+LKG PNEP + SL+ LV  H     +LP KL++ S+     D  D           ES+      +S   +L                        Q      L++   D++ L G  AI +A ++ L     P  T V  ++ S  GIT TD  + LF+ R +P   V   D D Q R++               +   + + +    +NA HL  ELD +   S I+ F+ +  L
Sbjct:  298 NGKVSSSPVANGMASGSSTVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTITQQGKKGDMTHELVRHFLIETGPR----GVKLKGCPNEPNFGSLSALVYQHSVIPLALPCKLVIPSR-----DPTD-----------ESKDSSGPANSTTDLLK-----------------------QGAACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW-----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVML 618          
BLAST of tensin isoform X3 vs. Ensembl Mouse
Match: Tns1 (tensin 1 [Source:MGI Symbol;Acc:MGI:104552])

HSP 1 Score: 151.754 bits (382), Expect = 2.740e-36
Identity = 111/370 (30.00%), Postives = 167/370 (45.14%), Query Frame = 3
Query: 2268 NFQSALSPVSNQESMVSANYAFSGT-------------EDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAI---RTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINK-LFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKENYL 3326
            N + + SPV+N  +  S+  +FS T              + R  ++FV +T   WY+P ++RE  I  L+D+E G+FIIR+S +F GAYGLA+KV+S P       +  D   +L+RHFLIET       GV+LKG PNEP + SL+ LV  H     +LP KL++ S+     D  D           ES+      +S   +L                        Q      L++   D++ L G  AI +A ++ L     P  T V  ++ S  GIT TD  + LF+ R +P   V   D D Q R++               +   + + +    +NA HL  ELD +   S I+ F+ +  L
Sbjct: 1562 NGKVSSSPVANGMASGSSTVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTITQQGKKGDMTHELVRHFLIETGPR----GVKLKGCPNEPNFGSLSALVYQHSVIPLALPCKLVIPSR-----DPTD-----------ESKDSSGPANSTTDLLK-----------------------QGAACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW-----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVML 1882          
BLAST of tensin isoform X3 vs. Ensembl Mouse
Match: Tns1 (tensin 1 [Source:MGI Symbol;Acc:MGI:104552])

HSP 1 Score: 151.369 bits (381), Expect = 2.875e-36
Identity = 111/370 (30.00%), Postives = 167/370 (45.14%), Query Frame = 3
Query: 2268 NFQSALSPVSNQESMVSANYAFSGT-------------EDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAI---RTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINK-LFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKENYL 3326
            N + + SPV+N  +  S+  +FS T              + R  ++FV +T   WY+P ++RE  I  L+D+E G+FIIR+S +F GAYGLA+KV+S P       +  D   +L+RHFLIET       GV+LKG PNEP + SL+ LV  H     +LP KL++ S+     D  D           ES+      +S   +L                        Q      L++   D++ L G  AI +A ++ L     P  T V  ++ S  GIT TD  + LF+ R +P   V   D D Q R++               +   + + +    +NA HL  ELD +   S I+ F+ +  L
Sbjct: 1497 NGKVSSSPVANGMASGSSTVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTITQQGKKGDMTHELVRHFLIETGPR----GVKLKGCPNEPNFGSLSALVYQHSVIPLALPCKLVIPSR-----DPTD-----------ESKDSSGPANSTTDLLK-----------------------QGAACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW-----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVML 1817          
BLAST of tensin isoform X3 vs. Ensembl Mouse
Match: Tns1 (tensin 1 [Source:MGI Symbol;Acc:MGI:104552])

HSP 1 Score: 151.369 bits (381), Expect = 2.894e-36
Identity = 111/370 (30.00%), Postives = 167/370 (45.14%), Query Frame = 3
Query: 2268 NFQSALSPVSNQESMVSANYAFSGT-------------EDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAI---RTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINK-LFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKENYL 3326
            N + + SPV+N  +  S+  +FS T              + R  ++FV +T   WY+P ++RE  I  L+D+E G+FIIR+S +F GAYGLA+KV+S P       +  D   +L+RHFLIET       GV+LKG PNEP + SL+ LV  H     +LP KL++ S+     D  D           ES+      +S   +L                        Q      L++   D++ L G  AI +A ++ L     P  T V  ++ S  GIT TD  + LF+ R +P   V   D D Q R++               +   + + +    +NA HL  ELD +   S I+ F+ +  L
Sbjct: 1393 NGKVSSSPVANGMASGSSTVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTITQQGKKGDMTHELVRHFLIETGPR----GVKLKGCPNEPNFGSLSALVYQHSVIPLALPCKLVIPSR-----DPTD-----------ESKDSSGPANSTTDLLK-----------------------QGAACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW-----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVML 1713          
BLAST of tensin isoform X3 vs. Ensembl Mouse
Match: Tns1 (tensin 1 [Source:MGI Symbol;Acc:MGI:104552])

HSP 1 Score: 151.369 bits (381), Expect = 2.950e-36
Identity = 111/370 (30.00%), Postives = 167/370 (45.14%), Query Frame = 3
Query: 2268 NFQSALSPVSNQESMVSANYAFSGT-------------EDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAI---RTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINK-LFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKENYL 3326
            N + + SPV+N  +  S+  +FS T              + R  ++FV +T   WY+P ++RE  I  L+D+E G+FIIR+S +F GAYGLA+KV+S P       +  D   +L+RHFLIET       GV+LKG PNEP + SL+ LV  H     +LP KL++ S+     D  D           ES+      +S   +L                        Q      L++   D++ L G  AI +A ++ L     P  T V  ++ S  GIT TD  + LF+ R +P   V   D D Q R++               +   + + +    +NA HL  ELD +   S I+ F+ +  L
Sbjct: 1554 NGKVSSSPVANGMASGSSTVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTITQQGKKGDMTHELVRHFLIETGPR----GVKLKGCPNEPNFGSLSALVYQHSVIPLALPCKLVIPSR-----DPTD-----------ESKDSSGPANSTTDLLK-----------------------QGAACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW-----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVML 1874          
BLAST of tensin isoform X3 vs. UniProt/SwissProt
Match: sp|Q9GLM4|TENS1_BOVIN (Tensin-1 OS=Bos taurus OX=9913 GN=TNS1 PE=2 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 4.087e-36
Identity = 103/333 (30.93%), Postives = 159/333 (47.75%), Query Frame = 3
Query: 2340 TEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTN---DSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINK-LFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKENYL 3326
            + + R  ++FV +T   WY+P ++RE  I  L+D+E G+FIIR+S +F GAYGLA+KV+S P   ++ N   D   +L+RHFLIET       GV+LKG PNEP + SL+ LV  H     +LP KL++ ++     D  D           ES+      +S + +L                        Q      L++   D++ L G  AI +AI++ L     P  T V  ++ S  GIT TD  + LF+ R +P   V   D D Q R+++              +   + + +    +NA HL  ELD +   S I++F+ +  L
Sbjct: 1426 SPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFLIETGPR----GVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIPNR-----DPTD-----------ESKDSSGPANSTSDLLK-----------------------QGAACNVLFVNSVDMESLTGPQAISKAISETLAADPTPAATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKWT-----KTEGGAPAKLFGFVARKQGSATDNACHLFAELDPNQPASAIVSFVSKVML 1709          
BLAST of tensin isoform X3 vs. UniProt/SwissProt
Match: sp|Q9HBL0|TENS1_HUMAN (Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2)

HSP 1 Score: 151.369 bits (381), Expect = 2.071e-35
Identity = 103/333 (30.93%), Postives = 156/333 (46.85%), Query Frame = 3
Query: 2340 TEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTN---DSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINK-LFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKENYL 3326
            + + R  ++FV +T   WY+P ++RE  I  L+D+E G+FIIR+S +F GAYGLA+KV+S P   ++ N   D   +L+RHFLIET       GV+LKG PNEP + SL+ LV  H     +LP KL++ ++     D  D           ES+      +S A +L                        Q      L++   D++ L G  AI +A ++ L     P  T V  ++ S  GIT TD  + LF+ R +P   V   D D Q R++               +   + + +    +NA HL  ELD +   S I+ F+ +  L
Sbjct: 1446 SPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFLIETGPR----GVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIPNR-----DPTD-----------ESKDSSGPANSTADLLK-----------------------QGAACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW-----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVML 1729          
BLAST of tensin isoform X3 vs. UniProt/SwissProt
Match: sp|Q04205|TENS_CHICK (Tensin OS=Gallus gallus OX=9031 GN=TNS PE=1 SV=2)

HSP 1 Score: 146.747 bits (369), Expect = 6.117e-34
Identity = 98/328 (29.88%), Postives = 153/328 (46.65%), Query Frame = 3
Query: 2340 TEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTN---DSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINK-LFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFI 3311
            + + R  ++FV +T   WY+P ++RE  I  L+D+E G+FIIR+S +F GAYGLA+KVAS P   ++ N   D   +L+RHFLIET    S  GV+LKG PNEP +  L+ LV  H     +LP KL++  +  +                 E ++   S ++ A  L                      L Q      L++   +++ L G  AI +A+ + L     P  T V  ++ S  GIT TD  + LF+ R +P   V   D D Q R+++         +    +   + + +    +N  HL  ELD     + I+ F+
Sbjct: 1455 SPETRANVKFVQDTSKYWYKPDISREQAIALLKDREPGAFIIRDSHSFRGAYGLAMKVASPPPTVMQQNKKGDITNELVRHFLIET----SPRGVKLKGCPNEPNFGCLSALVYQHSIMPLALPCKLVIPDRDPM-----------------EEKKDAASTTNSATDL----------------------LKQGAACNVLFINSVEMESLTGPQAISKAVAETLVADPTPTATIVHFKV-SAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKWT-----KTDGSGPAKLFGFVARKQGSTTDNVCHLFAELDPDQPAAAIVNFV 1733          
BLAST of tensin isoform X3 vs. UniProt/SwissProt
Match: sp|Q68CZ2|TENS3_HUMAN (Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2)

HSP 1 Score: 139.813 bits (351), Expect = 7.411e-32
Identity = 96/323 (29.72%), Postives = 148/323 (45.82%), Query Frame = 3
Query: 2361 LQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGD----LIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKE 3317
            ++FV +T   WY+  ++RE  I  L+DKE GSFI+R+S +F GAYGLA+KVA+ P + ++ N   GD    L+RHFLIE   +    GVRLKG  NEP + SL  LV  H     +LP KL++  +  +         +A+S  Q        + +S A++L                        Q       YL   +++ L G  AI +A++    ++ P  +TV     S  GIT TD  + LF+ R +P   V+    D Q R++               +   + + +    +N  HL  E D     S I+ F+ +
Sbjct: 1162 VKFVQDTSKFWYKADISREQAIAMLKDKEPGSFIVRDSHSFRGAYGLAMKVATPPPSVLQLNKKAGDLANELVRHFLIECTPK----GVRLKGCSNEPYFGSLTALVCQHSITPLALPCKLLIPERDPLE-------EIAESSPQ-------TAANSAAELLK-----------------------QGAACNVWYLNSVEMESLTGHQAIQKALSITLVQEPPPVSTVVHFKVSAQGITLTDNQRKLFFRRHYPVNSVIFCALDPQDRKW-------IKDGPSSKVFGFVARKQGSATDNVCHLFAEHDPEQPASAIVNFVSK 1436          
BLAST of tensin isoform X3 vs. UniProt/SwissProt
Match: sp|Q8CGB6|TNS2_MOUSE (Tensin-2 OS=Mus musculus OX=10090 GN=Tns2 PE=1 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.116e-31
Identity = 103/330 (31.21%), Postives = 154/330 (46.67%), Query Frame = 3
Query: 2343 EDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENA-IRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAIN-KLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKENYL 3326
            ++N+  ++FV +T   WY+PHL+R+  I  L+DK+ G+F+IR+S +F GAYGLALKVA+ P +A     D    L+RHFLIET  +    GV++KG P EP + SL+ LV  H  +  SLP  L + S+  +                 E+ +     +     +STA                 + L Q    + LYL   + + L G  A+ +A +  L     P    V  ++ S  GIT TD  + LF+ R +P   +  +  D Q R +++P            I   + K      EN  HL  ELD     S I+TFI +  L
Sbjct: 1115 QENQSNVKFVQDTSKFWYKPHLSRDQAIALLKDKDPGAFLIRDSHSFQGAYGLALKVATPPPSAQPWKGDPSEQLVRHFLIETGPK----GVKIKGCPTEPYFGSLSALVSQHSISPISLPCCLRIPSKDPLE----------------ETPE-----APVPTNMSTAA----------------DLLRQGAACSVLYLTSVETESLTGPQAVAKASSAALSCSPVPVPAIVHFKV-SAQGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNP------DGATSKIFGFVAKKPGSPWENVCHLFAELDPDQPASAIVTFITKVLL 1396          
BLAST of tensin isoform X3 vs. TrEMBL
Match: A0A060YE75 (SH2 domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00044137001 PE=4 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 1.964e-37
Identity = 107/345 (31.01%), Postives = 160/345 (46.38%), Query Frame = 3
Query: 2331 FSGTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENA---IRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSS----QSSIRLDQ--------VDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKN-PKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKE 3317
            +  + D R  ++FV +T   WY+P ++RE  I+ LRD+E G+F+IR+S +F GAYGLA+KVA  P  A    +  D   +L+RHFLIET    S  GVRLKG PNEP +  L+ LV  H     +LP KL++ S    + ++ LD         V  G +AQ     E+                                     H C V   LY+   D++ L G  A+ +AI+++      P  TTV  ++ S+ GIT TD  + +F+ R +P   V   D D Q R++S              +   + + +    +N  HL  ELD     S I+ F+ +
Sbjct:   38 YDQSPDIRLNVKFVQDTSKFWYKPDISREQAISLLRDREPGAFVIRDSHSFRGAYGLAMKVACPPPTAQANKKVGDITSELVRHFLIET----SPKGVRLKGCPNEPYFGCLSALVYQHSMTPLALPCKLMIPSKDPNEEALELDTPTDTVAELVKQGAVAQQQVPEEA-------------------------------------HACNV---LYISSVDMESLTGPQAVAKAISEMVAVNPLPAATTVHFKV-SSQGITLTDSQRKVFFRRHYPINTVTYCDIDPQDRKWSK------EGGGTAKLFGFVARKQGSTTDNVSHLFAELDPDQPASAIVNFVSK 331          
BLAST of tensin isoform X3 vs. TrEMBL
Match: A0A1S3QDI3 (tensin-like isoform X6 OS=Salmo salar OX=8030 GN=LOC106591349 PE=4 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 4.707e-36
Identity = 108/342 (31.58%), Postives = 158/342 (46.20%), Query Frame = 3
Query: 2340 TEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENA---IRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSS----QSSIRLDQ--------VDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKN-PKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKE 3317
            + D R  ++FV +T   WY+P ++RE  I+ LRD+E G+F+IR+S +F GAYGLA+KVA  P  A    +  D   +L+RHFLIET    S  GVRLKG PNEP +  L+ LV  H     +LP KL++ S    + ++ LD         V  G +AQ     E+                                     H C V   LY+   D++ L G  A+ +AI+K       P  TTV  ++ S+ GIT TD  + +F+ R +P   V   D D Q R++S              +   + + +    +N  HL  ELD     S I+ F+ +
Sbjct:  353 SPDIRLNVKFVQDTSKFWYKPDISREQAISLLRDREPGAFVIRDSHSFRGAYGLAMKVACPPPTAQANKKVGDITSELVRHFLIET----SPKGVRLKGCPNEPYFGCLSALVYQHSMTPLALPCKLMIPSKDPNEEALELDTPTDTVAELVKQGAVAQQQVPEEA-------------------------------------HACNV---LYISSVDMESLTGPQAVAKAISKTVAVNPLPAATTVHFKV-SSQGITLTDSQRKVFFRRHYPINTVTYCDIDPQDRKWSK------EGGGTAKLFGFVARKQGSTTDNVSHLFAELDPDQPASAIVNFVSK 643          
BLAST of tensin isoform X3 vs. TrEMBL
Match: A0A1S3MY10 (tensin-like isoform X7 OS=Salmo salar OX=8030 GN=LOC106575567 PE=4 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 5.262e-36
Identity = 108/342 (31.58%), Postives = 159/342 (46.49%), Query Frame = 3
Query: 2340 TEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENA---IRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSS----QSSIRLDQ--------VDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKN-PKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKE 3317
            + D R  ++FV +T  LWY+P ++RE  I+ LRD+E G+F+IR+S +F GAYGLA+KVA  P  A    +  D   +L+RHFLIET    S  GVRLKG PNEP +  L+ LV  H     +LP KL++ S    + ++ LD         V  G +AQ     E+                                     H C V   LY+   D++ L G  A+ +AI++       P  TTV  ++ S+ GIT TD  + +F+ R +P   V   D D Q R++S              +   + + +    +N  HL  ELD     S I+ F+ +
Sbjct:  344 SPDIRLNVKFVQDTSKLWYKPDISREQAISLLRDREPGAFVIRDSHSFRGAYGLAMKVACPPPTAQANKKVGDITSELVRHFLIET----SPKGVRLKGCPNEPYFGCLSALVYQHSMTPLALPCKLMIPSKDPNEEALELDTPTDTVAELVKQGAVAQQQVPEEA-------------------------------------HACNV---LYISSVDMESLTGPQAVAKAISETVAVNPLPAATTVHFKV-SSQGITLTDSQRKVFFRRHYPINTVTYCDIDPQDRKWSK------EGGGTAKLFGFVARKQGSTTDNVSHLFAELDPDQPASAIVNFVSK 634          
BLAST of tensin isoform X3 vs. TrEMBL
Match: A0A1S3QDG6 (tensin-like isoform X3 OS=Salmo salar OX=8030 GN=LOC106591349 PE=4 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 5.330e-36
Identity = 108/342 (31.58%), Postives = 158/342 (46.20%), Query Frame = 3
Query: 2340 TEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENA---IRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSS----QSSIRLDQ--------VDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKN-PKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKE 3317
            + D R  ++FV +T   WY+P ++RE  I+ LRD+E G+F+IR+S +F GAYGLA+KVA  P  A    +  D   +L+RHFLIET    S  GVRLKG PNEP +  L+ LV  H     +LP KL++ S    + ++ LD         V  G +AQ     E+                                     H C V   LY+   D++ L G  A+ +AI+K       P  TTV  ++ S+ GIT TD  + +F+ R +P   V   D D Q R++S              +   + + +    +N  HL  ELD     S I+ F+ +
Sbjct:  374 SPDIRLNVKFVQDTSKFWYKPDISREQAISLLRDREPGAFVIRDSHSFRGAYGLAMKVACPPPTAQANKKVGDITSELVRHFLIET----SPKGVRLKGCPNEPYFGCLSALVYQHSMTPLALPCKLMIPSKDPNEEALELDTPTDTVAELVKQGAVAQQQVPEEA-------------------------------------HACNV---LYISSVDMESLTGPQAVAKAISKTVAVNPLPAATTVHFKV-SSQGITLTDSQRKVFFRRHYPINTVTYCDIDPQDRKWSK------EGGGTAKLFGFVARKQGSTTDNVSHLFAELDPDQPASAIVNFVSK 664          
BLAST of tensin isoform X3 vs. TrEMBL
Match: A0A1S3QF46 (tensin-like isoform X7 OS=Salmo salar OX=8030 GN=LOC106591349 PE=4 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 5.606e-36
Identity = 108/342 (31.58%), Postives = 158/342 (46.20%), Query Frame = 3
Query: 2340 TEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENA---IRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSS----QSSIRLDQ--------VDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKN-PKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKE 3317
            + D R  ++FV +T   WY+P ++RE  I+ LRD+E G+F+IR+S +F GAYGLA+KVA  P  A    +  D   +L+RHFLIET    S  GVRLKG PNEP +  L+ LV  H     +LP KL++ S    + ++ LD         V  G +AQ     E+                                     H C V   LY+   D++ L G  A+ +AI+K       P  TTV  ++ S+ GIT TD  + +F+ R +P   V   D D Q R++S              +   + + +    +N  HL  ELD     S I+ F+ +
Sbjct:  344 SPDIRLNVKFVQDTSKFWYKPDISREQAISLLRDREPGAFVIRDSHSFRGAYGLAMKVACPPPTAQANKKVGDITSELVRHFLIET----SPKGVRLKGCPNEPYFGCLSALVYQHSMTPLALPCKLMIPSKDPNEEALELDTPTDTVAELVKQGAVAQQQVPEEA-------------------------------------HACNV---LYISSVDMESLTGPQAVAKAISKTVAVNPLPAATTVHFKV-SSQGITLTDSQRKVFFRRHYPINTVTYCDIDPQDRKWSK------EGGGTAKLFGFVARKQGSTTDNVSHLFAELDPDQPASAIVNFVSK 634          
BLAST of tensin isoform X3 vs. Ensembl Cavefish
Match: TNS3 (tensin-3 [Source:NCBI gene;Acc:103027377])

HSP 1 Score: 151.754 bits (382), Expect = 1.158e-36
Identity = 119/379 (31.40%), Postives = 169/379 (44.59%), Query Frame = 3
Query: 2193 GRSGQDQVVNTSWQTRTESYTNGNRNFQSALSPVSNQESMVSANYAFSGTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDL----IRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKE 3317
            G  G D  +N+S  +RT    NG        SP  +  S        SG  DN    +FV +T   WY+P ++RE  I  L+DKE GSFI+R+S +F GAYGLA+KVA+ P + ++ +   GDL    +RHFLIE  ++    GVRLKG PNEP + SL  LV  H     +LP KLI+ S+  +                 ESQQ  Q+ ++ A  L                      L Q       +LG  +++ L G  AI +A   + G+  P T+T+     S  GIT TD  + LF+ R +    V+    D Q R ++              I   + +      EN  HL  E D     S I+ F+ +
Sbjct:  875 GVDGGDMFLNSSL-SRTAVSNNG--------SPTGSTPS----PDPLSGKPDNA---KFVQDTSKFWYKPDISREQAITVLKDKEPGSFIVRDSHSFRGAYGLAMKVATPPPSILQQSKKVGDLTNELVRHFLIECTQK----GVRLKGCPNEPYFGSLTALVCQHSITPLALPCKLIIPSRDPLE-------------DLTESQQ--QTSTNSATEL----------------------LKQGAACNVWFLGSVELESLTGVQAIQKASTVILGQNPPATSTIVHFKVSAQGITLTDNQRKLFFRRHYAVNTVIFCALDPQDRRWTK------DGCLAAKIFGFVARKSGSSTENVCHLFAEHDPEQPASAIVNFVSK 1190          
BLAST of tensin isoform X3 vs. Ensembl Cavefish
Match: tns1b (tensin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-6933])

HSP 1 Score: 150.214 bits (378), Expect = 4.706e-36
Identity = 98/330 (29.70%), Postives = 154/330 (46.67%), Query Frame = 3
Query: 2337 GTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENA--IRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINK-LFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKE 3317
            G+ + R  ++FV +T   WY+P ++RE  IN L+++E G+FIIR+S +F GAYGLA+KV+S P  A   +  D   +L+RHFLIET    S  GV+LKG PNEP +  L+ LV  H     +LP KL++                        ++  H+     A  ++ A                   L Q      LY+   D++ L G  A+ +AI++ +     P  TTV  ++ S+ GIT TD  + LF+ R +P   V   D D Q R+++                  + + +    +N  HL  E+D     + I+ F+ +
Sbjct: 1423 GSPETRLNVKFVQDTSKFWYKPDISREQAINILKEREPGAFIIRDSHSFRGAYGLAMKVSSPPPTAQQAKKGDITNELVRHFLIET----SPKGVKLKGCPNEPYFGCLSALVYQHSITPLALPCKLVI-----------------------PTKDPHEEVPEVATPVNPATEL----------------LKQGAACNVLYINSVDMESLTGPQAVAKAISETMAASPMPTATTVHFKV-SSQGITLTDNQRKLFFRRHYPISTVTFCDLDPQERKWN------KAEGGTAKFFGFVARKQGSTTDNVSHLFAEMDPDQPATAIVNFVSK 1702          
BLAST of tensin isoform X3 vs. Ensembl Cavefish
Match: ENSAMXT00000013817.2 (pep primary_assembly:Astyanax_mexicanus-2.0:13:8188442:8217069:-1 gene:ENSAMXG00000013421.2 transcript:ENSAMXT00000013817.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 143.665 bits (361), Expect = 3.728e-34
Identity = 96/335 (28.66%), Postives = 150/335 (44.78%), Query Frame = 3
Query: 2325 YAFSGTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIR-TNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKENYL 3326
            +   G  D +  ++FV +T   WY+P ++RE  I  L+D+E G+F+IR+S +F GAYGLA+KVA  P    +   D   +L+RHFLIET    S  GVRLKG PNEP +  L+ LV  H     +LP KL++                                 +R + LS +H  +SS   N                  LY+   D++ L G  A+ +AI++      P + TV     S  GIT TD  + +F+ R +P   V   + D Q R+++              +   + + +    +N  HL  EL+     + I+ ++ +  L
Sbjct:  873 FPADGPPDIKLNVKFVQDTSKFWYKPDISREQAITLLKDREPGAFVIRDSHSFRGAYGLAMKVACPPPTVQQNKKDMTNELVRHFLIET----SSKGVRLKGCPNEPHFGCLSALVYQHSITPLALPCKLMI--------------------------------PTRGETLSFSHFLISSAACN-----------------VLYINSVDMESLTGPQAVAKAISETLAANPPLSATVVHFKVSLQGITLTDNQRKVFFRRHYPINTVTYCNIDPQERKWNK------ADGGLAKLFGFVARKQGSTTDNVSHLFAELEPDQPATAIVNYVSKVML 1148          
BLAST of tensin isoform X3 vs. Ensembl Cavefish
Match: ENSAMXT00000049936.1 (pep primary_assembly:Astyanax_mexicanus-2.0:13:8188442:8199496:-1 gene:ENSAMXG00000013421.2 transcript:ENSAMXT00000049936.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.428 bits (350), Expect = 7.205e-34
Identity = 95/335 (28.36%), Postives = 150/335 (44.78%), Query Frame = 3
Query: 2325 YAFSGTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIR-TNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKENYL 3326
            +   G  D +  ++FV +T   WY+P ++RE  I  L+D+E G+F+IR+S +F GAYGLA+KVA  P    +   D   +L+RHFLIET    S  GVRLKG PNEP +  L+ LV  H     +LP KL++ ++                    E   +  + +S A  L                      L Q      LY+   D++ L G  A+ +AI++      P + TV     S  GIT TD  + +F+ R +P   V   + D Q R+++              +   + + +    +N  HL  EL+     + I+ ++ +  L
Sbjct:  262 FPADGPPDIKLNVKFVQDTSKFWYKPDISREQAITLLKDREPGAFVIRDSHSFRGAYGLAMKVACPPPTVQQNKKDMTNELVRHFLIET----SSKGVRLKGCPNEPHFGCLSALVYQHSITPLALPCKLMIPTRDP-----------------NEEALELVTPTSSAMDL----------------------LKQGAACNVLYINSVDMESLTGPQAVAKAISETLAANPPLSATVVHFKVSLQGITLTDNQRKVFFRRHYPINTVTYCNIDPQERKWNK------ADGGLAKLFGFVARKQGSTTDNVSHLFAELEPDQPATAIVNYVSKVML 547          
BLAST of tensin isoform X3 vs. Ensembl Cavefish
Match: tns2a (tensin 2 [Source:NCBI gene;Acc:103022390])

HSP 1 Score: 137.117 bits (344), Expect = 5.276e-32
Identity = 107/330 (32.42%), Postives = 147/330 (44.55%), Query Frame = 3
Query: 2337 GTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENA----IRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINK-LFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFI 3311
            G   N+  ++FV ++   WY+P ++RE  I AL++KE G+F+IR+S++F GAYGLALKVA+ P NA     +  D Q  L+RHFLIET       GV++KG  NEP + SL+ LV  H     SLP  L        RL   D  G  Q     E Q         A  +STA                 + L Q      LYL   + + L G  AI +A+   +     P  T V  ++ S  GIT TD  + +F+ R +P   V  +  D Q R     + +  G                   EN  HL  ELD     + I+ FI
Sbjct: 1325 GEAGNQVSVKFVQDSSRFWYKPGISREQAIVALKEKEPGAFLIRDSNSFQGAYGLALKVATPPPNANNHSGKGGDPQEQLVRHFLIET----GPRGVKIKGCQNEPHFGSLSALVYQHSITPISLPCAL--------RLPDKDPTGEMQ-----EVQV--------ASNMSTAA----------------DLLKQGAACNVLYLNSVETESLTGPQAIAKAVGATVVRSPRPSATVVHFKV-SAQGITLTDSQRRVFFRRHYPINSVTFSSLDPQDRRVFGFVAKKPGSVA----------------ENVCHLFAELDPEQPATAIVNFI 1596          
BLAST of tensin isoform X3 vs. Ensembl Sea Lamprey
Match: TNS1 (tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973])

HSP 1 Score: 157.918 bits (398), Expect = 4.399e-39
Identity = 105/332 (31.63%), Postives = 158/332 (47.59%), Query Frame = 3
Query: 2337 GTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGD----LIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINK-LFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKE 3317
            G+ + R  ++FV +T   WY+  ++R+  I  L+DKE GSF+IR+S +F GAYGLA+KV+S P N  +    +GD    L+RH+LIE   +    GVRLKG PNEP + SL+ LV  H     +LP K+++  +  +   +VD            S Q H   ++                        P  L Q      LYLG  +++ L G  A+ +A+ + L G   P  T V  ++ S  G+T TD  + LF+ R +PA  V   D D Q R++               I   + K +  + +N  HL  ELD     S I++FI +
Sbjct: 1385 GSIETRAQVKFVQDTTKYWYKKEISRDQAIALLKDKEPGSFVIRDSHSFRGAYGLAMKVSSPPPNIPQQGKKKGDVSSELVRHYLIECTSK----GVRLKGCPNEPYFGSLSALVYQHSITPLALPCKIVIPHEDPLEHSEVD------------SIQSHPVNAT------------------------PELLKQGAACNVLYLGSVEMESLTGPQAVAKAVGQALSGSAPPSPTQVHFKV-SQQGVTLTDNQRKLFFRRHYPADTVTYCDQDPQNRKWKK------DSGSSANIFGFVAKKQGSVTDNQCHLFAELDPKQPASAIVSFITK 1669          
BLAST of tensin isoform X3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003653.1 (pep scaffold:Pmarinus_7.0:GL476944:428913:445548:-1 gene:ENSPMAG00000003337.1 transcript:ENSPMAT00000003653.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 133.65 bits (335), Expect = 5.568e-32
Identity = 92/326 (28.22%), Postives = 144/326 (44.17%), Query Frame = 3
Query: 2358 PLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAI--RTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFG-KKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKENYL 3326
            P+ FV +T   WY+P ++R+  I  L+ ++ G+F+IR+SS+F GAYGLALKVA+ P  ++  +  D   +L+RHFLIE+  +    GVRLKG  NEP + SL+ LV  H     +LP KL+V     +    V+                     S +++L                        Q      L+LG  +++ L G  AI +A  ++   K  P  TTV  ++ S  GIT TD  + +      P   V   + D + R +            G  +   + +      +N  HL  ELD     + I+ F+ +  L
Sbjct:  522 PVNFVQDTSKYWYKPDISRDQAITMLKGRDPGAFVIRDSSSFRGAYGLALKVATPPGPSLDSKKGDPASELVRHFLIESTPK----GVRLKGCSNEPVFGSLSALVYQHSITPLALPCKLLVPEHDPLDTSSVN---------------------SASELLK-----------------------QGAACNVLFLGSVEMESLTGPQAIGKATAEILDMKPRPVATTVHFKV-SAQGITLTDNQRSILPPTHNPVSTVTFCNVDPETRTWV-----QAEGTPGSRVFGFVARKPGSSSDNLCHLFAELDPEQPAAAIVNFVSKVLL 793          
BLAST of tensin isoform X3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005743.1 (pep scaffold:Pmarinus_7.0:GL478791:187748:191319:1 gene:ENSPMAG00000005205.1 transcript:ENSPMAT00000005743.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.087 bits (292), Expect = 2.823e-29
Identity = 89/305 (29.18%), Postives = 134/305 (43.93%), Query Frame = 3
Query: 2424 INALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAI---RTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLD-STNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKENYL 3326
            I  L+D E GSFIIR+S +F GAYGLA+KVA  P + +   +  D   +L+RH+LIE    S+  GVRLKG PNEP + SL+ LV  H     +LP +LI+  +  +   + D                    SS A   ++A                   L Q      L+LG  +++ L G  AI +A+ ++            +    S  GIT TD  + LF+ R +P+  V   D D Q R++ +        +    I   + K +    +N  HL  EL+       I+ F+ +  L
Sbjct:    2 IAVLKDSEPGSFIIRDSHSFRGAYGLAVKVAMPPPSVLQQTKKGDLANELVRHYLIE----STPKGVRLKGCPNEPFFGSLSALVYQHSITPLALPCQLIIPDKDPMECSETD--------------------SSEANTANSASEL----------------LKQGAACNVLFLGSVEMESLTGPQAIAKAVGEVLEASAATPAATAVHFKVSAQGITLTDNQRKLFFRRHYPSITVTFCDLDPQERKWQN------NGSNSANIFGFVAKKQASTTDNLCHLFAELEPEQPAGAIVNFVTKVML 260          
BLAST of tensin isoform X3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001958.1 (pep scaffold:Pmarinus_7.0:GL480048:14054:23824:1 gene:ENSPMAG00000001775.1 transcript:ENSPMAT00000001958.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.316 bits (290), Expect = 8.401e-29
Identity = 80/257 (31.13%), Postives = 123/257 (47.86%), Query Frame = 3
Query: 2361 LQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAI--RTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTN-GITFTDKVQLLFYTRQFPAQHV 3122
            + FV +T   WY+P + RE  +  L  +E G+F+IRNSS+F G +GLA+KV +LP         D+  +L+RHFLIET       GVRLKG PNEP + SL+ LV  H     +LP          +RL   D   + ++H   ++     +GSS+                       P       V TA +L   +++ L G  A+ +A + + G    ++  + + L  T  GIT TD  +  F+ R +PA+ +
Sbjct:    1 ISFVQDTSKFWYKPGITREQAVTLLCPREAGAFVIRNSSSFHGDFGLAMKVENLPPGVPVQAGRDTVDELVRHFLIET----KAQGVRLKGCPNEPFFGSLSALVNQHTVTPLALP--------GCLRLPDRD-FDLTKAHDLCDALTGGSTGSSQP----------------------PE-----AVGTAFFLDSVEMESLTGPQAVARATSVIMGMAT-RSMPIHVHLRVTGQGITLTDIYRKRFFRRHYPAESI 216          
BLAST of tensin isoform X3 vs. Ensembl Nematostella
Match: EDO45783 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRM1])

HSP 1 Score: 114.39 bits (285), Expect = 4.942e-28
Identity = 75/257 (29.18%), Postives = 122/257 (47.47%), Query Frame = 3
Query: 2385 DLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDL----IRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFG-KKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYD 3140
            + WY+P + R+  IN L+DKE G F++R+S +F GAYGLA+KVA  P + ++ + ++ DL    IRHFLI    ES+  GV+LKG  NEP + SLA  V  H     SLP +L++ ++                           +   R   L+  +       VN +           L    +++G+ +V+ L G  A+ + +  L   K  P+ T    ++ +  G+T TD  + +F+ + FP   +L    D
Sbjct:    2 EFWYKPKITRDQAINVLKDKEPGLFVVRDSQSFPGAYGLAVKVAIPPPHVLQGDLTKVDLANEKIRHFLI----ESTKKGVKLKGCDNEPVFGSLAAFVFQHTITPLSLPLRLVIPNEG--------------------------TWPRRCFSLTFMY------AVNVVSF--------FLAMKVMFVGESNVEMLSGSTAVQRTVEDLLKYKATPRFTPASFKV-TREGVTITDLERKVFFRKHFPMTSILHCGID 213          
BLAST of tensin isoform X3 vs. Ensembl Medaka
Match: ENSORLT00000002849.2 (pep primary_assembly:ASM223467v1:2:14075704:14085025:-1 gene:ENSORLG00000002301.2 transcript:ENSORLT00000002849.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 153.295 bits (386), Expect = 7.617e-38
Identity = 105/333 (31.53%), Postives = 156/333 (46.85%), Query Frame = 3
Query: 2346 DNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGD----LIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKN-PKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKENYLR 3329
            D +  ++FV +T   WY+P ++RE  IN L+D+E G+F+IR+S +F GAYGLA+KVA  P   I+ N   GD    L+RHFLIET    S  GVRLKG PNEP +  L+ LV  H     +LP KL++ ++                             +  A  L+T     + P V          L Q      LY+   D++ L G  AI +AI++       P  TTV  ++ +T GIT TD  + +F+ R +P   +   D D Q R++               +   + + +    +NA HL  ELD     S I++F+ +   R
Sbjct:  394 DIKMNVKFVQDTSKFWYKPDISREQAINLLKDREPGAFVIRDSHSFRGAYGLAMKVA-CPPPTIQQNKKVGDLTNELVRHFLIET----SPKGVRLKGCPNEPYFGCLSALVYQHSMTPLALPCKLMIPTKDP---------------------------NEEALELATP----TDPVVEL--------LKQEAACNVLYINSVDMESLTGPQAIAKAISQTLATSPLPAATTVHFKV-TTQGITLTDSQRKIFFRRHYPISTITYCDMDPQNRKWG------KEGGGSVKLFGFVARKQGSTTDNASHLFAELDPDQPASAIVSFVSKTLNR 675          
BLAST of tensin isoform X3 vs. Ensembl Medaka
Match: ENSORLT00000002851.2 (pep primary_assembly:ASM223467v1:2:14075704:14087112:-1 gene:ENSORLG00000002301.2 transcript:ENSORLT00000002851.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 153.295 bits (386), Expect = 2.761e-37
Identity = 105/333 (31.53%), Postives = 156/333 (46.85%), Query Frame = 3
Query: 2346 DNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGD----LIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKN-PKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKENYLR 3329
            D +  ++FV +T   WY+P ++RE  IN L+D+E G+F+IR+S +F GAYGLA+KVA  P   I+ N   GD    L+RHFLIET    S  GVRLKG PNEP +  L+ LV  H     +LP KL++ ++                             +  A  L+T     + P V          L Q      LY+   D++ L G  AI +AI++       P  TTV  ++ +T GIT TD  + +F+ R +P   +   D D Q R++               +   + + +    +NA HL  ELD     S I++F+ +   R
Sbjct:  700 DIKMNVKFVQDTSKFWYKPDISREQAINLLKDREPGAFVIRDSHSFRGAYGLAMKVA-CPPPTIQQNKKVGDLTNELVRHFLIET----SPKGVRLKGCPNEPYFGCLSALVYQHSMTPLALPCKLMIPTKDP---------------------------NEEALELATP----TDPVVEL--------LKQEAACNVLYINSVDMESLTGPQAIAKAISQTLATSPLPAATTVHFKV-TTQGITLTDSQRKIFFRRHYPISTITYCDMDPQNRKWG------KEGGGSVKLFGFVARKQGSTTDNASHLFAELDPDQPASAIVSFVSKTLNR 981          
BLAST of tensin isoform X3 vs. Ensembl Medaka
Match: tns1b (tensin-1 [Source:NCBI gene;Acc:101155555])

HSP 1 Score: 144.436 bits (363), Expect = 2.945e-34
Identity = 100/329 (30.40%), Postives = 155/329 (47.11%), Query Frame = 3
Query: 2337 GTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENA--IRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKE 3317
            G+ +NR  ++FV +T   WY+P ++RE  I+ L+D+E G+F+IR+S +F GAYGLA+KVA+ P +    +  D   +L+RHFLI    ESS  GV+LKG PNEP +  L+ LV  H     +LP KLI+ +   I  D+V                     +S   M+                      L Q      LY+   +++ L G  A+ +AI++      P T T+     S+ GIT TD  + LF+ R +P   V   D D Q R+++ P            +   + + +    +N  HL  EL+     S I+ F+ +
Sbjct: 1437 GSLENRLNVKFVQDTSKFWYKPEISREQAISLLKDREPGAFVIRDSHSFRGAYGLAMKVATPPPSVQQSKKGDITNELVRHFLI----ESSPKGVKLKGCPNEPYFGCLSALVYQHAITPLALPCKLIIPATDLI--DEVP------------------EDTSTNPMMER--------------------LKQGAACNVLYVNSVEMESLTGPQAVAKAISETLAAAAPPTATIVHFKVSSQGITLTDNQRKLFFRRHYPTNTVTFCDTDPQDRKWNKP------EGGVAKLFGFVARKQGSTTDNVTHLFAELEPGQPASAIVNFVSK 1715          
BLAST of tensin isoform X3 vs. Ensembl Medaka
Match: tns1b (tensin-1 [Source:NCBI gene;Acc:101155555])

HSP 1 Score: 144.436 bits (363), Expect = 3.194e-34
Identity = 100/329 (30.40%), Postives = 155/329 (47.11%), Query Frame = 3
Query: 2337 GTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENA--IRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKE 3317
            G+ +NR  ++FV +T   WY+P ++RE  I+ L+D+E G+F+IR+S +F GAYGLA+KVA+ P +    +  D   +L+RHFLI    ESS  GV+LKG PNEP +  L+ LV  H     +LP KLI+ +   I  D+V                     +S   M+                      L Q      LY+   +++ L G  A+ +AI++      P T T+     S+ GIT TD  + LF+ R +P   V   D D Q R+++ P            +   + + +    +N  HL  EL+     S I+ F+ +
Sbjct: 1451 GSLENRLNVKFVQDTSKFWYKPEISREQAISLLKDREPGAFVIRDSHSFRGAYGLAMKVATPPPSVQQSKKGDITNELVRHFLI----ESSPKGVKLKGCPNEPYFGCLSALVYQHAITPLALPCKLIIPATDLI--DEVP------------------EDTSTNPMMER--------------------LKQGAACNVLYVNSVEMESLTGPQAVAKAISETLAAAAPPTATIVHFKVSSQGITLTDNQRKLFFRRHYPTNTVTFCDTDPQDRKWNKP------EGGVAKLFGFVARKQGSTTDNVTHLFAELEPGQPASAIVNFVSK 1729          
BLAST of tensin isoform X3 vs. Ensembl Medaka
Match: TNS3 (tensin-3 [Source:NCBI gene;Acc:101166465])

HSP 1 Score: 138.272 bits (347), Expect = 1.572e-32
Identity = 96/323 (29.72%), Postives = 142/323 (43.96%), Query Frame = 3
Query: 2361 LQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDL----IRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKE 3317
            ++FV +T   WY+P ++R+  I  L+DKE GSFI+R+S +F GAYGLA+KVA+ P   ++ +   GDL    +RHFLIE   +    GVRLKG PNEP + SL  LV  H     +LP +LI+  +  +               +  S    Q+ ++ A  L                      L Q       YLG  +++ L G  A+ +A         P  +TV     S  GIT TD  + LF+ R +    V+    D Q R+++              I   + +      EN  HL  E D     S I+ F+ +
Sbjct:  894 VKFVQDTSKFWYKPDISRDQAIAVLKDKEPGSFIVRDSHSFRGAYGLAMKVATPPPTVLQHSKKGGDLSNELVRHFLIECTPK----GVRLKGCPNEPYFGSLTALVCQHSITPLALPCRLILPDRDPV---------------EELSDSPAQTATNSAADL----------------------LKQGAACNVWYLGSVELESLTGHQAVQKATTVTLTMDPPPPSTVVHFKVSAQGITLTDNQRKLFFRRHYAVNTVIFCSLDPQGRKWT------RDSGSTAKIFGFVARKSQSDTENMCHLFAEHDPEQPASAIVNFVSK 1169          
BLAST of tensin isoform X3 vs. Planmine SMEST
Match: SMESG000033851.1 (SMESG000033851.1)

HSP 1 Score: 1951.41 bits (5054), Expect = 0.000e+0
Identity = 1044/1052 (99.24%), Postives = 1047/1052 (99.52%), Query Frame = 3
Query:  180 MIVTETKSQHNKEITKLGGTVYDKSGYRMDINLWFRHKNEALFYIDSVGKVHGPMDQTYSTRLGPVKKTGREIAFRSEFNEQSEKGLWKKSTEFLRTQPTEIRHEKKHFETTLKNFSTNDMTNHKKSHLTLSNHYIPSYRDTEINKYSTTITKPNKKPDQGVTVNIIAPTEKYVEKETISTTVREKRLIDELLEAREELNSLRRAKSVVDNSVVENDLKNYNNTSESFVSKVVTDVYPSMNSTEKIKRRHHSTHQENANRTDVENYQTRQTVFENHQKVEPTAIDKTFYSEIRNRHGLEKLQSGQQIPVTIQAGNRARNVVENXXXXXXXXXXXXXXXQVQRVENISGSQFSNGNTHELRGEEXXXXXXXXXXXXXXASENINTLRDSYIENINLSPETKYXXXXXXXXXQRQLETKETIIPVKSSPKFEALNPLKEVSEEIIIPEVXXXXXXXXXXXXXXXKAIDDFQKAADWEYREQSVNRGQTPQFQRNNISDTTTYNTYIQEKDSGPISSYSARKENIKTQQMMGDRNGSLRALPTERRVNEMTEEIETITLQPIGKGVQDLAPGISTLSRPGSRAATPRAYDTSRNNFFKEETRQASNYNTMPAAPKFNKYXXXXXXXXXXXXFIANSRYPSNRPRLSTGSFANARNINQVSSYDIPDSYRRVGSVGRSGQDQVVNTSWQTRTESYTNGNRNFQSALSPVSNQESMVSANYAFSGTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKENYLRRA 3335
            MIVTETKSQHNKEITKLGGTVYDKSGYRMDINLWFRHKNEALFYIDSVGKVHGPMDQTYSTRLGPV+KTGREIAFRSEFNEQSEK LWKKSTEFLRTQPTEIRHEKKHFETTLKNFSTNDMTNHKKSHLTLSNHYIPSYRDTEINKYSTTITKPNKKPDQGVTVNIIAPTEKYVEKETISTTVREKRLIDELLEAREELNSLRRAKSVVDNSVVENDLKNYNNTSESFVSKVVTDVYPSMNSTEKIKRRHHSTHQENANRTDVENYQTRQTVFENHQKVEPTAIDKTFYSEIRNRHGLEKLQSGQQIP+TIQAGNRARNVVENISYNSSSSKSIGEIS VQRVENISGSQFSNGNTHELRGEEKTVTIKRKITKRKKASENINTLRDSYIENINLSPETKYDSASDSDSDQ QLETKETIIPVKSSPKFEALNPLKEVSEEIIIPEVKKKPELSLEPPKIPIKAIDDFQKAADWEYREQSVNRGQTPQFQRNNISDTTTYNTYIQEKDSGPISSYSARKENIKTQQMMGDRNGSLRALPTERRVNEMTEEIETITLQPIGKGVQDLAPGI+TLSRPGSRAATPRAYDTSRNNFFKEETRQASNYNTMPAAPKFNKYSSSSNRSPVRESF ANSRYPSNRPRLSTGSFANARNINQVSSYDIPDSYRRVGSVGRSGQDQVVNTSWQTRTESYTNGNRNFQSALSPVSNQESMVSANYAFSGTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEP YPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQNNGLNRGRIIGIVIRKNKIILRENAVHLLCELDRSNDVSNIITFIKENYLRRA
Sbjct:    1 MIVTETKSQHNKEITKLGGTVYDKSGYRMDINLWFRHKNEALFYIDSVGKVHGPMDQTYSTRLGPVQKTGREIAFRSEFNEQSEKDLWKKSTEFLRTQPTEIRHEKKHFETTLKNFSTNDMTNHKKSHLTLSNHYIPSYRDTEINKYSTTITKPNKKPDQGVTVNIIAPTEKYVEKETISTTVREKRLIDELLEAREELNSLRRAKSVVDNSVVENDLKNYNNTSESFVSKVVTDVYPSMNSTEKIKRRHHSTHQENANRTDVENYQTRQTVFENHQKVEPTAIDKTFYSEIRNRHGLEKLQSGQQIPITIQAGNRARNVVENISYNSSSSKSIGEISPVQRVENISGSQFSNGNTHELRGEEKTVTIKRKITKRKKASENINTLRDSYIENINLSPETKYDSASDSDSDQLQLETKETIIPVKSSPKFEALNPLKEVSEEIIIPEVKKKPELSLEPPKIPIKAIDDFQKAADWEYREQSVNRGQTPQFQRNNISDTTTYNTYIQEKDSGPISSYSARKENIKTQQMMGDRNGSLRALPTERRVNEMTEEIETITLQPIGKGVQDLAPGIATLSRPGSRAATPRAYDTSRNNFFKEETRQASNYNTMPAAPKFNKYSSSSNRSPVRESFKANSRYPSNRPRLSTGSFANARNINQVSSYDIPDSYRRVGSVGRSGQDQVVNTSWQTRTESYTNGNRNFQSALSPVSNQESMVSANYAFSGTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPIYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQNNGLNRGRIIGIVIRKNKIILRENAVHLLCELDRSNDVSNIITFIKENYLRRA 1052          
BLAST of tensin isoform X3 vs. Planmine SMEST
Match: SMESG000033851.1 (SMESG000033851.1)

HSP 1 Score: 1424.84 bits (3687), Expect = 0.000e+0
Identity = 791/797 (99.25%), Postives = 793/797 (99.50%), Query Frame = 3
Query:  945 ENANRTDVENYQTRQTVFENHQKVEPTAIDKTFYSEIRNRHGLEKLQSGQQIPVTIQAGNRARNVVENXXXXXXXXXXXXXXXQVQRVENISGSQFSNGNTHELRGEEXXXXXXXXXXXXXXASENINTLRDSYIENINLSPETKYXXXXXXXXXQRQLETKETIIPVKSSPKFEALNPLKEVSEEIIIPEVXXXXXXXXXXXXXXXKAIDDFQKAADWEYREQSVNRGQTPQFQRNNISDTTTYNTYIQEKDSGPISSYSARKENIKTQQMMGDRNGSLRALPTERRVNEMTEEIETITLQPIGKGVQDLAPGISTLSRPGSRAATPRAYDTSRNNFFKEETRQASNYNTMPAAPKFNKYXXXXXXXXXXXXFIANSRYPSNRPRLSTGSFANARNINQVSSYDIPDSYRRVGSVGRSGQDQVVNTSWQTRTESYTNGNRNFQSALSPVSNQESMVSANYAFSGTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKENYLRRA 3335
            ENANRTDVENYQTRQTVFENHQKVEPTAIDKTFYSEIRNRHGLEKLQSGQQIP+TIQAGNRARNVVENISYNSSSSKSIGEIS VQRVENISGSQFSNGNTHELRGEEKTVTIKRKITKRKKASENINTLRDSYIENINLSPETKYDSASDSDSDQ QLETKETIIPVKSSPKFEALNPLKEVSEEIIIPEVKKKPELSLEPPKIPIKAIDDFQKAADWEYREQSVNRGQTPQFQRNNISDTTTYNTYIQEKDSGPISSYSARKENIKTQQMMGDRNGSLRALPTERRVNEMTEEIETITLQPIGKGVQDLAPGI+TLSRPGSRAATPRAYDTSRNNFFKEETRQASNYNTMPAAPKFNKYSSSSNRSPVRESF ANSRYPSNRPRLSTGSFANARNINQVSSYDIPDSYRRVGSVGRSGQDQVVNTSWQTRTESYTNGNRNFQSALSPVSNQESMVSANYAFSGTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEP YPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQNNGLNRGRIIGIVIRKNKIILRENAVHLLCELDRSNDVSNIITFIKENYLRRA
Sbjct:   35 ENANRTDVENYQTRQTVFENHQKVEPTAIDKTFYSEIRNRHGLEKLQSGQQIPITIQAGNRARNVVENISYNSSSSKSIGEISPVQRVENISGSQFSNGNTHELRGEEKTVTIKRKITKRKKASENINTLRDSYIENINLSPETKYDSASDSDSDQLQLETKETIIPVKSSPKFEALNPLKEVSEEIIIPEVKKKPELSLEPPKIPIKAIDDFQKAADWEYREQSVNRGQTPQFQRNNISDTTTYNTYIQEKDSGPISSYSARKENIKTQQMMGDRNGSLRALPTERRVNEMTEEIETITLQPIGKGVQDLAPGIATLSRPGSRAATPRAYDTSRNNFFKEETRQASNYNTMPAAPKFNKYSSSSNRSPVRESFKANSRYPSNRPRLSTGSFANARNINQVSSYDIPDSYRRVGSVGRSGQDQVVNTSWQTRTESYTNGNRNFQSALSPVSNQESMVSANYAFSGTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPIYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQNNGLNRGRIIGIVIRKNKIILRENAVHLLCELDRSNDVSNIITFIKENYLRRA 831          
BLAST of tensin isoform X3 vs. Planmine SMEST
Match: SMESG000033851.1 (SMESG000033851.1)

HSP 1 Score: 1373.99 bits (3555), Expect = 0.000e+0
Identity = 759/797 (95.23%), Postives = 763/797 (95.73%), Query Frame = 3
Query:  945 ENANRTDVENYQTRQTVFENHQKVEPTAIDKTFYSEIRNRHGLEKLQSGQQIPVTIQAGNRARNVVENXXXXXXXXXXXXXXXQVQRVENISGSQFSNGNTHELRGEEXXXXXXXXXXXXXXASENINTLRDSYIENINLSPETKYXXXXXXXXXQRQLETKETIIPVKSSPKFEALNPLKEVSEEIIIPEVXXXXXXXXXXXXXXXKAIDDFQKAADWEYREQSVNRGQTPQFQRNNISDTTTYNTYIQEKDSGPISSYSARKENIKTQQMMGDRNGSLRALPTERRVNEMTEEIETITLQPIGKGVQDLAPGISTLSRPGSRAATPRAYDTSRNNFFKEETRQASNYNTMPAAPKFNKYXXXXXXXXXXXXFIANSRYPSNRPRLSTGSFANARNINQVSSYDIPDSYRRVGSVGRSGQDQVVNTSWQTRTESYTNGNRNFQSALSPVSNQESMVSANYAFSGTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKENYLRRA 3335
            ENANRTDVENYQTRQTVFENHQKVEPTAIDKTFYSEIRNRHGLEKLQSGQQIP+TIQAGNRARNVVENISYNSSSSKSIGEIS VQRVENISGSQFSNGNTHELRGEEKTVTIKRKITKRKKASENINTLRDSYIENINLSPETKYDSASDSDSDQ QLETKETIIPVKSSPKFEALNPLKEVSEEIIIPEVKKKPELSLEPPKIPIKAIDDFQKAADWEYREQSVNRGQTPQFQRNNISDTTTYNTYIQEKDSGPISSYSARKENIKTQQMMGDRNGSLRALPTERRVNEMTEEIETITLQPIGKGVQDLAPGI+TLSRPGSRAATPRAYDTSRNNFFKEETRQASNYNTMPAAPKFNKY                               ++ARNINQVSSYDIPDSYRRVGSVGRSGQDQVVNTSWQTRTESYTNGNRNFQSALSPVSNQESMVSANYAFSGTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEP YPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQNNGLNRGRIIGIVIRKNKIILRENAVHLLCELDRSNDVSNIITFIKENYLRRA
Sbjct:   46 ENANRTDVENYQTRQTVFENHQKVEPTAIDKTFYSEIRNRHGLEKLQSGQQIPITIQAGNRARNVVENISYNSSSSKSIGEISPVQRVENISGSQFSNGNTHELRGEEKTVTIKRKITKRKKASENINTLRDSYIENINLSPETKYDSASDSDSDQLQLETKETIIPVKSSPKFEALNPLKEVSEEIIIPEVKKKPELSLEPPKIPIKAIDDFQKAADWEYREQSVNRGQTPQFQRNNISDTTTYNTYIQEKDSGPISSYSARKENIKTQQMMGDRNGSLRALPTERRVNEMTEEIETITLQPIGKGVQDLAPGIATLSRPGSRAATPRAYDTSRNNFFKEETRQASNYNTMPAAPKFNKY-------------------------------SSARNINQVSSYDIPDSYRRVGSVGRSGQDQVVNTSWQTRTESYTNGNRNFQSALSPVSNQESMVSANYAFSGTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPIYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQNNGLNRGRIIGIVIRKNKIILRENAVHLLCELDRSNDVSNIITFIKENYLRRA 811          
BLAST of tensin isoform X3 vs. Planmine SMEST
Match: SMESG000033851.1 (SMESG000033851.1)

HSP 1 Score: 1373.22 bits (3553), Expect = 0.000e+0
Identity = 759/797 (95.23%), Postives = 763/797 (95.73%), Query Frame = 3
Query:  945 ENANRTDVENYQTRQTVFENHQKVEPTAIDKTFYSEIRNRHGLEKLQSGQQIPVTIQAGNRARNVVENXXXXXXXXXXXXXXXQVQRVENISGSQFSNGNTHELRGEEXXXXXXXXXXXXXXASENINTLRDSYIENINLSPETKYXXXXXXXXXQRQLETKETIIPVKSSPKFEALNPLKEVSEEIIIPEVXXXXXXXXXXXXXXXKAIDDFQKAADWEYREQSVNRGQTPQFQRNNISDTTTYNTYIQEKDSGPISSYSARKENIKTQQMMGDRNGSLRALPTERRVNEMTEEIETITLQPIGKGVQDLAPGISTLSRPGSRAATPRAYDTSRNNFFKEETRQASNYNTMPAAPKFNKYXXXXXXXXXXXXFIANSRYPSNRPRLSTGSFANARNINQVSSYDIPDSYRRVGSVGRSGQDQVVNTSWQTRTESYTNGNRNFQSALSPVSNQESMVSANYAFSGTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKENYLRRA 3335
            ENANRTDVENYQTRQTVFENHQKVEPTAIDKTFYSEIRNRHGLEKLQSGQQIP+TIQAGNRARNVVENISYNSSSSKSIGEIS VQRVENISGSQFSNGNTHELRGEEKTVTIKRKITKRKKASENINTLRDSYIENINLSPETKYDSASDSDSDQ QLETKETIIPVKSSPKFEALNPLKEVSEEIIIPEVKKKPELSLEPPKIPIKAIDDFQKAADWEYREQSVNRGQTPQFQRNNISDTTTYNTYIQEKDSGPISSYSARKENIKTQQMMGDRNGSLRALPTERRVNEMTEEIETITLQPIGKGVQDLAPGI+TLSRPGSRAATPRAYDTSRNNFFKEETRQASNYNTMPAAPKFNKY                               ++ARNINQVSSYDIPDSYRRVGSVGRSGQDQVVNTSWQTRTESYTNGNRNFQSALSPVSNQESMVSANYAFSGTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEP YPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQNNGLNRGRIIGIVIRKNKIILRENAVHLLCELDRSNDVSNIITFIKENYLRRA
Sbjct:   35 ENANRTDVENYQTRQTVFENHQKVEPTAIDKTFYSEIRNRHGLEKLQSGQQIPITIQAGNRARNVVENISYNSSSSKSIGEISPVQRVENISGSQFSNGNTHELRGEEKTVTIKRKITKRKKASENINTLRDSYIENINLSPETKYDSASDSDSDQLQLETKETIIPVKSSPKFEALNPLKEVSEEIIIPEVKKKPELSLEPPKIPIKAIDDFQKAADWEYREQSVNRGQTPQFQRNNISDTTTYNTYIQEKDSGPISSYSARKENIKTQQMMGDRNGSLRALPTERRVNEMTEEIETITLQPIGKGVQDLAPGIATLSRPGSRAATPRAYDTSRNNFFKEETRQASNYNTMPAAPKFNKY-------------------------------SSARNINQVSSYDIPDSYRRVGSVGRSGQDQVVNTSWQTRTESYTNGNRNFQSALSPVSNQESMVSANYAFSGTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPIYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQNNGLNRGRIIGIVIRKNKIILRENAVHLLCELDRSNDVSNIITFIKENYLRRA 800          
BLAST of tensin isoform X3 vs. Planmine SMEST
Match: SMESG000033851.1 (SMESG000033851.1)

HSP 1 Score: 1307.74 bits (3383), Expect = 0.000e+0
Identity = 734/741 (99.06%), Postives = 736/741 (99.33%), Query Frame = 3
Query: 1113 QAGNRARNVVENXXXXXXXXXXXXXXXQVQRVENISGSQFSNGNTHELRGEEXXXXXXXXXXXXXXASENINTLRDSYIENINLSPETKYXXXXXXXXXQRQLETKETIIPVKSSPKFEALNPLKEVSEEIIIPEVXXXXXXXXXXXXXXXKAIDDFQKAADWEYREQSVNRGQTPQFQRNNISDTTTYNTYIQEKDSGPISSYSARKENIKTQQMMGDRNGSLRALPTERRVNEMTEEIETITLQPIGKGVQDLAPGISTLSRPGSRAATPRAYDTSRNNFFKEETRQASNYNTMPAAPKFNKYXXXXXXXXXXXXFIANSRYPSNRPRLSTGSFANARNINQVSSYDIPDSYRRVGSVGRSGQDQVVNTSWQTRTESYTNGNRNFQSALSPVSNQESMVSANYAFSGTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQXXXXXXXXXXXXXXXXXXXXXRENAVHLLCELDRSNDVSNIITFIKENYLRRA 3335
            + GNRARNVVENISYNSSSSKSIGEIS VQRVENISGSQFSNGNTHELRGEEKTVTIKRKITKRKKASENINTLRDSYIENINLSPETKYDSASDSDSDQ QLETKETIIPVKSSPKFEALNPLKEVSEEIIIPEVKKKPELSLEPPKIPIKAIDDFQKAADWEYREQSVNRGQTPQFQRNNISDTTTYNTYIQEKDSGPISSYSARKENIKTQQMMGDRNGSLRALPTERRVNEMTEEIETITLQPIGKGVQDLAPGI+TLSRPGSRAATPRAYDTSRNNFFKEETRQASNYNTMPAAPKFNKYSSSSNRSPVRESF ANSRYPSNRPRLSTGSFANARNINQVSSYDIPDSYRRVGSVGRSGQDQVVNTSWQTRTESYTNGNRNFQSALSPVSNQESMVSANYAFSGTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEP YPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQNNGLNRGRIIGIVIRKNKIILRENAVHLLCELDRSNDVSNIITFIKENYLRRA
Sbjct:    4 KTGNRARNVVENISYNSSSSKSIGEISPVQRVENISGSQFSNGNTHELRGEEKTVTIKRKITKRKKASENINTLRDSYIENINLSPETKYDSASDSDSDQLQLETKETIIPVKSSPKFEALNPLKEVSEEIIIPEVKKKPELSLEPPKIPIKAIDDFQKAADWEYREQSVNRGQTPQFQRNNISDTTTYNTYIQEKDSGPISSYSARKENIKTQQMMGDRNGSLRALPTERRVNEMTEEIETITLQPIGKGVQDLAPGIATLSRPGSRAATPRAYDTSRNNFFKEETRQASNYNTMPAAPKFNKYSSSSNRSPVRESFKANSRYPSNRPRLSTGSFANARNINQVSSYDIPDSYRRVGSVGRSGQDQVVNTSWQTRTESYTNGNRNFQSALSPVSNQESMVSANYAFSGTEDNRYPLQFVLNTEDLWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPIYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQNNGLNRGRIIGIVIRKNKIILRENAVHLLCELDRSNDVSNIITFIKENYLRRA 744          
The following BLAST results are available for this feature:
BLAST of tensin isoform X3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TNS13.975e-3730.93tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973][more]
TNS11.191e-3630.93tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973][more]
TNS13.187e-3631.02tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973][more]
TNS13.187e-3631.02tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973][more]
TNS13.768e-3630.93tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973][more]
back to top
BLAST of tensin isoform X3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tns-11.142e-3229.66TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L04... [more]
tns-11.093e-3129.66TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L04... [more]
tns-11.093e-3129.66TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L04... [more]
tns-11.920e-3129.85TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L04... [more]
tns-11.284e-3029.85TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L04... [more]
back to top
BLAST of tensin isoform X3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
by1.448e-2325.87gene:FBgn0000244 transcript:FBtr0302382[more]
by1.448e-2325.87gene:FBgn0000244 transcript:FBtr0082119[more]
by1.448e-2325.87gene:FBgn0000244 transcript:FBtr0301093[more]
back to top
BLAST of tensin isoform X3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tns1b1.452e-3831.42tensin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-6933][more]
tns1a2.708e-3830.86tensin 1a [Source:ZFIN;Acc:ZDB-GENE-120215-32][more]
tns1a3.165e-3830.86tensin 1a [Source:ZFIN;Acc:ZDB-GENE-120215-32][more]
tns3.29.237e-3831.00tensin 3, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-... [more]
tns1b2.330e-3629.91tensin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-6933][more]
back to top
BLAST of tensin isoform X3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TNS32.919e-3228.96tensin 3 [Source:NCBI gene;Acc:100492216][more]
TNS33.731e-3228.96tensin 3 [Source:NCBI gene;Acc:100492216][more]
TNS34.298e-3229.14tensin 3 [Source:NCBI gene;Acc:100492216][more]
TNS34.354e-3228.96tensin 3 [Source:NCBI gene;Acc:100492216][more]
TNS35.953e-3228.79tensin 3 [Source:NCBI gene;Acc:100492216][more]
back to top
BLAST of tensin isoform X3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tns14.580e-3830.00tensin 1 [Source:MGI Symbol;Acc:MGI:104552][more]
Tns12.740e-3630.00tensin 1 [Source:MGI Symbol;Acc:MGI:104552][more]
Tns12.875e-3630.00tensin 1 [Source:MGI Symbol;Acc:MGI:104552][more]
Tns12.894e-3630.00tensin 1 [Source:MGI Symbol;Acc:MGI:104552][more]
Tns12.950e-3630.00tensin 1 [Source:MGI Symbol;Acc:MGI:104552][more]
back to top
BLAST of tensin isoform X3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9GLM4|TENS1_BOVIN4.087e-3630.93Tensin-1 OS=Bos taurus OX=9913 GN=TNS1 PE=2 SV=1[more]
sp|Q9HBL0|TENS1_HUMAN2.071e-3530.93Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2[more]
sp|Q04205|TENS_CHICK6.117e-3429.88Tensin OS=Gallus gallus OX=9031 GN=TNS PE=1 SV=2[more]
sp|Q68CZ2|TENS3_HUMAN7.411e-3229.72Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2[more]
sp|Q8CGB6|TNS2_MOUSE1.116e-3131.21Tensin-2 OS=Mus musculus OX=10090 GN=Tns2 PE=1 SV=... [more]
back to top
BLAST of tensin isoform X3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A060YE751.964e-3731.01SH2 domain-containing protein OS=Oncorhynchus myki... [more]
A0A1S3QDI34.707e-3631.58tensin-like isoform X6 OS=Salmo salar OX=8030 GN=L... [more]
A0A1S3MY105.262e-3631.58tensin-like isoform X7 OS=Salmo salar OX=8030 GN=L... [more]
A0A1S3QDG65.330e-3631.58tensin-like isoform X3 OS=Salmo salar OX=8030 GN=L... [more]
A0A1S3QF465.606e-3631.58tensin-like isoform X7 OS=Salmo salar OX=8030 GN=L... [more]
back to top
BLAST of tensin isoform X3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TNS31.158e-3631.40tensin-3 [Source:NCBI gene;Acc:103027377][more]
tns1b4.706e-3629.70tensin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-6933][more]
ENSAMXT00000013817.23.728e-3428.66pep primary_assembly:Astyanax_mexicanus-2.0:13:818... [more]
ENSAMXT00000049936.17.205e-3428.36pep primary_assembly:Astyanax_mexicanus-2.0:13:818... [more]
tns2a5.276e-3232.42tensin 2 [Source:NCBI gene;Acc:103022390][more]
back to top
BLAST of tensin isoform X3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
TNS14.399e-3931.63tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973][more]
ENSPMAT00000003653.15.568e-3228.22pep scaffold:Pmarinus_7.0:GL476944:428913:445548:-... [more]
ENSPMAT00000005743.12.823e-2929.18pep scaffold:Pmarinus_7.0:GL478791:187748:191319:1... [more]
ENSPMAT00000001958.18.401e-2931.13pep scaffold:Pmarinus_7.0:GL480048:14054:23824:1 g... [more]
back to top
BLAST of tensin isoform X3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tensin isoform X3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO457834.942e-2829.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of tensin isoform X3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000002849.27.617e-3831.53pep primary_assembly:ASM223467v1:2:14075704:140850... [more]
ENSORLT00000002851.22.761e-3731.53pep primary_assembly:ASM223467v1:2:14075704:140871... [more]
tns1b2.945e-3430.40tensin-1 [Source:NCBI gene;Acc:101155555][more]
tns1b3.194e-3430.40tensin-1 [Source:NCBI gene;Acc:101155555][more]
TNS31.572e-3229.72tensin-3 [Source:NCBI gene;Acc:101166465][more]
back to top
BLAST of tensin isoform X3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033851.10.000e+099.24SMESG000033851.1[more]
SMESG000033851.10.000e+099.25SMESG000033851.1[more]
SMESG000033851.10.000e+095.23SMESG000033851.1[more]
SMESG000033851.10.000e+095.23SMESG000033851.1[more]
SMESG000033851.10.000e+099.06SMESG000033851.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020213 ID=SMED30020213|Name=tensin isoform X3|organism=Schmidtea mediterranea sexual|type=transcript|length=3767bp
CGATCTTTTTTTTTAATTTCGAGAAGTATTAGCATTATTAATCGTCAACG
AATCTTTGAAAAATCGATTTTCAATAGTTTATATTTGGATTTATTCACGA
GAAATTATTTATTAATTTATTTAAACTTGTAATTTATTTGAAAATTCTGA
GAAAAAAAATCAGAAAAAAAATTAGCAACATGATTGTCACAGAAACTAAA
TCTCAACATAATAAAGAAATAACGAAACTTGGTGGAACCGTTTATGATAA
ATCCGGTTATCGCATGGATATAAATCTTTGGTTTCGCCATAAAAATGAAG
CACTTTTTTACATCGACAGTGTTGGTAAAGTCCATGGACCAATGGATCAA
ACGTATTCTACAAGACTTGGGCCAGTTAAGAAGACCGGAAGGGAAATTGC
TTTTAGAAGTGAATTTAATGAACAAAGTGAAAAGGGCCTATGGAAAAAAT
CGACAGAATTTCTCCGAACTCAACCAACAGAAATTCGTCACGAAAAAAAA
CATTTTGAAACAACTTTGAAAAATTTTTCCACCAACGACATGACAAACCA
TAAGAAAAGCCACCTGACATTAAGCAATCATTATATCCCAAGCTATAGAG
ATACAGAAATTAATAAATATTCCACAACTATTACCAAGCCGAATAAAAAA
CCAGATCAAGGAGTTACTGTAAATATTATTGCACCGACTGAAAAATATGT
TGAAAAGGAGACAATATCAACAACAGTTAGAGAGAAACGTCTCATTGATG
AATTACTCGAAGCCCGGGAAGAATTAAATTCTTTGAGACGAGCGAAAAGT
GTTGTTGACAACAGTGTTGTTGAAAACGATTTGAAAAATTATAATAACAC
AAGTGAATCGTTTGTCAGTAAAGTCGTAACGGATGTTTATCCGTCAATGA
ATTCTACGGAAAAAATCAAACGACGACATCACTCAACTCATCAAGAAAAT
GCGAATAGGACCGACGTAGAGAATTATCAAACCAGGCAGACAGTTTTCGA
GAATCATCAGAAAGTCGAACCGACAGCCATTGATAAAACATTTTACAGTG
AAATAAGAAATCGACATGGATTGGAAAAGTTACAATCGGGTCAACAAATT
CCAGTAACAATTCAAGCGGGAAATCGGGCGAGAAATGTTGTAGAAAATAT
CTCTTACAATTCTTCGAGTAGCAAGTCTATTGGAGAAATTTCGCAGGTTC
AAAGAGTGGAAAACATATCGGGATCGCAATTCAGTAATGGTAACACTCAT
GAGTTACGCGGCGAAGAGAAAACTGTGACAATAAAAAGAAAAATTACGAA
ACGAAAAAAAGCCTCAGAAAATATTAATACTCTCCGAGATTCATACATCG
AAAATATAAATTTATCTCCAGAAACAAAATATGATTCAGCAAGTGATTCT
GATAGCGATCAGCGTCAACTCGAAACAAAAGAAACGATAATTCCAGTAAA
ATCTTCTCCGAAATTTGAAGCACTTAACCCTCTAAAAGAAGTGTCTGAAG
AAATTATTATACCGGAAGTTAAAAAGAAACCTGAATTGTCTTTAGAGCCT
CCTAAGATTCCAATTAAAGCAATTGACGATTTTCAAAAGGCCGCCGACTG
GGAATATAGAGAGCAGTCTGTCAATCGAGGCCAAACACCCCAATTCCAAC
GCAATAACATATCTGACACCACAACATACAATACATACATTCAAGAAAAG
GATTCTGGACCAATTTCAAGCTATTCGGCGAGAAAAGAAAATATAAAAAC
TCAACAAATGATGGGTGATCGAAATGGAAGTTTAAGAGCACTTCCTACAG
AAAGACGCGTCAATGAAATGACCGAAGAAATTGAAACGATTACCTTACAA
CCAATTGGAAAAGGGGTTCAGGATTTAGCGCCAGGTATTTCTACTTTAAG
TAGGCCTGGAAGTCGTGCTGCTACACCTAGAGCTTATGACACATCAAGAA
ATAATTTCTTTAAGGAAGAAACCAGACAGGCATCAAACTATAATACTATG
CCCGCAGCACCTAAATTCAACAAATACAGCAGTTCCAGTAATAGGTCTCC
AGTTAGAGAATCATTTATAGCAAATAGCCGTTACCCTTCAAATCGGCCAA
GGCTATCAACTGGTAGCTTCGCCAATGCCAGAAATATCAACCAAGTTTCA
AGTTATGACATACCTGATTCGTACAGAAGAGTTGGATCAGTTGGCAGATC
TGGACAGGATCAGGTTGTCAATACTTCATGGCAAACAAGAACGGAATCAT
ATACTAATGGAAATAGAAATTTCCAATCGGCTTTATCACCTGTATCAAAT
CAGGAAAGCATGGTAAGTGCTAACTATGCCTTTTCTGGGACTGAAGACAA
TAGATATCCGTTGCAATTTGTGCTCAATACCGAAGATCTTTGGTATCAAC
CTCATTTAAATCGAGAAGATGTAATCAATGCATTACGAGATAAAGAAACT
GGAAGTTTTATTATAAGAAATAGTTCAACATTTGTTGGGGCTTACGGATT
AGCCCTTAAAGTAGCATCACTTCCAGAAAATGCTATTAGAACAAATGATT
CACAAGGCGATCTCATACGCCATTTTCTAATTGAAACGGTTGAAGAATCT
TCAGGATCAGGGGTAAGGTTGAAAGGACTCCCCAATGAACCAACTTATCC
CTCTCTTGCTCATTTGGTTCAAGATCATTGTCAAAACGCTAGATCTTTAC
CAACAAAATTAATAGTTTCATCTCAGTCCTCAATTAGATTAGATCAAGTC
GATGGTGGCGGTATGGCACAATCGCATTATCAATATGAATCTCAACAAAA
ACACCAAAGCGGATCAAGTCGGGCTCAAATGCTATCAACTGCCCATAGGT
CCATGAGTTCTCCCGGAGTGAATTTCATTGACAGTAATCATCCGAATCCA
TTGCATCAGTGTTTAGTGACAACTGCTTTATATTTGGGGAAATTTGACGT
TGATAGATTGGAAGGAAAAGCCGCGATTGATCAAGCTATCAACAAATTGT
TTGGTAAAAAGAATCCGAAAACCACCACGGTAGAAATAAGACTTGACTCA
ACAAATGGCATAACTTTTACTGATAAAGTCCAGCTTTTGTTCTATACAAG
ACAATTCCCTGCTCAGCACGTTTTGTCAGCCGATTATGATTCACAATTAC
GAGAATTCAGCTCACCGATATTGCAAAATAATGGACTCAACAGAGGAAGA
ATAATTGGTATTGTTATTCGCAAGAACAAAATTATTCTACGAGAAAATGC
GGTCCATTTATTGTGTGAACTTGACAGGTCCAACGATGTCAGTAATATTA
TTACATTTATCAAAGAAAATTATTTGCGGAGAGCTTGACCGAGAAAACTT
ATTTCAAACCTACCGATAATTATTATAATTTATTATTATTTTTATTTTAT
GTTCAAATTTAATTATTTATTATTTTATTGCTTACCAAGATTGAGTGTAT
GAGGAAATTTGAGATTTACAATTAATGTTGTGATATAGAATTATGATGTA
ATAATATTATGTAATTATCCGAGACTATTTATGATAAATAGCGGTTTCGT
TTTCATTTCGGGAGTTTCATAATTCATTCTTATTGAGTTGTCAAAGAAAT
TATTATTGAGTCCTCGAGAAAATTTGTTCTGTAGTTTTTAACAGTTGAAA
TTTTAACAGTTCGCTGGAATAAACAGTTTTTTAGAAAAATCTACTTTTAT
TTTCAAATTTTGATGCATGTGAAATTTATTGGAATTAGTAATAAAATATA
TGGCGATTAAAAAAAAA
back to top

protein sequence of SMED30020213-orf-1

>SMED30020213-orf-1 ID=SMED30020213-orf-1|Name=SMED30020213-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1053bp
MIVTETKSQHNKEITKLGGTVYDKSGYRMDINLWFRHKNEALFYIDSVGK
VHGPMDQTYSTRLGPVKKTGREIAFRSEFNEQSEKGLWKKSTEFLRTQPT
EIRHEKKHFETTLKNFSTNDMTNHKKSHLTLSNHYIPSYRDTEINKYSTT
ITKPNKKPDQGVTVNIIAPTEKYVEKETISTTVREKRLIDELLEAREELN
SLRRAKSVVDNSVVENDLKNYNNTSESFVSKVVTDVYPSMNSTEKIKRRH
HSTHQENANRTDVENYQTRQTVFENHQKVEPTAIDKTFYSEIRNRHGLEK
LQSGQQIPVTIQAGNRARNVVENISYNSSSSKSIGEISQVQRVENISGSQ
FSNGNTHELRGEEKTVTIKRKITKRKKASENINTLRDSYIENINLSPETK
YDSASDSDSDQRQLETKETIIPVKSSPKFEALNPLKEVSEEIIIPEVKKK
PELSLEPPKIPIKAIDDFQKAADWEYREQSVNRGQTPQFQRNNISDTTTY
NTYIQEKDSGPISSYSARKENIKTQQMMGDRNGSLRALPTERRVNEMTEE
IETITLQPIGKGVQDLAPGISTLSRPGSRAATPRAYDTSRNNFFKEETRQ
ASNYNTMPAAPKFNKYSSSSNRSPVRESFIANSRYPSNRPRLSTGSFANA
RNINQVSSYDIPDSYRRVGSVGRSGQDQVVNTSWQTRTESYTNGNRNFQS
ALSPVSNQESMVSANYAFSGTEDNRYPLQFVLNTEDLWYQPHLNREDVIN
ALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDLIRHFL
IETVEESSGSGVRLKGLPNEPTYPSLAHLVQDHCQNARSLPTKLIVSSQS
SIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFI
DSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTT
VEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQN
NGLNRGRIIGIVIRKNKIILRENAVHLLCELDRSNDVSNIITFIKENYLR
RA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004725protein tyrosine phosphatase activity
GO:0005515protein binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0016311dephosphorylation
GO:0035335peptidyl-tyrosine dephosphorylation
GO:0035556intracellular signal transduction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036860SH2_dom_sf
IPR000980SH2
IPR013625PTB
IPR011993PH-like_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 185..205
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 869..888
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 584..646
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 575..646
NoneNo IPR availablePANTHERPTHR45734FAMILY NOT NAMEDcoord: 161..1045
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 907..1048
IPR000980SH2 domainSMARTSM00252SH2_5coord: 736..839
e-value: 4.4E-15
score: 66.1
IPR000980SH2 domainPFAMPF00017SH2coord: 738..832
e-value: 2.2E-6
score: 27.7
IPR000980SH2 domainPROSITEPS50001SH2coord: 738..848
score: 14.557
IPR036860SH2 domain superfamilyGENE3DG3DSA:3.30.505.10coord: 734..845
e-value: 9.5E-27
score: 95.5
IPR036860SH2 domain superfamilySUPERFAMILYSSF55550SH2 domaincoord: 735..845
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 902..1052
e-value: 1.1E-23
score: 85.4
IPR013625Tensin/EPS8 phosphotyrosine-binding domainPFAMPF08416PTBcoord: 917..1046
e-value: 2.3E-7
score: 31.0