Synaptotagmin, putative

Overview
NameSynaptotagmin, putative
Smed IDSMED30020209
Length (bp)1588
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Synaptotagmin, putative (SMED30020209) t-SNE clustered cells

Violin plots show distribution of expression levels for Synaptotagmin, putative (SMED30020209) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Synaptotagmin, putative (SMED30020209) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Synaptotagmin, putative (SMED30020209) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020209

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30020209SMESG000021478.1 SmedASXL_008342SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30020209SMESG000021478.1 dd_Smed_v4_6920_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020209SMESG000021478.1 dd_Smed_v4_6920_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30020209SMESG000021478.1 dd_Smed_v4_6920_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30020209SMESG000021478.1 dd_Smed_v4_6920_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30020209SMESG000021478.1 dd_Smed_v4_6920_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020209SMESG000021478.1 SMESG000000587.1 Contig18940newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020209SMESG000021478.1 SMESG000000587.1 Contig18940uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020209SMESG000021478.1 Contig13409newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020209SMESG000021478.1 Contig13409uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30020209SMESG000021478.1 dd_Smed_v6_6920_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neuronSMED30020209SMESG000021478.1 Contig13409newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30020209SMESG000021478.1 Contig13409uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Synaptotagmin, putative vs. Ensembl Human
Match: SYT1 (synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509])

HSP 1 Score: 337.806 bits (865), Expect = 5.833e-111
Identity = 189/260 (72.69%), Postives = 220/260 (84.62%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKEN--KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            F   +L VGI+QA ELPALDM GTSDPYVKVFL PDKKKKFETKVHRKTLNPVF+E F FKVP+SE+  KTL + +YDFDRFSKHD IG+ ++P+ ++D   V +EW++L+    SAEKE   KLGDICFSLRYVPT GKLTVV+LEAKNLKKMDVGGLSDPYVKI LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQ++ ++VTV+DYD+IG ++ IG+V +G N++G  LR WSDMLANPRRPIAQW TLQ
Sbjct:  151 FQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQ----SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 406          

HSP 2 Score: 75.8702 bits (185), Expect = 4.526e-14
Identity = 44/123 (35.77%), Postives = 70/123 (56.91%), Query Frame = 1
Query:  988 LGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNAS--GTALRQWSDM 1350
            LG + +SL Y   N +L V +++A  L  +D+GG SDPYVK+ L+ + K+  + K   K  TLNP +NE F+F+VP+ ++    L++ V D+DR    + IG   +  N    G    +W D+
Sbjct:  140 LGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRK--TLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDL 260          
BLAST of Synaptotagmin, putative vs. Ensembl Human
Match: SYT1 (synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509])

HSP 1 Score: 337.806 bits (865), Expect = 5.948e-111
Identity = 189/260 (72.69%), Postives = 220/260 (84.62%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKEN--KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            F   +L VGI+QA ELPALDM GTSDPYVKVFL PDKKKKFETKVHRKTLNPVF+E F FKVP+SE+  KTL + +YDFDRFSKHD IG+ ++P+ ++D   V +EW++L+    SAEKE   KLGDICFSLRYVPT GKLTVV+LEAKNLKKMDVGGLSDPYVKI LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQ++ ++VTV+DYD+IG ++ IG+V +G N++G  LR WSDMLANPRRPIAQW TLQ
Sbjct:  154 FQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQ----SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 409          

HSP 2 Score: 75.8702 bits (185), Expect = 4.472e-14
Identity = 44/123 (35.77%), Postives = 70/123 (56.91%), Query Frame = 1
Query:  988 LGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNAS--GTALRQWSDM 1350
            LG + +SL Y   N +L V +++A  L  +D+GG SDPYVK+ L+ + K+  + K   K  TLNP +NE F+F+VP+ ++    L++ V D+DR    + IG   +  N    G    +W D+
Sbjct:  143 LGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRK--TLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDL 263          
BLAST of Synaptotagmin, putative vs. Ensembl Human
Match: SYT1 (synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509])

HSP 1 Score: 337.806 bits (865), Expect = 5.948e-111
Identity = 189/260 (72.69%), Postives = 220/260 (84.62%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKEN--KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            F   +L VGI+QA ELPALDM GTSDPYVKVFL PDKKKKFETKVHRKTLNPVF+E F FKVP+SE+  KTL + +YDFDRFSKHD IG+ ++P+ ++D   V +EW++L+    SAEKE   KLGDICFSLRYVPT GKLTVV+LEAKNLKKMDVGGLSDPYVKI LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQ++ ++VTV+DYD+IG ++ IG+V +G N++G  LR WSDMLANPRRPIAQW TLQ
Sbjct:  154 FQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQ----SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 409          

HSP 2 Score: 75.8702 bits (185), Expect = 4.472e-14
Identity = 44/123 (35.77%), Postives = 70/123 (56.91%), Query Frame = 1
Query:  988 LGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNAS--GTALRQWSDM 1350
            LG + +SL Y   N +L V +++A  L  +D+GG SDPYVK+ L+ + K+  + K   K  TLNP +NE F+F+VP+ ++    L++ V D+DR    + IG   +  N    G    +W D+
Sbjct:  143 LGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRK--TLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDL 263          
BLAST of Synaptotagmin, putative vs. Ensembl Human
Match: SYT1 (synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509])

HSP 1 Score: 337.806 bits (865), Expect = 5.948e-111
Identity = 189/260 (72.69%), Postives = 220/260 (84.62%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKEN--KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            F   +L VGI+QA ELPALDM GTSDPYVKVFL PDKKKKFETKVHRKTLNPVF+E F FKVP+SE+  KTL + +YDFDRFSKHD IG+ ++P+ ++D   V +EW++L+    SAEKE   KLGDICFSLRYVPT GKLTVV+LEAKNLKKMDVGGLSDPYVKI LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQ++ ++VTV+DYD+IG ++ IG+V +G N++G  LR WSDMLANPRRPIAQW TLQ
Sbjct:  154 FQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQ----SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 409          

HSP 2 Score: 75.8702 bits (185), Expect = 4.472e-14
Identity = 44/123 (35.77%), Postives = 70/123 (56.91%), Query Frame = 1
Query:  988 LGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNAS--GTALRQWSDM 1350
            LG + +SL Y   N +L V +++A  L  +D+GG SDPYVK+ L+ + K+  + K   K  TLNP +NE F+F+VP+ ++    L++ V D+DR    + IG   +  N    G    +W D+
Sbjct:  143 LGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRK--TLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDL 263          
BLAST of Synaptotagmin, putative vs. Ensembl Human
Match: SYT2 (synaptotagmin 2 [Source:HGNC Symbol;Acc:HGNC:11510])

HSP 1 Score: 331.643 bits (849), Expect = 1.316e-108
Identity = 179/258 (69.38%), Postives = 219/258 (84.88%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            F   +LTVG+LQA ELPALDM GTSDPYVKVFL PDKKKK+ETKVHRKTLNP F+E F FKVP+ E+  KTL + IYDFDRFSKHD IG++++P+ ++DL Q ++EW++L+  +   E+  KLGDIC SLRYVPT GKLTV +LEAKNLKKMDVGGLSDPYVKI LM NGKR+KKKKTT+KK TLNPY+NESFSFE+PFEQIQ++ ++VTV+DYD++G +E IG++ +G NA+GT LR WSDMLANPRRPIAQW +L+
Sbjct:  151 FQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGE--KEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLK 406          

HSP 2 Score: 81.6481 bits (200), Expect = 6.174e-16
Identity = 47/123 (38.21%), Postives = 76/123 (61.79%), Query Frame = 1
Query:  988 LGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNAS--GTALRQWSDM 1350
            LG + FSL Y     +LTV VL+A  L  +D+GG SDPYVK+ L+ +  + KK +T + + TLNP +NE+F+F+VP++++    L++ + D+DR    + IG V +  N    G  + +W D+
Sbjct:  140 LGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPD--KKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDL 260          
BLAST of Synaptotagmin, putative vs. Ensembl Celegans
Match: snt-1 (Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:P34693])

HSP 1 Score: 358.607 bits (919), Expect = 3.267e-119
Identity = 187/263 (71.10%), Postives = 226/263 (85.93%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPEK 1410
            F +G+LTV ++QA++LP +DM+GTSDPYVK++L P+KKKK ETKVHRKTLNPVF+E F+FKV F+EIT+KTL   IYDFDRFSKHDQIGQ+ IPLG IDL  V++EWK++ P  D  E E  LGDICFSLRYVPT GKLTVV+LEAKNLKKMDVGGLSDPYVKI LM  GKR+KKKKT+IKKCTLNPYYNESFSFEVPFEQIQ+++L++TV+DYD++G+++ IGR +LGCN +G  LR W DMLA+PRRPIAQW TL  + E+
Sbjct:  171 FQQGQLTVTVIQAEDLPGMDMSGTSDPYVKLYLLPEKKKKVETKVHRKTLNPVFNETFIFKVAFNEITAKTLVFAIYDFDRFSKHDQIGQVLIPLGKIDLGAVIEEWKDIAPPPDDKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIVLMQGGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKVSLMITVMDYDKLGSNDAIGRCLLGCNGTGAELRHWMDMLASPRRPIAQWHTLGPVEEE 433          

HSP 2 Score: 80.8777 bits (198), Expect = 4.627e-16
Identity = 49/127 (38.58%), Postives = 73/127 (57.48%), Query Frame = 1
Query:  988 LGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVV--LGCNASGTALRQWSDMLANP 1362
            LG I + L Y    G+LTV V++A++L  MD+ G SDPYVK+ L+   K+  + K   K  TLNP +NE+F F+V F +I    L+  + D+DR    + IG+V+  LG    G  + +W D+   P
Sbjct:  160 LGRIQYKLDYDFQQGQLTVTVIQAEDLPGMDMSGTSDPYVKLYLLPEKKKKVETKVHRK--TLNPVFNETFIFKVAFNEITAKTLVFAIYDFDRFSKHDQIGQVLIPLGKIDLGAVIEEWKDIAPPP 284          
BLAST of Synaptotagmin, putative vs. Ensembl Celegans
Match: snt-1 (Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:P34693])

HSP 1 Score: 323.553 bits (828), Expect = 1.766e-105
Identity = 172/265 (64.91%), Postives = 220/265 (83.02%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLM-MNGXXXXXXXXXXXXCTLNPYYNESFSFE-VPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPEK 1410
            F +G+LTV ++QA++LP +DM+GTSDPYVK++L P+KKKK ETKVHRKTLNPVF+E F+FKV F+EIT+KTL   IYDFDRFSKHDQIGQ+ IPLG IDL  V++EWK++ P  D  E E  LGDICFSLRYVPT GKLTVV+LEAKNLKKMDVGGLSDPYVK+ +   + KR+KKKKT IK+ TLNPY+NESF F+ +P  ++++++L++TV+DYD++G+++ IGR +LGCN +G  LR W DMLA+PRRPIAQW TL  + E+
Sbjct:  171 FQQGQLTVTVIQAEDLPGMDMSGTSDPYVKLYLLPEKKKKVETKVHRKTLNPVFNETFIFKVAFNEITAKTLVFAIYDFDRFSKHDQIGQVLIPLGKIDLGAVIEEWKDIAPPPDDKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKLEMFGEDRKRLKKKKTNIKRKTLNPYFNESFVFDKLPLHKMKKVSLMITVMDYDKLGSNDAIGRCLLGCNGTGAELRHWMDMLASPRRPIAQWHTLGPVEEE 435          

HSP 2 Score: 81.2629 bits (199), Expect = 3.636e-16
Identity = 49/127 (38.58%), Postives = 73/127 (57.48%), Query Frame = 1
Query:  988 LGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVV--LGCNASGTALRQWSDMLANP 1362
            LG I + L Y    G+LTV V++A++L  MD+ G SDPYVK+ L+   K+  + K   K  TLNP +NE+F F+V F +I    L+  + D+DR    + IG+V+  LG    G  + +W D+   P
Sbjct:  160 LGRIQYKLDYDFQQGQLTVTVIQAEDLPGMDMSGTSDPYVKLYLLPEKKKKVETKVHRK--TLNPVFNETFIFKVAFNEITAKTLVFAIYDFDRFSKHDQIGQVLIPLGKIDLGAVIEEWKDIAPPP 284          
BLAST of Synaptotagmin, putative vs. Ensembl Celegans
Match: snt-3 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5])

HSP 1 Score: 289.656 bits (740), Expect = 1.551e-94
Identity = 162/257 (63.04%), Postives = 205/257 (79.77%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTL 1392
            F K  LTV I+QA+ELPA+D+ GTSDPYVK+FL PDKKKK +TKV RK+LNPVF+E F FK+PF+EI  +TL L+++DFDRF KHDQIGQ+ IPLG +DL   ++    +E     +  EN+LG++C +LRYVP   KL+VVV+E KNLKKMDV GLSDPYVKI LMM  KR++KKKTTIK  TLNPYYNESFSF+V  E++QR++L VTV DYDR+G++E IG+V++G  A+G AL+QW+DMLA PRR +AQW TL
Sbjct:   27 FDKNSLTVVIIQAEELPAMDLGGTSDPYVKLFLLPDKKKKLQTKVQRKSLNPVFNESFTFKIPFNEIGGQTLVLNVFDFDRFGKHDQIGQISIPLGKVDLAATLERTDLIE-----SPPENRLGEVCLALRYVPNKNKLSVVVMECKNLKKMDVLGLSDPYVKIYLMMGTKRLEKKKTTIKMKTLNPYYNESFSFDVTSEKMQRVHLHVTVSDYDRVGSNERIGQVIIGTCATGVALKQWNDMLATPRRSVAQWHTL 278          

HSP 2 Score: 79.337 bits (194), Expect = 3.242e-16
Identity = 46/126 (36.51%), Postives = 76/126 (60.32%), Query Frame = 1
Query:  988 LGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCN-ASGTALRQWSDMLANP 1362
            LG + + L Y      LTVV+++A+ L  MD+GG SDPYVK+ L+ + K+  + K   K  +LNP +NESF+F++PF +I    L++ V D+DR G  + IG++ +        A  + +D++ +P
Sbjct:   16 LGRLQYKLDYDFDKNSLTVVIIQAEELPAMDLGGTSDPYVKLFLLPDKKKKLQTKVQRK--SLNPVFNESFTFKIPFNEIGGQTLVLNVFDFDRFGKHDQIGQISIPLGKVDLAATLERTDLIESP 139          
BLAST of Synaptotagmin, putative vs. Ensembl Celegans
Match: snt-3 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5])

HSP 1 Score: 289.656 bits (740), Expect = 1.551e-94
Identity = 162/257 (63.04%), Postives = 205/257 (79.77%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTL 1392
            F K  LTV I+QA+ELPA+D+ GTSDPYVK+FL PDKKKK +TKV RK+LNPVF+E F FK+PF+EI  +TL L+++DFDRF KHDQIGQ+ IPLG +DL   ++    +E     +  EN+LG++C +LRYVP   KL+VVV+E KNLKKMDV GLSDPYVKI LMM  KR++KKKTTIK  TLNPYYNESFSF+V  E++QR++L VTV DYDR+G++E IG+V++G  A+G AL+QW+DMLA PRR +AQW TL
Sbjct:   27 FDKNSLTVVIIQAEELPAMDLGGTSDPYVKLFLLPDKKKKLQTKVQRKSLNPVFNESFTFKIPFNEIGGQTLVLNVFDFDRFGKHDQIGQISIPLGKVDLAATLERTDLIE-----SPPENRLGEVCLALRYVPNKNKLSVVVMECKNLKKMDVLGLSDPYVKIYLMMGTKRLEKKKTTIKMKTLNPYYNESFSFDVTSEKMQRVHLHVTVSDYDRVGSNERIGQVIIGTCATGVALKQWNDMLATPRRSVAQWHTL 278          

HSP 2 Score: 79.337 bits (194), Expect = 3.242e-16
Identity = 46/126 (36.51%), Postives = 76/126 (60.32%), Query Frame = 1
Query:  988 LGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCN-ASGTALRQWSDMLANP 1362
            LG + + L Y      LTVV+++A+ L  MD+GG SDPYVK+ L+ + K+  + K   K  +LNP +NESF+F++PF +I    L++ V D+DR G  + IG++ +        A  + +D++ +P
Sbjct:   16 LGRLQYKLDYDFDKNSLTVVIIQAEELPAMDLGGTSDPYVKLFLLPDKKKKLQTKVQRK--SLNPVFNESFTFKIPFNEIGGQTLVLNVFDFDRFGKHDQIGQISIPLGKVDLAATLERTDLIESP 139          
BLAST of Synaptotagmin, putative vs. Ensembl Celegans
Match: snt-2 (Synaptotagmin 2 [Source:UniProtKB/Swiss-Prot;Acc:K8FE10])

HSP 1 Score: 233.032 bits (593), Expect = 1.418e-71
Identity = 134/269 (49.81%), Postives = 185/269 (68.77%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNA------SGTALRQWSDMLANPRRPIAQWQTLQEMPEK 1410
            F + +L+V I+ A +LPA+D NG SDPYVKV++ P++K+KFET++ R TLNP ++E F F +PF+E+ SKTL L +YD+DR SK D++GQL +PL SID        + L+  +   EKE +LGDICFS RY P  G +T+ ++EA+NLKKMDVGG SDPYVKI L    K + KKKT+ K  TLNPYYNESF F++    I++++LIV+V DYD++  ++ IG V LG         +     QW++M+ + RRP+ QW TLQE  EK
Sbjct:   95 FEQSKLSVTIVSASDLPAMDRNGMSDPYVKVYVLPERKQKFETRIIRNTLNPTYNETFQFSIPFNELHSKTLMLVVYDYDRLSKDDKMGQLSVPLESIDFGITTDIERPLQKPEKDDEKECRLGDICFSTRYRPATGTVTLTIMEARNLKKMDVGGSSDPYVKIYLHHGRKLLSKKKTSRKYKTLNPYYNESFQFKIEPHMIEKVHLIVSVWDYDKMSKNDFIGEVTLGSKHLNLPQITHACSEQWAEMMTS-RRPVVQWHTLQERMEK 362          

HSP 2 Score: 73.559 bits (179), Expect = 6.207e-14
Identity = 37/105 (35.24%), Postives = 62/105 (59.05%), Query Frame = 1
Query:  985 KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRV 1299
            + G+I F + Y     KL+V ++ A +L  MD  G+SDPYVK+ ++   K+  + +      TLNP YNE+F F +PF ++    L++ V DYDR+   + +G++
Sbjct:   83 QYGNIHFRVEYDFEQSKLSVTIVSASDLPAMDRNGMSDPYVKVYVLPERKQKFETRIIRN--TLNPTYNETFQFSIPFNELHSKTLMLVVYDYDRLSKDDKMGQL 185          
BLAST of Synaptotagmin, putative vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0077726)

HSP 1 Score: 349.747 bits (896), Expect = 3.355e-115
Identity = 191/264 (72.35%), Postives = 227/264 (85.98%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFK-VPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPEK 1410
            F    L V ++QA+ELPALDM GTSDPYVKV+L PDKKKKFETKVHRKTL+PVF+E F FK +P+++  +KTL   I+DFDRFSKHDQIG++++PL +IDL Q ++EW++L   +    +E KLGDICFSLRYVPT GKLTVV+LEAKNLKKMDVGGLSDPYVKI++M NGKR+KKKKT+IKKCTLNPYYNESFSFEVPFEQIQ+I L+VTVVDYDRIGTSEPIGR +LGC  +GT LR WSDMLA+PRRPIAQW TL++ PE+
Sbjct:  204 FNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQE-KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLKD-PEE 465          

HSP 2 Score: 72.7886 bits (177), Expect = 2.214e-13
Identity = 45/138 (32.61%), Postives = 76/138 (55.07%), Query Frame = 1
Query:  952 EPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFE-VPFEQIQRINLIVTVVDYDRIGTSEPIGRV-VLGCNAS-GTALRQWSDMLA 1356
            E  ++  + E KLG + F L Y   +  L V V++A+ L  +D+GG SDPYVK+ L+ + K+  + K   K  TL+P +NE+F+F+ +P+       L+  + D+DR    + IG V V  C       + +W D+++
Sbjct:  181 EGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRK--TLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVS 316          
BLAST of Synaptotagmin, putative vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0077728)

HSP 1 Score: 349.747 bits (896), Expect = 3.365e-115
Identity = 191/264 (72.35%), Postives = 227/264 (85.98%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFK-VPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPEK 1410
            F    L V ++QA+ELPALDM GTSDPYVKV+L PDKKKKFETKVHRKTL+PVF+E F FK +P+++  +KTL   I+DFDRFSKHDQIG++++PL +IDL Q ++EW++L   +    +E KLGDICFSLRYVPT GKLTVV+LEAKNLKKMDVGGLSDPYVKI++M NGKR+KKKKT+IKKCTLNPYYNESFSFEVPFEQIQ+I L+VTVVDYDRIGTSEPIGR +LGC  +GT LR WSDMLA+PRRPIAQW TL++ PE+
Sbjct:  202 FNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQE-KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLKD-PEE 463          

HSP 2 Score: 72.7886 bits (177), Expect = 2.240e-13
Identity = 45/138 (32.61%), Postives = 76/138 (55.07%), Query Frame = 1
Query:  952 EPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFE-VPFEQIQRINLIVTVVDYDRIGTSEPIGRV-VLGCNAS-GTALRQWSDMLA 1356
            E  ++  + E KLG + F L Y   +  L V V++A+ L  +D+GG SDPYVK+ L+ + K+  + K   K  TL+P +NE+F+F+ +P+       L+  + D+DR    + IG V V  C       + +W D+++
Sbjct:  179 EGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRK--TLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVS 314          
BLAST of Synaptotagmin, putative vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0345331)

HSP 1 Score: 349.747 bits (896), Expect = 3.365e-115
Identity = 191/264 (72.35%), Postives = 227/264 (85.98%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFK-VPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPEK 1410
            F    L V ++QA+ELPALDM GTSDPYVKV+L PDKKKKFETKVHRKTL+PVF+E F FK +P+++  +KTL   I+DFDRFSKHDQIG++++PL +IDL Q ++EW++L   +    +E KLGDICFSLRYVPT GKLTVV+LEAKNLKKMDVGGLSDPYVKI++M NGKR+KKKKT+IKKCTLNPYYNESFSFEVPFEQIQ+I L+VTVVDYDRIGTSEPIGR +LGC  +GT LR WSDMLA+PRRPIAQW TL++ PE+
Sbjct:  202 FNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQE-KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLKD-PEE 463          

HSP 2 Score: 72.7886 bits (177), Expect = 2.240e-13
Identity = 45/138 (32.61%), Postives = 76/138 (55.07%), Query Frame = 1
Query:  952 EPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFE-VPFEQIQRINLIVTVVDYDRIGTSEPIGRV-VLGCNAS-GTALRQWSDMLA 1356
            E  ++  + E KLG + F L Y   +  L V V++A+ L  +D+GG SDPYVK+ L+ + K+  + K   K  TL+P +NE+F+F+ +P+       L+  + D+DR    + IG V V  C       + +W D+++
Sbjct:  179 EGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRK--TLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVS 314          
BLAST of Synaptotagmin, putative vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0077727)

HSP 1 Score: 349.747 bits (896), Expect = 3.365e-115
Identity = 191/264 (72.35%), Postives = 227/264 (85.98%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFK-VPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPEK 1410
            F    L V ++QA+ELPALDM GTSDPYVKV+L PDKKKKFETKVHRKTL+PVF+E F FK +P+++  +KTL   I+DFDRFSKHDQIG++++PL +IDL Q ++EW++L   +    +E KLGDICFSLRYVPT GKLTVV+LEAKNLKKMDVGGLSDPYVKI++M NGKR+KKKKT+IKKCTLNPYYNESFSFEVPFEQIQ+I L+VTVVDYDRIGTSEPIGR +LGC  +GT LR WSDMLA+PRRPIAQW TL++ PE+
Sbjct:  202 FNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQE-KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLKD-PEE 463          

HSP 2 Score: 72.7886 bits (177), Expect = 2.240e-13
Identity = 45/138 (32.61%), Postives = 76/138 (55.07%), Query Frame = 1
Query:  952 EPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFE-VPFEQIQRINLIVTVVDYDRIGTSEPIGRV-VLGCNAS-GTALRQWSDMLA 1356
            E  ++  + E KLG + F L Y   +  L V V++A+ L  +D+GG SDPYVK+ L+ + K+  + K   K  TL+P +NE+F+F+ +P+       L+  + D+DR    + IG V V  C       + +W D+++
Sbjct:  179 EGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRK--TLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVS 314          
BLAST of Synaptotagmin, putative vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0343993)

HSP 1 Score: 348.591 bits (893), Expect = 8.684e-115
Identity = 191/264 (72.35%), Postives = 226/264 (85.61%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFK-VPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPEK 1410
            F    L V ++QA+ELPALDM GTSDPYVKV+L PDKKKKFETKVHRKTL+PVF+E F FK +P+++  +KTL   I+DFDRFSKHDQIG++++PL +IDL Q ++EW++L   +   E   KLGDICFSLRYVPT GKLTVV+LEAKNLKKMDVGGLSDPYVKI++M NGKR+KKKKT+IKKCTLNPYYNESFSFEVPFEQIQ+I L+VTVVDYDRIGTSEPIGR +LGC  +GT LR WSDMLA+PRRPIAQW TL++ PE+
Sbjct:  204 FNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVE--GEGGQKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLKD-PEE 464          

HSP 2 Score: 72.7886 bits (177), Expect = 2.520e-13
Identity = 45/138 (32.61%), Postives = 76/138 (55.07%), Query Frame = 1
Query:  952 EPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFE-VPFEQIQRINLIVTVVDYDRIGTSEPIGRV-VLGCNAS-GTALRQWSDMLA 1356
            E  ++  + E KLG + F L Y   +  L V V++A+ L  +D+GG SDPYVK+ L+ + K+  + K   K  TL+P +NE+F+F+ +P+       L+  + D+DR    + IG V V  C       + +W D+++
Sbjct:  181 EGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRK--TLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVS 316          
BLAST of Synaptotagmin, putative vs. Ensembl Zebrafish
Match: syt1a (synaptotagmin Ia [Source:ZFIN;Acc:ZDB-GENE-040718-165])

HSP 1 Score: 336.65 bits (862), Expect = 9.191e-111
Identity = 186/260 (71.54%), Postives = 220/260 (84.62%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKEN--KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            FT+  L VGI+QA ELPA+DM GTSDPYVKV+L PDKKKKFETKVHRKTLNPVF+E F FKVP++E+  KTL + +YDFDRFSKHD IG +++P+  +D   V +EW++L+    SAEKE   KLGDICFSLRYVPT GKLTVVVLEAKNLKKMDVGGLSDPYVKI LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQ++ +++TV+DYD+IG ++ IG+V +G N++GT LR WSDMLANPRRPIAQW  L+
Sbjct:  150 FTENTLIVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDAIGDVKVPMNKVDFSHVTEEWRDLQ----SAEKEEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVITVLDYDKIGKNDAIGKVFVGLNSTGTELRHWSDMLANPRRPIAQWHVLK 405          

HSP 2 Score: 76.2554 bits (186), Expect = 1.959e-14
Identity = 45/123 (36.59%), Postives = 70/123 (56.91%), Query Frame = 1
Query:  988 LGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNAS--GTALRQWSDM 1350
            LG + +S+ Y  T   L V +++A  L  MD+GG SDPYVK+ L+ + K+  + K   K  TLNP +NE F+F+VP+ ++    L++TV D+DR    + IG V +  N         +W D+
Sbjct:  139 LGKLQYSMDYNFTENTLIVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRK--TLNPVFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDAIGDVKVPMNKVDFSHVTEEWRDL 259          
BLAST of Synaptotagmin, putative vs. Ensembl Zebrafish
Match: syt1a (synaptotagmin Ia [Source:ZFIN;Acc:ZDB-GENE-040718-165])

HSP 1 Score: 336.65 bits (862), Expect = 9.191e-111
Identity = 186/260 (71.54%), Postives = 220/260 (84.62%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKEN--KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            FT+  L VGI+QA ELPA+DM GTSDPYVKV+L PDKKKKFETKVHRKTLNPVF+E F FKVP++E+  KTL + +YDFDRFSKHD IG +++P+  +D   V +EW++L+    SAEKE   KLGDICFSLRYVPT GKLTVVVLEAKNLKKMDVGGLSDPYVKI LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQ++ +++TV+DYD+IG ++ IG+V +G N++GT LR WSDMLANPRRPIAQW  L+
Sbjct:  150 FTENTLIVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDAIGDVKVPMNKVDFSHVTEEWRDLQ----SAEKEEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVITVLDYDKIGKNDAIGKVFVGLNSTGTELRHWSDMLANPRRPIAQWHVLK 405          

HSP 2 Score: 76.2554 bits (186), Expect = 1.959e-14
Identity = 45/123 (36.59%), Postives = 70/123 (56.91%), Query Frame = 1
Query:  988 LGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNAS--GTALRQWSDM 1350
            LG + +S+ Y  T   L V +++A  L  MD+GG SDPYVK+ L+ + K+  + K   K  TLNP +NE F+F+VP+ ++    L++TV D+DR    + IG V +  N         +W D+
Sbjct:  139 LGKLQYSMDYNFTENTLIVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRK--TLNPVFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDAIGDVKVPMNKVDFSHVTEEWRDL 259          
BLAST of Synaptotagmin, putative vs. Ensembl Zebrafish
Match: syt5a (synaptotagmin Va [Source:ZFIN;Acc:ZDB-GENE-040718-110])

HSP 1 Score: 315.464 bits (807), Expect = 1.215e-102
Identity = 169/258 (65.50%), Postives = 215/258 (83.33%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            FT+ +L VGILQAQ+LPA+D+ GTSDPYVKV++ PDKKKKFETKV RK L PVF+E F+FK+PF+++  +TL L ++DFDRF KHD IG+++IP+ SIDL Q + E+K+L       E++ KLGDIC SLRYVPT+GKLTV ++EAKNLKKMDVGGLSDP+VKI L  NGKRIKKKKTT+K+ TLNPY+NESFSFE+PF QIQ++ +++TV DYD++G+++PIG+  +G  ASG  LR WSDMLANPRRP+AQW TLQ
Sbjct:  141 FTENQLIVGILQAQDLPAMDIGGTSDPYVKVYMLPDKKKKFETKVQRKNLCPVFNETFIFKIPFNDLAGQTLVLQVFDFDRFGKHDVIGEIKIPMNSIDLGQPIHEYKDL--VGGEKEEQEKLGDICISLRYVPTSGKLTVCIMEAKNLKKMDVGGLSDPFVKIVLQHNGKRIKKKKTTVKQNTLNPYFNESFSFEIPFAQIQKVQVLITVYDYDKLGSNDPIGKCWIGFGASGVGLRHWSDMLANPRRPVAQWHTLQ 396          

HSP 2 Score: 72.4034 bits (176), Expect = 3.893e-13
Identity = 40/123 (32.52%), Postives = 72/123 (58.54%), Query Frame = 1
Query: 1003 FSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNAS--GTALRQWSDMLANPR 1365
            ++L Y  T  +L V +L+A++L  MD+GG SDPYVK+ ++ + K+  + K   K   L P +NE+F F++PF  +    L++ V D+DR G  + IG + +  N+   G  + ++ D++   +
Sbjct:  135 YTLDYNFTENQLIVGILQAQDLPAMDIGGTSDPYVKVYMLPDKKKKFETKVQRK--NLCPVFNETFIFKIPFNDLAGQTLVLQVFDFDRFGKHDVIGEIKIPMNSIDLGQPIHEYKDLVGGEK 255          
BLAST of Synaptotagmin, putative vs. Ensembl Zebrafish
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 314.309 bits (804), Expect = 6.770e-102
Identity = 172/260 (66.15%), Postives = 217/260 (83.46%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKEN--KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            F+  +LTVGILQA +L ++D  GTSDPYVKVF+ PDKKKK++TKVH+KTLNPVF+E F FK+PF+E+  KTL + +YDFDRFSKHD IG+++IP+ ++DL Q +++W++L    DSAEKE   KLGDIC SLRYVPT GKLT+ +LEAKNLKKMDVGGLSDPYVKI L+ NGKR+KKKKTT+KK TLNPYYNESFSFE+P +Q+Q+I  ++TV+DYD+IG ++ IG++ +G  A GT LR WSDMLANPRRPIAQW  L+
Sbjct:  159 FSASQLTVGILQAADLLSMDSGGTSDPYVKVFILPDKKKKYDTKVHKKTLNPVFNETFHFKIPFTEMGGKTLVMSVYDFDRFSKHDVIGEVKIPMNTLDLAQPIEQWRDL----DSAEKEEPEKLGDICISLRYVPTAGKLTICILEAKNLKKMDVGGLSDPYVKIHLLQNGKRLKKKKTTVKKNTLNPYYNESFSFEIPQDQMQKIQAVITVLDYDKIGKNDAIGKIWVGSKAQGTELRHWSDMLANPRRPIAQWHPLK 414          

HSP 2 Score: 83.5741 bits (205), Expect = 8.890e-17
Identity = 61/182 (33.52%), Postives = 94/182 (51.65%), Query Frame = 1
Query:  988 LGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTL----QEMPEK*LFLFFLLYADKNLNLVIRYVISYF*TTILIFSSFNV 1521
            LG + FSL Y  +  +LTV +L+A +L  MD GG SDPYVK+ ++ + K+    K   K  TLNP +NE+F F++PF ++    L+++V D+DR    + IG V +  N    A            +PI QW+ L    +E PEK            ++ + +RYV +    TI I  + N+
Sbjct:  148 LGKLQFSLDYDFSASQLTVGILQAADLLSMDSGGTSDPYVKVFILPDKKKKYDTKVHKK--TLNPVFNETFHFKIPFTEMGGKTLVMSVYDFDRFSKHDVIGEVKIPMNTLDLA------------QPIEQWRDLDSAEKEEPEK----------LGDICISLRYVPTAGKLTICILEAKNL 305          
BLAST of Synaptotagmin, putative vs. Ensembl Zebrafish
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 314.309 bits (804), Expect = 6.770e-102
Identity = 172/260 (66.15%), Postives = 217/260 (83.46%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKEN--KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            F+  +LTVGILQA +L ++D  GTSDPYVKVF+ PDKKKK++TKVH+KTLNPVF+E F FK+PF+E+  KTL + +YDFDRFSKHD IG+++IP+ ++DL Q +++W++L    DSAEKE   KLGDIC SLRYVPT GKLT+ +LEAKNLKKMDVGGLSDPYVKI L+ NGKR+KKKKTT+KK TLNPYYNESFSFE+P +Q+Q+I  ++TV+DYD+IG ++ IG++ +G  A GT LR WSDMLANPRRPIAQW  L+
Sbjct:  159 FSASQLTVGILQAADLLSMDSGGTSDPYVKVFILPDKKKKYDTKVHKKTLNPVFNETFHFKIPFTEMGGKTLVMSVYDFDRFSKHDVIGEVKIPMNTLDLAQPIEQWRDL----DSAEKEEPEKLGDICISLRYVPTAGKLTICILEAKNLKKMDVGGLSDPYVKIHLLQNGKRLKKKKTTVKKNTLNPYYNESFSFEIPQDQMQKIQAVITVLDYDKIGKNDAIGKIWVGSKAQGTELRHWSDMLANPRRPIAQWHPLK 414          

HSP 2 Score: 83.5741 bits (205), Expect = 8.890e-17
Identity = 61/182 (33.52%), Postives = 94/182 (51.65%), Query Frame = 1
Query:  988 LGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTL----QEMPEK*LFLFFLLYADKNLNLVIRYVISYF*TTILIFSSFNV 1521
            LG + FSL Y  +  +LTV +L+A +L  MD GG SDPYVK+ ++ + K+    K   K  TLNP +NE+F F++PF ++    L+++V D+DR    + IG V +  N    A            +PI QW+ L    +E PEK            ++ + +RYV +    TI I  + N+
Sbjct:  148 LGKLQFSLDYDFSASQLTVGILQAADLLSMDSGGTSDPYVKVFILPDKKKKYDTKVHKK--TLNPVFNETFHFKIPFTEMGGKTLVMSVYDFDRFSKHDVIGEVKIPMNTLDLA------------QPIEQWRDLDSAEKEEPEK----------LGDICISLRYVPTAGKLTICILEAKNL 305          
BLAST of Synaptotagmin, putative vs. Ensembl Xenopus
Match: SYT5 (synaptotagmin 5 [Source:NCBI gene;Acc:100493612])

HSP 1 Score: 342.813 bits (878), Expect = 5.536e-113
Identity = 185/260 (71.15%), Postives = 223/260 (85.77%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKEN--KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            F  G+L VGI+QA +LPALD+ GTSDPYVKV+L PDKKKK+ETKVHRKTLNP F+E F FKVP++E+  KTL + +YDFDRFSKHD IG++ + + ++DL  V++EW++L+    SAEKE   KLGDICFSLRYVPT GKLTV+VLEAKNLKKMDVGGLSDPYVKI LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQ++ +++TV+DYD++G +E IG++ +GCNA+GT LR WSDMLANPRRPIAQW TLQ
Sbjct:  152 FQTGQLVVGIIQAADLPALDIGGTSDPYVKVYLLPDKKKKYETKVHRKTLNPTFNESFTFKVPYAELGGKTLVMSVYDFDRFSKHDAIGEVRVHMNTVDLAHVIEEWQDLQ----SAEKEEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVLTVLDYDKLGKNEAIGKIFVGCNATGTELRHWSDMLANPRRPIAQWHTLQ 407          

HSP 2 Score: 88.5817 bits (218), Expect = 2.525e-18
Identity = 56/156 (35.90%), Postives = 92/156 (58.97%), Query Frame = 1
Query:  904 LGSIDLCQVVQEWKELEPS-----KDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTA--LRQWSDM 1350
            LG   + +V  + ++L+PS     KD   +E KLG + +SL Y    G+L V +++A +L  +D+GG SDPYVK+ L+ + K+  + K   K  TLNP +NESF+F+VP+ ++    L+++V D+DR    + IG V +  N    A  + +W D+
Sbjct:  109 LGKSYIDKVQPDVEDLDPSLLDDVKDEKPQE-KLGKLQYSLDYDFQTGQLVVGIIQAADLPALDIGGTSDPYVKVYLLPDKKKKYETKVHRK--TLNPTFNESFTFKVPYAELGGKTLVMSVYDFDRFSKHDAIGEVRVHMNTVDLAHVIEEWQDL 261          
BLAST of Synaptotagmin, putative vs. Ensembl Xenopus
Match: SYT5 (synaptotagmin 5 [Source:NCBI gene;Acc:100493612])

HSP 1 Score: 342.428 bits (877), Expect = 7.271e-113
Identity = 185/260 (71.15%), Postives = 223/260 (85.77%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKEN--KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            F  G+L VGI+QA +LPALD+ GTSDPYVKV+L PDKKKK+ETKVHRKTLNP F+E F FKVP++E+  KTL + +YDFDRFSKHD IG++ + + ++DL  V++EW++L+    SAEKE   KLGDICFSLRYVPT GKLTV+VLEAKNLKKMDVGGLSDPYVKI LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQ++ +++TV+DYD++G +E IG++ +GCNA+GT LR WSDMLANPRRPIAQW TLQ
Sbjct:  147 FQTGQLVVGIIQAADLPALDIGGTSDPYVKVYLLPDKKKKYETKVHRKTLNPTFNESFTFKVPYAELGGKTLVMSVYDFDRFSKHDAIGEVRVHMNTVDLAHVIEEWQDLQ----SAEKEEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVLTVLDYDKLGKNEAIGKIFVGCNATGTELRHWSDMLANPRRPIAQWHTLQ 402          

HSP 2 Score: 88.5817 bits (218), Expect = 2.975e-18
Identity = 56/156 (35.90%), Postives = 92/156 (58.97%), Query Frame = 1
Query:  904 LGSIDLCQVVQEWKELEPS-----KDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTA--LRQWSDM 1350
            LG   + +V  + ++L+PS     KD   +E KLG + +SL Y    G+L V +++A +L  +D+GG SDPYVK+ L+ + K+  + K   K  TLNP +NESF+F+VP+ ++    L+++V D+DR    + IG V +  N    A  + +W D+
Sbjct:  104 LGKSYIDKVQPDVEDLDPSLLDDVKDEKPQE-KLGKLQYSLDYDFQTGQLVVGIIQAADLPALDIGGTSDPYVKVYLLPDKKKKYETKVHRK--TLNPTFNESFTFKVPYAELGGKTLVMSVYDFDRFSKHDAIGEVRVHMNTVDLAHVIEEWQDL 256          
BLAST of Synaptotagmin, putative vs. Ensembl Xenopus
Match: luzp2 (leucine zipper protein 2 [Source:Xenbase;Acc:XB-GENE-940667])

HSP 1 Score: 338.961 bits (868), Expect = 2.473e-111
Identity = 181/260 (69.62%), Postives = 220/260 (84.62%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKEN--KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            F   ++ VGI+QA ELPALDM GTSDPYVKVF  PDKKKK ETKVHRKTLNP+F+E F FK+P+ E+  KTLC+ IYDFDRFSKHD IG++++P+ ++DL Q ++EW++L+    SAEKE   KLGDIC SLRYVPT GKLTV +LEAKNLKKMDVGGLSDPYVKI LM NGKR+KKKKTT+KK TLNPY+NESFSFE+PFEQIQ++ +++TV+DYD++G +E IG++ +GCNASGT LR WSDMLANPRRPIAQW  L+
Sbjct:  157 FQNNQMQVGIIQATELPALDMGGTSDPYVKVFFLPDKKKKHETKVHRKTLNPIFNETFTFKIPYQELGGKTLCMSIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQ----SAEKEEPEKLGDICISLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVITVLDYDKLGKNEAIGKIFVGCNASGTELRHWSDMLANPRRPIAQWHPLK 412          

HSP 2 Score: 73.9442 bits (180), Expect = 1.516e-13
Identity = 40/118 (33.90%), Postives = 70/118 (59.32%), Query Frame = 1
Query: 1003 FSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNAS--GTALRQWSDM 1350
            FSL Y   N ++ V +++A  L  +D+GG SDPYVK+  + + K+  + K   K  TLNP +NE+F+F++P++++    L +++ D+DR    + IG V +  N    G  + +W D+
Sbjct:  151 FSLDYDFQNNQMQVGIIQATELPALDMGGTSDPYVKVFFLPDKKKKHETKVHRK--TLNPIFNETFTFKIPYQELGGKTLCMSIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDL 266          
BLAST of Synaptotagmin, putative vs. Ensembl Xenopus
Match: e2f4 (E2F transcription factor 4 [Source:Xenbase;Acc:XB-GENE-482721])

HSP 1 Score: 333.183 bits (853), Expect = 3.583e-109
Identity = 187/259 (72.20%), Postives = 218/259 (84.17%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKEN--KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTL 1392
            F   +L VGI+QA ELPALDM GTSDPYVK+FL PDKKKKFETKVHRKTLNPVF+E F FKVP++E+  KTL L +YDFDRFSKHD IG +++P+ ++D   V +EW++L     SAEKE   KLGDICFSLRYVPT GKLTVV+LEAKNLKKMDVGGLSDPYVKI LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQ++ ++VTV+DYD+IG ++ IG+V +G N++G  LR WSDMLANPRRPIAQW TL
Sbjct:  157 FQNNQLMVGIIQAAELPALDMGGTSDPYVKLFLMPDKKKKFETKVHRKTLNPVFNEQFTFKVPYAELGGKTLVLTVYDFDRFSKHDVIGDVKVPMNTVDFGHVTEEWRDLV----SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTL 411          

HSP 2 Score: 83.1889 bits (204), Expect = 1.796e-16
Identity = 49/135 (36.30%), Postives = 79/135 (58.52%), Query Frame = 1
Query:  958 SKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNAS--GTALRQWSDMLA 1356
             K+  ++  KLG + +SL Y   N +L V +++A  L  +D+GG SDPYVK+ LM + K+  + K   K  TLNP +NE F+F+VP+ ++    L++TV D+DR    + IG V +  N    G    +W D+++
Sbjct:  136 DKEQPKEVEKLGKLQYSLDYDFQNNQLMVGIIQAAELPALDMGGTSDPYVKLFLMPDKKKKFETKVHRK--TLNPVFNEQFTFKVPYAELGGKTLVLTVYDFDRFSKHDVIGDVKVPMNTVDFGHVTEEWRDLVS 268          
BLAST of Synaptotagmin, putative vs. Ensembl Xenopus
Match: syt8 (synaptotagmin 8 [Source:NCBI gene;Acc:100037878])

HSP 1 Score: 288.5 bits (737), Expect = 4.100e-92
Identity = 150/262 (57.25%), Postives = 201/262 (76.72%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPE 1407
            F   ELTVG+ QA  L A+D+ GTSDPY  V++  D +KKFETKV+RKTLNPVF+E F+FKV   E+   T  + I+DF+RF KHD IG++ IPLG ++L  V+++WK+L P+  +  +   LGDICFSLRYVP++GKLT+++LEAKNLK+MD  G SDPYVK+ L +N K+ K+KKT +KK TL PY+NESF+F+V  EQ++ ++LI++V D+D++G +E IG++ LGC ASG ALR WSDMLA+PRRPIAQW  LQE  E
Sbjct:  117 FQTEELTVGVKQAAALKAMDLGGTSDPYAIVYVTNDTRKKFETKVNRKTLNPVFNESFVFKVTQEEVPRTTAVVQIFDFNRFLKHDVIGEMVIPLGEVNLQHVIEDWKDLGPAGKTEHEH--LGDICFSLRYVPSSGKLTIIILEAKNLKRMDSDGFSDPYVKVHLALNRKKWKRKKTAVKKSTLKPYFNESFTFDVSLEQMKNLDLIISVWDHDKVGKNEQIGKLFLGCRASGNALRHWSDMLAHPRRPIAQWHKLQEADE 376          

HSP 2 Score: 66.6254 bits (161), Expect = 3.075e-11
Identity = 46/129 (35.66%), Postives = 68/129 (52.71%), Query Frame = 1
Query:  970 AEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVV--LGCNASGTALRQWSDM 1350
             EK    G + +SL Y     +LTV V +A  LK MD+GG SDPY  +   +     KK +T + + TLNP +NESF F+V  E++ R   +V + D++R    + IG +V  LG       +  W D+
Sbjct:  100 GEKVEYRGRVQYSLEYNFQTEELTVGVKQAAALKAMDLGGTSDPYAIV--YVTNDTRKKFETKVNRKTLNPVFNESFVFKVTQEEVPRTTAVVQIFDFNRFLKHDVIGEMVIPLGEVNLQHVIEDWKDL 226          
BLAST of Synaptotagmin, putative vs. Ensembl Mouse
Match: Syt1 (synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667])

HSP 1 Score: 337.806 bits (865), Expect = 3.513e-111
Identity = 189/260 (72.69%), Postives = 220/260 (84.62%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKEN--KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            F   +L VGI+QA ELPALDM GTSDPYVKVFL PDKKKKFETKVHRKTLNPVF+E F FKVP+SE+  KTL + +YDFDRFSKHD IG+ ++P+ ++D   V +EW++L+    SAEKE   KLGDICFSLRYVPT GKLTVV+LEAKNLKKMDVGGLSDPYVKI LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQ++ ++VTV+DYD+IG ++ IG+V +G N++G  LR WSDMLANPRRPIAQW TLQ
Sbjct:  153 FQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQ----SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 408          

HSP 2 Score: 75.485 bits (184), Expect = 3.589e-14
Identity = 44/123 (35.77%), Postives = 70/123 (56.91%), Query Frame = 1
Query:  988 LGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNAS--GTALRQWSDM 1350
            LG + +SL Y   N +L V +++A  L  +D+GG SDPYVK+ L+ + K+  + K   K  TLNP +NE F+F+VP+ ++    L++ V D+DR    + IG   +  N    G    +W D+
Sbjct:  142 LGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRK--TLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDL 262          
BLAST of Synaptotagmin, putative vs. Ensembl Mouse
Match: Syt1 (synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667])

HSP 1 Score: 337.806 bits (865), Expect = 3.513e-111
Identity = 189/260 (72.69%), Postives = 220/260 (84.62%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKEN--KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            F   +L VGI+QA ELPALDM GTSDPYVKVFL PDKKKKFETKVHRKTLNPVF+E F FKVP+SE+  KTL + +YDFDRFSKHD IG+ ++P+ ++D   V +EW++L+    SAEKE   KLGDICFSLRYVPT GKLTVV+LEAKNLKKMDVGGLSDPYVKI LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQ++ ++VTV+DYD+IG ++ IG+V +G N++G  LR WSDMLANPRRPIAQW TLQ
Sbjct:  153 FQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQ----SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 408          

HSP 2 Score: 75.485 bits (184), Expect = 3.589e-14
Identity = 44/123 (35.77%), Postives = 70/123 (56.91%), Query Frame = 1
Query:  988 LGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNAS--GTALRQWSDM 1350
            LG + +SL Y   N +L V +++A  L  +D+GG SDPYVK+ L+ + K+  + K   K  TLNP +NE F+F+VP+ ++    L++ V D+DR    + IG   +  N    G    +W D+
Sbjct:  142 LGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRK--TLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDL 262          
BLAST of Synaptotagmin, putative vs. Ensembl Mouse
Match: Syt2 (synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666])

HSP 1 Score: 331.643 bits (849), Expect = 9.014e-109
Identity = 179/258 (69.38%), Postives = 219/258 (84.88%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            F   +LTVG+LQA ELPALDM GTSDPYVKVFL PDKKKK+ETKVHRKTLNP F+E F FKVP+ E+  KTL + IYDFDRFSKHD IG++++P+ ++DL Q ++EW++L+  +   E+  KLGDIC SLRYVPT GKLTV +LEAKNLKKMDVGGLSDPYVKI LM NGKR+KKKKTT+KK TLNPY+NESFSFE+PFEQIQ++ ++VTV+DYD++G +E IG++ +G NA+GT LR WSDMLANPRRPIAQW +L+
Sbjct:  154 FQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGE--KEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLK 409          

HSP 2 Score: 81.6481 bits (200), Expect = 3.507e-16
Identity = 47/123 (38.21%), Postives = 74/123 (60.16%), Query Frame = 1
Query:  988 LGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNAS--GTALRQWSDM 1350
            LG + FSL Y     +LTV VL+A  L  +D+GG SDPYVK+ L+ + K+  + K   K  TLNP +NE+F+F+VP++++    L++ + D+DR    + IG V +  N    G  + +W D+
Sbjct:  143 LGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRK--TLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDL 263          
BLAST of Synaptotagmin, putative vs. Ensembl Mouse
Match: Syt2 (synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666])

HSP 1 Score: 331.643 bits (849), Expect = 9.014e-109
Identity = 179/258 (69.38%), Postives = 219/258 (84.88%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            F   +LTVG+LQA ELPALDM GTSDPYVKVFL PDKKKK+ETKVHRKTLNP F+E F FKVP+ E+  KTL + IYDFDRFSKHD IG++++P+ ++DL Q ++EW++L+  +   E+  KLGDIC SLRYVPT GKLTV +LEAKNLKKMDVGGLSDPYVKI LM NGKR+KKKKTT+KK TLNPY+NESFSFE+PFEQIQ++ ++VTV+DYD++G +E IG++ +G NA+GT LR WSDMLANPRRPIAQW +L+
Sbjct:  154 FQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGE--KEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLK 409          

HSP 2 Score: 81.6481 bits (200), Expect = 3.507e-16
Identity = 47/123 (38.21%), Postives = 74/123 (60.16%), Query Frame = 1
Query:  988 LGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNAS--GTALRQWSDM 1350
            LG + FSL Y     +LTV VL+A  L  +D+GG SDPYVK+ L+ + K+  + K   K  TLNP +NE+F+F+VP++++    L++ + D+DR    + IG V +  N    G  + +W D+
Sbjct:  143 LGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRK--TLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDL 263          
BLAST of Synaptotagmin, putative vs. Ensembl Mouse
Match: Syt5 (synaptotagmin V [Source:MGI Symbol;Acc:MGI:1926368])

HSP 1 Score: 291.967 bits (746), Expect = 1.002e-93
Identity = 160/258 (62.02%), Postives = 208/258 (80.62%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            F  G+L VGILQAQ L ALD+ G+SDPYV V+L PDK+++ ETKVHR+TLNP F E F FKVP+ E+  + L + +YDFDRFS++D IG++ +P+ S++L + VQ W+EL+ +    E++ KLGDICFSLRYVPT GKLTV+VLEAKNLKKMDVGGLSDPYVK+ L+  GK+++KKKTTIKK TLNPYYNE+FSFEVP +Q+Q++ + +TV+DYD++G +E IGRV +G    G  LR W+DMLANPRRPIAQW +L+
Sbjct:  120 FQTGQLLVGILQAQGLAALDLGGSSDPYVSVYLLPDKRRRHETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDRFSRNDAIGEVRVPMSSVNLGRPVQAWRELQVA--PKEEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGGKKVRKKKTTIKKNTLNPYYNEAFSFEVPCDQVQKVQVELTVLDYDKLGKNEAIGRVAVGAAVGGAGLRHWADMLANPRRPIAQWHSLR 375          

HSP 2 Score: 79.337 bits (194), Expect = 1.836e-15
Identity = 54/174 (31.03%), Postives = 97/174 (55.75%), Query Frame = 1
Query:  904 LGSIDLCQVVQEWKELE-----PSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPEK 1410
            LG   + +V  E +EL+     P +  ++K ++LG + +SL Y    G+L V +L+A+ L  +D+GG SDPYV + L+ + +R  + K   +  TLNP++ E+F+F+VP+ ++    L++ V D+DR   ++ IG V +  ++             N  RP+  W+ LQ  P++
Sbjct:   77 LGRSYIDKVQPEIEELDRSPSMPGQQVSDK-HQLGRLQYSLDYDFQTGQLLVGILQAQGLAALDLGGSSDPYVSVYLLPDKRRRHETKVHRQ--TLNPHFGETFAFKVPYVELGGRVLVMAVYDFDRFSRNDAIGEVRVPMSS------------VNLGRPVQAWRELQVAPKE 235          
BLAST of Synaptotagmin, putative vs. UniProt/SwissProt
Match: sp|P41823|SY65_APLCA (Synaptotagmin-1 OS=Aplysia californica OX=6500 GN=SYT1 PE=1 SV=2)

HSP 1 Score: 375.941 bits (964), Expect = 5.071e-125
Identity = 201/263 (76.43%), Postives = 233/263 (88.59%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPEK 1410
            F KGEL+V ++QA +LP +DM+GTSDPYVKV+L PDKKKK+ETKVHRKTLNPVF+E F FKVP++E+ SK L   +YDFDRFSKHDQIGQ+++PL SIDL +VV++WK+L+     +EKENKLGDICFSLRYVPT GKLTVV+LEAKNLKKMDVGGLSDPYVKI+L+   KR+KKKKTTIKK TLNPY+NESF FEVPFEQIQ++ LI+TVVDYDRIGTSEPIGR VLGCN+SGT LR WSDMLANPRRPIAQW TLQE+PEK
Sbjct:  165 FQKGELSVNVIQAADLPGMDMSGTSDPYVKVYLLPDKKKKYETKVHRKTLNPVFNESFTFKVPYAEVGSKILTFAVYDFDRFSKHDQIGQVQVPLNSIDLGRVVEDWKDLQSPDTESEKENKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIALLQGTKRLKKKKTTIKKNTLNPYFNESFGFEVPFEQIQKVTLIITVVDYDRIGTSEPIGRCVLGCNSSGTELRHWSDMLANPRRPIAQWHTLQEVPEK 427          

HSP 2 Score: 83.5741 bits (205), Expect = 6.633e-16
Identity = 51/131 (38.93%), Postives = 78/131 (59.54%), Query Frame = 1
Query:  964 DSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNAS--GTALRQWSDM 1350
            +S + E KLG + FSL Y    G+L+V V++A +L  MD+ G SDPYVK+ L+ + K+  + K   K  TLNP +NESF+F+VP+ ++    L   V D+DR    + IG+V +  N+   G  +  W D+
Sbjct:  146 ESTKSEVKLGKLQFSLDYDFQKGELSVNVIQAADLPGMDMSGTSDPYVKVYLLPDKKKKYETKVHRK--TLNPVFNESFTFKVPYAEVGSKILTFAVYDFDRFSKHDQIGQVQVPLNSIDLGRVVEDWKDL 274          
BLAST of Synaptotagmin, putative vs. UniProt/SwissProt
Match: sp|P34693|SYT1_CAEEL (Synaptotagmin-1 OS=Caenorhabditis elegans OX=6239 GN=snt-1 PE=2 SV=1)

HSP 1 Score: 358.607 bits (919), Expect = 4.156e-118
Identity = 187/263 (71.10%), Postives = 226/263 (85.93%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPEK 1410
            F +G+LTV ++QA++LP +DM+GTSDPYVK++L P+KKKK ETKVHRKTLNPVF+E F+FKV F+EIT+KTL   IYDFDRFSKHDQIGQ+ IPLG IDL  V++EWK++ P  D  E E  LGDICFSLRYVPT GKLTVV+LEAKNLKKMDVGGLSDPYVKI LM  GKR+KKKKT+IKKCTLNPYYNESFSFEVPFEQIQ+++L++TV+DYD++G+++ IGR +LGCN +G  LR W DMLA+PRRPIAQW TL  + E+
Sbjct:  171 FQQGQLTVTVIQAEDLPGMDMSGTSDPYVKLYLLPEKKKKVETKVHRKTLNPVFNETFIFKVAFNEITAKTLVFAIYDFDRFSKHDQIGQVLIPLGKIDLGAVIEEWKDIAPPPDDKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIVLMQGGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKVSLMITVMDYDKLGSNDAIGRCLLGCNGTGAELRHWMDMLASPRRPIAQWHTLGPVEEE 433          

HSP 2 Score: 80.8777 bits (198), Expect = 5.886e-15
Identity = 49/127 (38.58%), Postives = 73/127 (57.48%), Query Frame = 1
Query:  988 LGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVV--LGCNASGTALRQWSDMLANP 1362
            LG I + L Y    G+LTV V++A++L  MD+ G SDPYVK+ L+   K+  + K   K  TLNP +NE+F F+V F +I    L+  + D+DR    + IG+V+  LG    G  + +W D+   P
Sbjct:  160 LGRIQYKLDYDFQQGQLTVTVIQAEDLPGMDMSGTSDPYVKLYLLPEKKKKVETKVHRK--TLNPVFNETFIFKVAFNEITAKTLVFAIYDFDRFSKHDQIGQVLIPLGKIDLGAVIEEWKDIAPPP 284          
BLAST of Synaptotagmin, putative vs. UniProt/SwissProt
Match: sp|P21521|SY65_DROME (Synaptotagmin 1 OS=Drosophila melanogaster OX=7227 GN=Syt1 PE=1 SV=3)

HSP 1 Score: 349.747 bits (896), Expect = 3.363e-114
Identity = 191/264 (72.35%), Postives = 227/264 (85.98%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFK-VPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPEK 1410
            F    L V ++QA+ELPALDM GTSDPYVKV+L PDKKKKFETKVHRKTL+PVF+E F FK +P+++  +KTL   I+DFDRFSKHDQIG++++PL +IDL Q ++EW++L   +    +E KLGDICFSLRYVPT GKLTVV+LEAKNLKKMDVGGLSDPYVKI++M NGKR+KKKKT+IKKCTLNPYYNESFSFEVPFEQIQ+I L+VTVVDYDRIGTSEPIGR +LGC  +GT LR WSDMLA+PRRPIAQW TL++ PE+
Sbjct:  204 FNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQE-KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLKD-PEE 465          

HSP 2 Score: 72.7886 bits (177), Expect = 2.219e-12
Identity = 45/138 (32.61%), Postives = 76/138 (55.07%), Query Frame = 1
Query:  952 EPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFE-VPFEQIQRINLIVTVVDYDRIGTSEPIGRV-VLGCNAS-GTALRQWSDMLA 1356
            E  ++  + E KLG + F L Y   +  L V V++A+ L  +D+GG SDPYVK+ L+ + K+  + K   K  TL+P +NE+F+F+ +P+       L+  + D+DR    + IG V V  C       + +W D+++
Sbjct:  181 EGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRK--TLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVS 316          
BLAST of Synaptotagmin, putative vs. UniProt/SwissProt
Match: sp|Q5R4J5|SYT1_PONAB (Synaptotagmin-1 OS=Pongo abelii OX=9601 GN=SYT1 PE=2 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 1.567e-111
Identity = 188/260 (72.31%), Postives = 220/260 (84.62%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKEN--KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            F   +L VGI+QA ELPALDM GTSDPYVKVFL PDKKKKFETKVHRKTLNPVF+E F FKVP+SE+  KTL + +YDFDRFSKHD IG+ ++P+ ++D   V +EW++L+    SAEKE   KLGDICFSLRYVPT GKLTVV+LEAKNLKKMDVGGLSDPYVKI LM NGKR+KKK+TTIKK TLNPYYNESFSFEVPFEQIQ++ ++VTV+DYD+IG ++ IG+V +G N++G  LR WSDMLANPRRPIAQW TLQ
Sbjct:  151 FQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQ----SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKETTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 406          

HSP 2 Score: 76.2554 bits (186), Expect = 1.707e-13
Identity = 44/123 (35.77%), Postives = 70/123 (56.91%), Query Frame = 1
Query:  988 LGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNAS--GTALRQWSDM 1350
            LG + +SL Y   N +L V +++A  L  +D+GG SDPYVK+ L+ + K+  + K   K  TLNP +NE F+F+VP+ ++    L++ V D+DR    + IG   +  N    G    +W D+
Sbjct:  140 LGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRK--TLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDL 260          
BLAST of Synaptotagmin, putative vs. UniProt/SwissProt
Match: sp|P21707|SYT1_RAT (Synaptotagmin-1 OS=Rattus norvegicus OX=10116 GN=Syt1 PE=1 SV=3)

HSP 1 Score: 337.806 bits (865), Expect = 2.405e-110
Identity = 189/260 (72.69%), Postives = 220/260 (84.62%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKEN--KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            F   +L VGI+QA ELPALDM GTSDPYVKVFL PDKKKKFETKVHRKTLNPVF+E F FKVP+SE+  KTL + +YDFDRFSKHD IG+ ++P+ ++D   V +EW++L+    SAEKE   KLGDICFSLRYVPT GKLTVV+LEAKNLKKMDVGGLSDPYVKI LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQ++ ++VTV+DYD+IG ++ IG+V +G N++G  LR WSDMLANPRRPIAQW TLQ
Sbjct:  153 FQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQ----SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQ 408          

HSP 2 Score: 75.8702 bits (185), Expect = 2.316e-13
Identity = 44/123 (35.77%), Postives = 70/123 (56.91%), Query Frame = 1
Query:  988 LGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNAS--GTALRQWSDM 1350
            LG + +SL Y   N +L V +++A  L  +D+GG SDPYVK+ L+ + K+  + K   K  TLNP +NE F+F+VP+ ++    L++ V D+DR    + IG   +  N    G    +W D+
Sbjct:  142 LGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRK--TLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDL 262          
BLAST of Synaptotagmin, putative vs. TrEMBL
Match: Q9U8R6 (Djsyt protein OS=Dugesia japonica OX=6161 GN=Djsyt PE=2 SV=1)

HSP 1 Score: 404.445 bits (1038), Expect = 3.563e-134
Identity = 212/262 (80.92%), Postives = 243/262 (92.75%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPE 1407
            F KGELTVG++QA +LPA+DM+GTSDPYVK+FL PDKKKKFETKVHRK LNPVF+E F+FKVPF+E+ SKTL  ++YDFDRFSKHDQIGQ+++PLG+IDL +V++EWKELE   +  EKEN+LGDICFSLRYVPT+GKLT+V+LEAKNLKKMDVGGLSDPYVK+SLM+NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQ++NLIVTVVDYDRIGTSEPIGR+VLGCNA+G  LR WSDMLANPRRPIAQW TLQEMPE
Sbjct:  132 FQKGELTVGVIQATDLPAMDMSGTSDPYVKLFLLPDKKKKFETKVHRKILNPVFNETFVFKVPFNEVASKTLVFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKELESPDNDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAELRHWSDMLANPRRPIAQWHTLQEMPE 393          

HSP 2 Score: 82.0333 bits (201), Expect = 5.884e-13
Identity = 51/137 (37.23%), Postives = 80/137 (58.39%), Query Frame = 1
Query:  949 LEPSKDSAEKEN-KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIG--RVVLGCNASGTALRQWSDM 1350
            +E ++   EKE+  LG + +SL Y    G+LTV V++A +L  MD+ G SDPYVK+ L+ + K+  + K   K   LNP +NE+F F+VPF ++    L+  V D+DR    + IG  +V LG    G  + +W ++
Sbjct:  107 MEDNEGVKEKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLFLLPDKKKKFETKVHRK--ILNPVFNETFVFKVPFNEVASKTLVFNVYDFDRFSKHDQIGQIKVPLGAIDLGRVIEEWKEL 241          
BLAST of Synaptotagmin, putative vs. TrEMBL
Match: A0A183K2R8 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS9282 PE=4 SV=1)

HSP 1 Score: 394.43 bits (1012), Expect = 2.556e-131
Identity = 201/263 (76.43%), Postives = 238/263 (90.49%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPEK 1410
            F K ELTVG++QA +LPA+DM GTSDPYVKV L PDKKKK+ETKVHRK LNP+F+E F+FK+P++EI+SKT+   +YDFDRFSKHDQIGQ+++PL ++DLC V++EW++L P +   EKEN+LGDICFSLRYVPT+G+L V +LEAKNLKKMDVGGLSDPYVK+SLM NGKRIKKKKTTIKK TLNPYYNESF+F+VPF+QIQ++NLIVTVVDYDRIGTSEPIGR+VLGCNA+G ALR WSDMLANPRRPIAQW TLQ+MPEK
Sbjct:   63 FQKAELTVGVIQAHDLPAMDMCGTSDPYVKVTLLPDKKKKYETKVHRKILNPIFNETFIFKIPYAEISSKTISFTVYDFDRFSKHDQIGQIKVPLSTVDLCNVIEEWRDLSPPEGEGEKENRLGDICFSLRYVPTSGRLNVNILEAKNLKKMDVGGLSDPYVKLSLMFNGKRIKKKKTTIKKYTLNPYYNESFAFDVPFDQIQKVNLIVTVVDYDRIGTSEPIGRIVLGCNATGAALRHWSDMLANPRRPIAQWHTLQDMPEK 325          

HSP 2 Score: 77.411 bits (189), Expect = 9.942e-12
Identity = 49/144 (34.03%), Postives = 79/144 (54.86%), Query Frame = 1
Query:  937 EWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRV------VLGCNASGTALRQWSDM 1350
            E  E E + D  +++   G + FSL Y     +LTV V++A +L  MD+ G SDPYVK++L+ + K+  + K   K   LNP +NE+F F++P+ +I    +  TV D+DR    + IG++      V  CN     + +W D+
Sbjct:   35 EMNEQEQAGDHEKEKQYFGKLQFSLDYDFQKAELTVGVIQAHDLPAMDMCGTSDPYVKVTLLPDKKKKYETKVHRK--ILNPIFNETFIFKIPYAEISSKTISFTVYDFDRFSKHDQIGQIKVPLSTVDLCN----VIEEWRDL 172          
BLAST of Synaptotagmin, putative vs. TrEMBL
Match: A0A267E6V1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031935g2 PE=4 SV=1)

HSP 1 Score: 397.897 bits (1021), Expect = 3.882e-131
Identity = 203/263 (77.19%), Postives = 241/263 (91.63%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPEK 1410
            F KGEL+VG++QA +LPA+DM GTSDPYVKV++ P+KKKKFETKVHRKTLNPVF+E F+FKVP++++ SKTL   +YDFDRFSKHDQIG +++PLG+IDL ++++EWK+++P +   +K N+LGDICFSLRYVPT GKLT+V+LEAKNLKKMDVGGLSDPYVK+SLM+NGKRIKKKKTTIKKCTLNPYYNESFSFEVPFEQIQ+++LIVTVVDYDRIGTSEPIGR+VLGC A+G  LR WSDMLANPRRPIAQW TLQEMPEK
Sbjct:  168 FQKGELSVGVIQASDLPAMDMGGTSDPYVKVYILPEKKKKFETKVHRKTLNPVFNETFIFKVPYADVPSKTLVFAVYDFDRFSKHDQIGLIKLPLGAIDLARLIEEWKDIDPPESEDDKSNRLGDICFSLRYVPTAGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRIKKKKTTIKKCTLNPYYNESFSFEVPFEQIQKVSLIVTVVDYDRIGTSEPIGRIVLGCTATGAELRHWSDMLANPRRPIAQWHTLQEMPEK 430          

HSP 2 Score: 80.8777 bits (198), Expect = 1.672e-12
Identity = 51/137 (37.23%), Postives = 80/137 (58.39%), Query Frame = 1
Query:  949 LEPSKDSAEKE-NKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTA--LRQWSDM 1350
            +E ++ + EKE  KLG + +SL Y    G+L+V V++A +L  MD+GG SDPYVK+ ++   K+  + K   K  TLNP +NE+F F+VP+  +    L+  V D+DR    + IG + L   A   A  + +W D+
Sbjct:  143 MEDNEGNQEKEVEKLGKLQYSLDYDFQKGELSVGVIQASDLPAMDMGGTSDPYVKVYILPEKKKKFETKVHRK--TLNPVFNETFIFKVPYADVPSKTLVFAVYDFDRFSKHDQIGLIKLPLGAIDLARLIEEWKDI 277          
BLAST of Synaptotagmin, putative vs. TrEMBL
Match: A0A267E333 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031935g3 PE=4 SV=1)

HSP 1 Score: 397.897 bits (1021), Expect = 3.968e-131
Identity = 203/263 (77.19%), Postives = 241/263 (91.63%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPEK 1410
            F KGEL+VG++QA +LPA+DM GTSDPYVKV++ P+KKKKFETKVHRKTLNPVF+E F+FKVP++++ SKTL   +YDFDRFSKHDQIG +++PLG+IDL ++++EWK+++P +   +K N+LGDICFSLRYVPT GKLT+V+LEAKNLKKMDVGGLSDPYVK+SLM+NGKRIKKKKTTIKKCTLNPYYNESFSFEVPFEQIQ+++LIVTVVDYDRIGTSEPIGR+VLGC A+G  LR WSDMLANPRRPIAQW TLQEMPEK
Sbjct:  168 FQKGELSVGVIQASDLPAMDMGGTSDPYVKVYIMPEKKKKFETKVHRKTLNPVFNETFIFKVPYADVPSKTLVFAVYDFDRFSKHDQIGLIKLPLGAIDLARLIEEWKDIDPPESEDDKSNRLGDICFSLRYVPTAGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRIKKKKTTIKKCTLNPYYNESFSFEVPFEQIQKVSLIVTVVDYDRIGTSEPIGRIVLGCTATGAELRHWSDMLANPRRPIAQWHTLQEMPEK 430          

HSP 2 Score: 82.8037 bits (203), Expect = 3.896e-13
Identity = 52/137 (37.96%), Postives = 80/137 (58.39%), Query Frame = 1
Query:  949 LEPSKDSAEKE-NKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTA--LRQWSDM 1350
            +E ++ + EKE  KLG + +SL Y    G+L+V V++A +L  MD+GG SDPYVK+ +M   K+  + K   K  TLNP +NE+F F+VP+  +    L+  V D+DR    + IG + L   A   A  + +W D+
Sbjct:  143 MEDNEGAQEKEVEKLGKLQYSLDYDFQKGELSVGVIQASDLPAMDMGGTSDPYVKVYIMPEKKKKFETKVHRK--TLNPVFNETFIFKVPYADVPSKTLVFAVYDFDRFSKHDQIGLIKLPLGAIDLARLIEEWKDI 277          
BLAST of Synaptotagmin, putative vs. TrEMBL
Match: A0A267GS86 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031935g1 PE=4 SV=1)

HSP 1 Score: 397.512 bits (1020), Expect = 5.376e-131
Identity = 203/263 (77.19%), Postives = 241/263 (91.63%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPEK 1410
            F KGEL+VG++QA +LPA+DM GTSDPYVKV++ P+KKKKFETKVHRKTLNPVF+E F+FKVP++++ SKTL   +YDFDRFSKHDQIG +++PLG+IDL ++++EWK+++P +   +K N+LGDICFSLRYVPT GKLT+V+LEAKNLKKMDVGGLSDPYVK+SLM+NGKRIKKKKTTIKKCTLNPYYNESFSFEVPFEQIQ+++LIVTVVDYDRIGTSEPIGR+VLGC A+G  LR WSDMLANPRRPIAQW TLQEMPEK
Sbjct:  168 FQKGELSVGVIQASDLPAMDMGGTSDPYVKVYIMPEKKKKFETKVHRKTLNPVFNETFIFKVPYADVPSKTLVFAVYDFDRFSKHDQIGLIKLPLGAIDLARLIEEWKDIDPPESEDDKSNRLGDICFSLRYVPTAGKLTIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRIKKKKTTIKKCTLNPYYNESFSFEVPFEQIQKVSLIVTVVDYDRIGTSEPIGRIVLGCTATGAELRHWSDMLANPRRPIAQWHTLQEMPEK 430          

HSP 2 Score: 82.8037 bits (203), Expect = 3.896e-13
Identity = 52/137 (37.96%), Postives = 80/137 (58.39%), Query Frame = 1
Query:  949 LEPSKDSAEKE-NKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTA--LRQWSDM 1350
            +E ++ + EKE  KLG + +SL Y    G+L+V V++A +L  MD+GG SDPYVK+ +M   K+  + K   K  TLNP +NE+F F+VP+  +    L+  V D+DR    + IG + L   A   A  + +W D+
Sbjct:  143 MEDNEGAQEKEVEKLGKLQYSLDYDFQKGELSVGVIQASDLPAMDMGGTSDPYVKVYIMPEKKKKFETKVHRK--TLNPVFNETFIFKVPYADVPSKTLVFAVYDFDRFSKHDQIGLIKLPLGAIDLARLIEEWKDI 277          
BLAST of Synaptotagmin, putative vs. Ensembl Cavefish
Match: syt1a (synaptotagmin 1 [Source:NCBI gene;Acc:103044539])

HSP 1 Score: 334.724 bits (857), Expect = 4.246e-110
Identity = 184/260 (70.77%), Postives = 218/260 (83.85%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKEN--KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            FT+  L VGI+QA ELPA+DM GTSDPYVKV+L PDKKKKFETKVHRKTLNP F+E F FKVP++E+  KTL + +YDFDRFSKHD IG +++P+  +D   V +EW++L+    SAEKE   KLGDICFSLRYVPT GKLTVV+LEAKNLKKMDVGGLSDPY KI LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQ++ +++TV+DYD+IG ++ IG+V +G N+SGT LR WSDMLANPRRPIAQW  L+
Sbjct:  150 FTENTLIVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPTFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDAIGDVKVPMNKVDFSHVTEEWRDLQ----SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYAKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVITVLDYDKIGKNDAIGKVFVGLNSSGTELRHWSDMLANPRRPIAQWHVLK 405          

HSP 2 Score: 80.8777 bits (198), Expect = 5.287e-16
Identity = 51/138 (36.96%), Postives = 78/138 (56.52%), Query Frame = 1
Query:  943 KELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNAS--GTALRQWSDM 1350
            KE EP     +++ KLG + +SL Y  T   L V +++A  L  MD+GG SDPYVK+ L+ + K+  + K   K  TLNP +NE F+F+VP+ ++    L++TV D+DR    + IG V +  N         +W D+
Sbjct:  129 KEAEP-----KEQEKLGKLQYSLDYNFTENTLIVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRK--TLNPTFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDAIGDVKVPMNKVDFSHVTEEWRDL 259          
BLAST of Synaptotagmin, putative vs. Ensembl Cavefish
Match: syt1a (synaptotagmin 1 [Source:NCBI gene;Acc:103044539])

HSP 1 Score: 334.339 bits (856), Expect = 6.010e-110
Identity = 184/260 (70.77%), Postives = 218/260 (83.85%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKEN--KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            FT+  L VGI+QA ELPA+DM GTSDPYVKV+L PDKKKKFETKVHRKTLNP F+E F FKVP++E+  KTL + +YDFDRFSKHD IG +++P+  +D   V +EW++L+    SAEKE   KLGDICFSLRYVPT GKLTVV+LEAKNLKKMDVGGLSDPY KI LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQ++ +++TV+DYD+IG ++ IG+V +G N+SGT LR WSDMLANPRRPIAQW  L+
Sbjct:  147 FTENTLIVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPTFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDAIGDVKVPMNKVDFSHVTEEWRDLQ----SAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYAKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVITVLDYDKIGKNDAIGKVFVGLNSSGTELRHWSDMLANPRRPIAQWHVLK 402          

HSP 2 Score: 80.8777 bits (198), Expect = 5.483e-16
Identity = 51/138 (36.96%), Postives = 78/138 (56.52%), Query Frame = 1
Query:  943 KELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNAS--GTALRQWSDM 1350
            KE EP     +++ KLG + +SL Y  T   L V +++A  L  MD+GG SDPYVK+ L+ + K+  + K   K  TLNP +NE F+F+VP+ ++    L++TV D+DR    + IG V +  N         +W D+
Sbjct:  126 KEAEP-----KEQEKLGKLQYSLDYNFTENTLIVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRK--TLNPTFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDAIGDVKVPMNKVDFSHVTEEWRDL 256          
BLAST of Synaptotagmin, putative vs. Ensembl Cavefish
Match: syt1b (synaptotagmin Ib [Source:ZFIN;Acc:ZDB-GENE-060503-166])

HSP 1 Score: 323.939 bits (829), Expect = 6.861e-106
Identity = 178/258 (68.99%), Postives = 214/258 (82.95%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            FT G L VGI+QA++L A+DM+GTSDPYVK++L PDKKKKFETKVHRKTLNP F+E F FKVP+SE+  KTL + +YDFDRFSKHD IG + + +  +D  QV +EW+ L+  K   E++ KLGDIC SLRYVPT GKLTVVVLEAKNLKKMDVGGLSDPYVKI LM NGKR+KKKKTTIKK TLNPYYNESFSFEVP EQIQ++ ++VTV+DYD+IG ++ IG+V +G ++SGT  R W+DMLANPRRPIAQW  L+
Sbjct:  149 FTDGSLIVGIIQAEDLAAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKTLNPTFNEHFTFKVPYSELGGKTLVMTVYDFDRFSKHDAIGDVRVQMNKVDFSQVTEEWRVLQ--KAEKEEQEKLGDICLSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKHTLNPYYNESFSFEVPSEQIQKVQVVVTVLDYDKIGKNDAIGKVFMGLHSSGTEQRHWADMLANPRRPIAQWHALK 404          

HSP 2 Score: 85.8853 bits (211), Expect = 1.150e-17
Identity = 54/148 (36.49%), Postives = 84/148 (56.76%), Query Frame = 1
Query:  871 KHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCN 1314
            K D  G L+  L S           + E  ++  ++E KLG + FSL Y  T+G L V +++A++L  MD+ G SDPYVK+ L+ + K+  + K   K  TLNP +NE F+F+VP+ ++    L++TV D+DR    + IG V +  N
Sbjct:  106 KEDSFGHLDHTLNS-------DTDSKAENKEEGPKEEQKLGKLQFSLDYHFTDGSLIVGIIQAEDLAAMDMSGTSDPYVKLYLLPDKKKKFETKVHRK--TLNPTFNEHFTFKVPYSELGGKTLVMTVYDFDRFSKHDAIGDVRVQMN 244          
BLAST of Synaptotagmin, putative vs. Ensembl Cavefish
Match: syt1b (synaptotagmin Ib [Source:ZFIN;Acc:ZDB-GENE-060503-166])

HSP 1 Score: 323.553 bits (828), Expect = 1.238e-105
Identity = 178/258 (68.99%), Postives = 214/258 (82.95%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            FT G L VGI+QA++L A+DM+GTSDPYVK++L PDKKKKFETKVHRKTLNP F+E F FKVP+SE+  KTL + +YDFDRFSKHD IG + + +  +D  QV +EW+ L+  K   E++ KLGDIC SLRYVPT GKLTVVVLEAKNLKKMDVGGLSDPYVKI LM NGKR+KKKKTTIKK TLNPYYNESFSFEVP EQIQ++ ++VTV+DYD+IG ++ IG+V +G ++SGT  R W+DMLANPRRPIAQW  L+
Sbjct:  152 FTDGSLIVGIIQAEDLAAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKTLNPTFNEHFTFKVPYSELGGKTLVMTVYDFDRFSKHDAIGDVRVQMNKVDFSQVTEEWRVLQ--KAEKEEQEKLGDICLSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKHTLNPYYNESFSFEVPSEQIQKVQVVVTVLDYDKIGKNDAIGKVFMGLHSSGTEQRHWADMLANPRRPIAQWHALK 407          

HSP 2 Score: 85.5001 bits (210), Expect = 1.814e-17
Identity = 48/121 (39.67%), Postives = 76/121 (62.81%), Query Frame = 1
Query:  952 EPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCN 1314
            E  ++  ++E KLG + FSL Y  T+G L V +++A++L  MD+ G SDPYVK+ L+ + K+  + K   K  TLNP +NE F+F+VP+ ++    L++TV D+DR    + IG V +  N
Sbjct:  129 ENKEEGPKEEQKLGKLQFSLDYHFTDGSLIVGIIQAEDLAAMDMSGTSDPYVKLYLLPDKKKKFETKVHRK--TLNPTFNEHFTFKVPYSELGGKTLVMTVYDFDRFSKHDAIGDVRVQMN 247          
BLAST of Synaptotagmin, putative vs. Ensembl Cavefish
Match: syt5b (synaptotagmin-1-like [Source:NCBI gene;Acc:103029888])

HSP 1 Score: 314.694 bits (805), Expect = 6.808e-102
Identity = 175/265 (66.04%), Postives = 219/265 (82.64%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKEN--KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPEK 1410
            FT+ +L VGILQAQ+L A+D+ GTSDPYVKVFL PDKKKKFETKV RK L PVF+E F+FK+P++E+  K L L +YDFDRF KHD IGQ++IP+  +DL Q + +W++LE    SAEKE   KLGD+C SLRYVPT GKLTV ++EAKNLKKMDVGGLSDP+VKI L  NGKR+KKKKTT+KK TLNPY+NESFSFE+PFEQIQ++ L++TV DYD++G+++PIG++ +G  A+G  LR WSDMLANPRRP+AQW TL  +PE+
Sbjct:  174 FTEAQLIVGILQAQDLAAMDIGGTSDPYVKVFLLPDKKKKFETKVQRKNLCPVFNETFIFKIPYAELGGKILVLLVYDFDRFGKHDVIGQIKIPMNCVDLGQPLHQWRDLE----SAEKEEQEKLGDVCISLRYVPTAGKLTVNIMEAKNLKKMDVGGLSDPFVKIVLQHNGKRLKKKKTTVKKNTLNPYFNESFSFEIPFEQIQKVQLLITVYDYDKLGSNDPIGKIFIGYGATGVGLRHWSDMLANPRRPVAQWHTL--LPEE 432          

HSP 2 Score: 83.5741 bits (205), Expect = 9.606e-17
Identity = 47/123 (38.21%), Postives = 74/123 (60.16%), Query Frame = 1
Query:  988 LGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIG--RVVLGCNASGTALRQWSDM 1350
            LG + FSL Y  T  +L V +L+A++L  MD+GG SDPYVK+ L+ + K+  + K   K   L P +NE+F F++P+ ++    L++ V D+DR G  + IG  ++ + C   G  L QW D+
Sbjct:  163 LGKLEFSLDYNFTEAQLIVGILQAQDLAAMDIGGTSDPYVKVFLLPDKKKKFETKVQRK--NLCPVFNETFIFKIPYAELGGKILVLLVYDFDRFGKHDVIGQIKIPMNCVDLGQPLHQWRDL 283          
BLAST of Synaptotagmin, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006908.1 (pep scaffold:Pmarinus_7.0:GL476344:649897:653668:1 gene:ENSPMAG00000006246.1 transcript:ENSPMAT00000006908.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 181.03 bits (458), Expect = 3.086e-55
Identity = 87/139 (62.59%), Postives = 113/139 (81.29%), Query Frame = 1
Query:  976 KENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTL 1392
            ++++LGDICFSLRY+P+ GKLT+V+LEA NLK MDV G SDPYVKI +M  G R+KKKKTT+KK  LNPY+NE+FSF++PFE I++I L+ +V+DYD +  ++ IG+V +GC A+G   R WSDMLANPRRPI QW TL
Sbjct:    6 QQDRLGDICFSLRYIPSTGKLTIVILEATNLKVMDVSGASDPYVKIQVMEGGIRLKKKKTTVKKKALNPYFNEAFSFDIPFENIEKIQLVFSVMDYDSLSRNDAIGKVYVGCGAAGAGHRHWSDMLANPRRPITQWHTL 144          

HSP 2 Score: 60.077 bits (144), Expect = 3.793e-11
Identity = 38/98 (38.78%), Postives = 60/98 (61.22%), Query Frame = 1
Query:  625 TKGELTVGILQAQELPALDMNGTSDPYXXXXXXX--XXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGS 912
            + G+LT+ IL+A  L  +D++G SDPYVK+ +     + KK +T V +K LNP F+E F F +PF  I    L   + D+D  S++D IG++ +  G+
Sbjct:   22 STGKLTIVILEATNLKVMDVSGASDPYVKIQVMEGGIRLKKKKTTVKKKALNPYFNEAFSFDIPFENIEKIQLVFSVMDYDSLSRNDAIGKVYVGCGA 119          
BLAST of Synaptotagmin, putative vs. Ensembl Sea Lamprey
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 139.043 bits (349), Expect = 1.527e-38
Identity = 79/120 (65.83%), Postives = 100/120 (83.33%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKE 981
            F   +LTVG++QA ELPALDM GTSDPYVK+FL PDKKKK+ETKVHRKTLNPVF+E F+FKVP+SE+  KTL + +YDFDRFSKHD IG++++P+ +IDL  V++EW++L     SAEKE
Sbjct:   91 FQNNQLTVGVIQAAELPALDMGGTSDPYVKLFLMPDKKKKYETKVHRKTLNPVFNESFVFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEVKVPMNTIDLGHVIEEWRDLV----SAEKE 206          

HSP 2 Score: 83.5741 bits (205), Expect = 1.063e-18
Identity = 49/125 (39.20%), Postives = 77/125 (61.60%), Query Frame = 1
Query:  988 LGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNAS--GTALRQWSDMLA 1356
            LG + FS+ Y   N +LTV V++A  L  +D+GG SDPYVK+ LM +  + KK +T + + TLNP +NESF F+VP+ ++    L++ V D+DR    + IG V +  N    G  + +W D+++
Sbjct:   80 LGKLQFSIDYDFQNNQLTVGVIQAAELPALDMGGTSDPYVKLFLMPD--KKKKYETKVHRKTLNPVFNESFVFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEVKVPMNTIDLGHVIEEWRDLVS 202          
BLAST of Synaptotagmin, putative vs. Ensembl Sea Lamprey
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 139.428 bits (350), Expect = 1.998e-38
Identity = 79/120 (65.83%), Postives = 100/120 (83.33%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKE 981
            F   +LTVG++QA ELPALDM GTSDPYVK+FL PDKKKK+ETKVHRKTLNPVF+E F+FKVP+SE+  KTL + +YDFDRFSKHD IG++++P+ +IDL  V++EW++L     SAEKE
Sbjct:  108 FQNNQLTVGVIQAAELPALDMGGTSDPYVKLFLMPDKKKKYETKVHRKTLNPVFNESFVFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEVKVPMNTIDLGHVIEEWRDLV----SAEKE 223          

HSP 2 Score: 86.2705 bits (212), Expect = 2.096e-19
Identity = 50/137 (36.50%), Postives = 81/137 (59.12%), Query Frame = 1
Query:  988 LGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNAS--GTALRQWSDMLANPRRPIAQWQTL 1392
            LG + FS+ Y   N +LTV V++A  L  +D+GG SDPYVK+ LM + K+  + K   K  TLNP +NESF F+VP+ ++    L++ V D+DR    + IG V +  N    G  + +W D+++  +  +++ + L
Sbjct:   97 LGKLQFSIDYDFQNNQLTVGVIQAAELPALDMGGTSDPYVKLFLMPDKKKKYETKVHRK--TLNPVFNESFVFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEVKVPMNTIDLGHVIEEWRDLVSAEKEEVSRARRL 231          
BLAST of Synaptotagmin, putative vs. Ensembl Sea Lamprey
Match: SYT5 (synaptotagmin 5 [Source:HGNC Symbol;Acc:HGNC:11513])

HSP 1 Score: 122.094 bits (305), Expect = 2.679e-32
Identity = 68/117 (58.12%), Postives = 88/117 (75.21%), Query Frame = 1
Query:  631 GELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPS-KDSAEK 978
             + TVGILQA +L A+D+ G SDPYV+V+L P KKKKFET VHRKTLNP+F+E F F VPF E+  + L + +YDFDRFS+HD IG+L IPL S+DL   V+EW++L+ + KD   K
Sbjct:   93 SQFTVGILQATDLAAMDIGGMSDPYVRVYLLPHKKKKFETSVHRKTLNPIFEEKFTFTVPFEELVERVLVMVVYDFDRFSRHDIIGELRIPLSSVDLSHSVEEWRDLQKTEKDDVSK 209          

HSP 2 Score: 87.4261 bits (215), Expect = 4.276e-20
Identity = 48/127 (37.80%), Postives = 74/127 (58.27%), Query Frame = 1
Query:  976 KENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIG--RVVLGCNASGTALRQWSDM 1350
            KEN LG + FSL Y     + TV +L+A +L  MD+GG+SDPYV++ L+ + K+  +     K  TLNP + E F+F VPFE++    L++ V D+DR    + IG  R+ L       ++ +W D+
Sbjct:   75 KENTLGRLQFSLDYNLKTSQFTVGILQATDLAAMDIGGMSDPYVRVYLLPHKKKKFETSVHRK--TLNPIFEEKFTFTVPFEELVERVLVMVVYDFDRFSRHDIIGELRIPLSSVDLSHSVEEWRDL 199          
BLAST of Synaptotagmin, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000226.1 (pep scaffold:Pmarinus_7.0:GL478944:1404:4221:1 gene:ENSPMAG00000000205.1 transcript:ENSPMAT00000000226.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.309 bits (277), Expect = 2.504e-29
Identity = 68/137 (49.64%), Postives = 90/137 (65.69%), Query Frame = 1
Query:  991 GDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLS-DPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQE 1398
            G+I  SL Y P   +LTVVVL+A++L K D+ GLS DPYVK+++    +R  KKKT +KKCTLNP +NESF FE+P E +  + + +TVVD+DR    E IGR+ LG    GT    W ++  NPRR IA+W  L E
Sbjct:    6 GEILVSLCYHPAASRLTVVVLKARHLPKTDIVGLSVDPYVKVNIYSGKRRFAKKKTHVKKCTLNPVFNESFVFELPEEGLSDLAVELTVVDFDRTTKDEVIGRLALG---PGT--EHWREVCENPRRQIAKWHPLSE 137          

HSP 2 Score: 59.6918 bits (143), Expect = 3.691e-11
Identity = 42/108 (38.89%), Postives = 66/108 (61.11%), Query Frame = 1
Query:  637 LTVGILQAQELPALDMNGTS-DPYXXXXXXXXXXXXXXXXXHRK--TLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKEL 951
            LTV +L+A+ LP  D+ G S DPYVKV +   K++  + K H K  TLNPVF+E F+F++P   ++   + L + DFDR +K + IG+L +  G+       + W+E+
Sbjct:   21 LTVVVLKARHLPKTDIVGLSVDPYVKVNIYSGKRRFAKKKTHVKKCTLNPVFNESFVFELPEEGLSDLAVELTVVDFDRTTKDEVIGRLALGPGT-------EHWREV 121          
BLAST of Synaptotagmin, putative vs. Ensembl Nematostella
Match: EDO31746 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX17])

HSP 1 Score: 279.256 bits (713), Expect = 7.973e-90
Identity = 153/262 (58.40%), Postives = 208/262 (79.39%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFK-VPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEP---SKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            FT   LTVGI++A+++PA D +G+SDPYVK+ L PDKKKK+ETKVHRKTLNPVF+E F+FK +P+SEIT++ L + ++DFDRFS+HD IG+  +PL  +DL   + EW+ L P   S  +   ++ LGDICFSLRYVP++GKL + ++EAK+LK MD+ G SDPYVKI+L+  G++IKKKKTT+KK TLNPYYNE+F+F V FE+I++ +LI++V+DYDR+G SE IG+ V+G  +SG  LR W+DMLA+PRR +AQW TL 
Sbjct:   95 FTDNTLTVGIIRAEDIPAKDFSGSSDPYVKIMLLPDKKKKYETKVHRKTLNPVFNEQFVFKNIPYSEITNRILLMELFDFDRFSRHDLIGEARLPLIDVDLASNINEWRVLTPPSGSGGAGHSKSDLGDICFSLRYVPSSGKLQITIVEAKSLKSMDLTGYSDPYVKIALVQEGRKIKKKKTTVKKRTLNPYYNETFTFTVAFEKIEQTSLIISVLDYDRVGKSEMIGKCVVGELSSGADLRHWADMLASPRRSVAQWHTLH 356          

HSP 2 Score: 63.929 bits (154), Expect = 5.026e-11
Identity = 41/108 (37.96%), Postives = 63/108 (58.33%), Query Frame = 1
Query:  985 KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFE-VPFEQIQRINLIVTVVDYDRIGTSEPIGRVVL 1305
            K+G I F+L Y  T+  LTV ++ A+++   D  G SDPYVKI L+ + K+  + K   K  TLNP +NE F F+ +P+ +I    L++ + D+DR    + IG   L
Sbjct:   83 KIGRINFTLDYSFTDNTLTVGIIRAEDIPAKDFSGSSDPYVKIMLLPDKKKKYETKVHRK--TLNPVFNEQFVFKNIPYSEITNRILLMELFDFDRFSRHDLIGEARL 188          
BLAST of Synaptotagmin, putative vs. Ensembl Nematostella
Match: EDO43704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXY7])

HSP 1 Score: 214.157 bits (544), Expect = 8.181e-66
Identity = 128/256 (50.00%), Postives = 184/256 (71.88%), Query Frame = 1
Query:  637 LTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFK-VPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEW-KELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQE 1398
            LT+ +L+AQ LPA D +GTSDP+VK+ L PDKK K ET+V RK LNPV++EVF F+  P +++  KTL + + D+DRFS++D IG++EIPL +IDL  V   + K+L P K   +    LGD+  SL Y PTN ++ VVV++A  LK MD+ G SDPYVK+ +M   +R+ KKKTTIK+ T +P +NESF F+VP ++I+ +  +  V+DYDRI  +E IG+V+LG   +G++LR W++M+ NPR+P+AQW  LQ+
Sbjct:   19 LTLKVLKAQGLPAKDFSGTSDPFVKIMLLPDKKHKLETRVKRKNLNPVWNEVFTFEGFPHNKLMGKTLYMQVLDYDRFSRNDPIGEVEIPLENIDLGPVTLTFTKDLLPCK---KDRVPLGDLLVSLMYQPTNNRIIVVVMKANKLKAMDLTGSSDPYVKMYIMHKDRRLDKKKTTIKRRTRDPVWNESFIFDVPLDKIRDLTFVFNVMDYDRITQNELIGQVILGYRTTGSSLRHWTEMMNNPRKPVAQWHRLQD 271          

HSP 2 Score: 69.3218 bits (168), Expect = 4.062e-13
Identity = 43/106 (40.57%), Postives = 62/106 (58.49%), Query Frame = 1
Query:  985 KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFE-VPFEQIQRINLIVTVVDYDRIGTSEPIGRV 1299
            +LG I FSL Y  ++  LT+ VL+A+ L   D  G SDP+VKI L+ + K   + +   K   LNP +NE F+FE  P  ++    L + V+DYDR   ++PIG V
Sbjct:    2 QLGKIFFSLTYYSSDSVLTLKVLKAQGLPAKDFSGTSDPFVKIMLLPDKKHKLETRVKRK--NLNPVWNEVFTFEGFPHNKLMGKTLYMQVLDYDRFSRNDPIGEV 105          

HSP 3 Score: 61.6178 bits (148), Expect = 1.386e-10
Identity = 40/121 (33.06%), Postives = 70/121 (57.85%), Query Frame = 1
Query:  625 TKGELTVGILQAQELPALDMNGTSDPYXXX--XXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKEL--EPSKDSAE 975
            T   + V +++A +L A+D+ G+SDPYVK+    K  +  K +T + R+T +PV++E F+F VP  +I   T   ++ D+DR ++++ IGQ  + LG       ++ W E+   P K  A+
Sbjct:  147 TNNRIIVVVMKANKLKAMDLTGSSDPYVKMYIMHKDRRLDKKKTTIKRRTRDPVWNESFIFDVPLDKIRDLTFVFNVMDYDRITQNELIGQ--VILGYRTTGSSLRHWTEMMNNPRKPVAQ 265          
BLAST of Synaptotagmin, putative vs. Ensembl Nematostella
Match: EDO41933 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S352])

HSP 1 Score: 139.428 bits (350), Expect = 1.600e-37
Identity = 98/259 (37.84%), Postives = 143/259 (55.21%), Query Frame = 1
Query:  634 ELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRK--TLNPVFDEVF-LFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEM 1401
             L V +  A+ L  +D  GTSDPYVK+ L P   K  + + H K  TLNPVF+E    + +   EI+SKTL L ++D D   ++D IG+  I L  ++     Q +K     K      + LG I  +L+Y    G L V V+    L  MD  G SDPYVK  L  + ++  K++T I+K TLNP +NE F +++   ++ + +L VTV DYD   +++ IG V+L  NA G+AL+ W DML  P +   QW TL+ +
Sbjct:   34 RLDVVLHDAKGLKPMDHGGTSDPYVKLHLLPGASKSNKLRSHTKYKTLNPVFNETLTYYGITEEEISSKTLRLQVFDEDTIGRNDFIGETSINLKLLN-SNPTQTFKRSLIPKALDSPHSPLGRIQLALKYNTQRGMLFVTVMRCSGLASMDANGYSDPYVKCYLKPDPQKKSKRRTNIRKKTLNPEFNEEFVYDIAHHELAKKSLEVTVWDYDVGKSNDFIGGVILNINAEGSALKHWYDMLKGPNQLHTQWHTLENV 291          

HSP 2 Score: 71.633 bits (174), Expect = 8.407e-14
Identity = 50/140 (35.71%), Postives = 75/140 (53.57%), Query Frame = 1
Query:  988 LGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFS-FEVPFEQIQRINLIVTVVDYDRIGTSEPIGRV-----VLGCNASGTALRQW-SDMLANPRRPIAQWQ 1386
            LG + F+LRY   + +L VV+ +AK LK MD GG SDPYVK+ L+    +  K ++  K  TLNP +NE+ + + +  E+I    L + V D D IG ++ IG       +L  N + T  R      L +P  P+ + Q
Sbjct:   19 LGLLEFTLRYQKLDSRLDVVLHDAKGLKPMDHGGTSDPYVKLHLLPGASKSNKLRSHTKYKTLNPVFNETLTYYGITEEEISSKTLRLQVFDEDTIGRNDFIGETSINLKLLNSNPTQTFKRSLIPKALDSPHSPLGRIQ 158          
BLAST of Synaptotagmin, putative vs. Ensembl Nematostella
Match: EDO31747 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX18])

HSP 1 Score: 135.191 bits (339), Expect = 2.810e-35
Identity = 84/224 (37.50%), Postives = 130/224 (58.04%), Query Frame = 1
Query:  760 RKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQ--VVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNL---------KKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGT-SEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            RKT  P ++E F F +   ++    L L + + DR+S+H  IGQ+++ LG + L    V  E + LE  K        LGD+  SL Y+PT  +L+VV+++A+NL         +  D+     P+VK+ L+ +G+++KKKKT+ +K   NP YNES  F++P   + R+ L+++V D       S+ IGRVV+G  +SG AL  W+ ML +PRRPIA W  L+
Sbjct:  142 RKTTEPYYNETFQFSIEMEKLADAILSLLVMEVDRYSRHHVIGQIDLELGDVVLANQMVAMEMEILEAYKSRL----GLGDLLVSLSYMPTAERLSVVIMKARNLNPPFSEWSSQPRDIS----PFVKVVLLFDGQKVKKKKTSTRKQEKNPVYNESMLFDIPPHFLHRVILLISVADKPSDSRRSDIIGRVVIGSPSSGEALSHWNQMLVSPRRPIAAWHKLR 357          
BLAST of Synaptotagmin, putative vs. Ensembl Nematostella
Match: EDO50013 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF18])

HSP 1 Score: 132.109 bits (331), Expect = 5.922e-35
Identity = 83/219 (37.90%), Postives = 137/219 (62.56%), Query Frame = 1
Query:  763 KTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAE-----KENKL--GDICFSLRYVPTNGKLTVVVLEAK-NLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNA-SGTALRQWSDMLANPRRPIAQWQTL 1392
            K  NPVF+E F F V FSE+  +TL   I D+D +S+H  +G++     S D+   +QE   +   KD        +EN++  G++  SL Y+PT+G+LT VVL+A+ +++ +    LSDP+VK+SLM++G++IKK KT++   TL P YNE+F F++P E++  ++L+V ++  D     + I + V+G ++ +   L  W+ M+ +PR+PIAQW  L
Sbjct:   69 KNSNPVFNETFEFDVAFSELPERTLQFCINDYDGYSRHQALGEV---FHSFDVNVNMQEDTVVIYEKDIRRDIFTFRENQVRKGEVLLSLCYLPTSGRLTFVVLKARLSMRLLFRYSLSDPFVKVSLMVSGRQIKKTKTSVMHGTLRPVYNEAFVFDIPVERLSDVSLLVRMLHSDG-KRCQTIAKTVVGPDSQTSIGLHHWNCMMTSPRKPIAQWHPL 283          
BLAST of Synaptotagmin, putative vs. Ensembl Medaka
Match: syt1a (synaptotagmin 1 [Source:NCBI gene;Acc:101166921])

HSP 1 Score: 338.961 bits (868), Expect = 1.329e-111
Identity = 187/260 (71.92%), Postives = 219/260 (84.23%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKEN--KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            FT+  L VGI+QA ELPA+DM GTSDPYVKV+L PDKKKKFETKVHRKTLNPVF+E F FKVP+ E+  KTL + +YDFDRFSKHD IG +++P+  +D   V +EW++L+    SAEKE   KLGDICFSLRYVPT GKLTVVVLEAKNLKKMDVGGLSDPYVKI LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQ++ +++TV+DYD+IG ++ IG+V +G N+SGT LR WSDMLANPRRPIAQW  L+
Sbjct:  154 FTENTLMVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYVELGGKTLVMTVYDFDRFSKHDAIGDIKVPMNKVDFSHVTEEWRDLQ----SAEKEEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVITVLDYDKIGKNDAIGKVFVGLNSSGTELRHWSDMLANPRRPIAQWHVLK 409          

HSP 2 Score: 79.7221 bits (195), Expect = 1.421e-15
Identity = 50/136 (36.76%), Postives = 78/136 (57.35%), Query Frame = 1
Query:  952 EPSKDSAEKEN-KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNAS--GTALRQWSDM 1350
            E  K++  KE+ KLG + +SL Y  T   L V +++A  L  MD+GG SDPYVK+ L+ + K+  + K   K  TLNP +NE F+F+VP+ ++    L++TV D+DR    + IG + +  N         +W D+
Sbjct:  130 ETEKEAEPKESEKLGKLQYSLDYNFTENTLMVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRK--TLNPVFNEQFTFKVPYVELGGKTLVMTVYDFDRFSKHDAIGDIKVPMNKVDFSHVTEEWRDL 263          
BLAST of Synaptotagmin, putative vs. Ensembl Medaka
Match: syt1a (synaptotagmin 1 [Source:NCBI gene;Acc:101166921])

HSP 1 Score: 338.961 bits (868), Expect = 1.329e-111
Identity = 187/260 (71.92%), Postives = 219/260 (84.23%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKEN--KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            FT+  L VGI+QA ELPA+DM GTSDPYVKV+L PDKKKKFETKVHRKTLNPVF+E F FKVP+ E+  KTL + +YDFDRFSKHD IG +++P+  +D   V +EW++L+    SAEKE   KLGDICFSLRYVPT GKLTVVVLEAKNLKKMDVGGLSDPYVKI LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQ++ +++TV+DYD+IG ++ IG+V +G N+SGT LR WSDMLANPRRPIAQW  L+
Sbjct:  154 FTENTLMVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYVELGGKTLVMTVYDFDRFSKHDAIGDIKVPMNKVDFSHVTEEWRDLQ----SAEKEEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVITVLDYDKIGKNDAIGKVFVGLNSSGTELRHWSDMLANPRRPIAQWHVLK 409          

HSP 2 Score: 79.7221 bits (195), Expect = 1.421e-15
Identity = 50/136 (36.76%), Postives = 78/136 (57.35%), Query Frame = 1
Query:  952 EPSKDSAEKEN-KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNAS--GTALRQWSDM 1350
            E  K++  KE+ KLG + +SL Y  T   L V +++A  L  MD+GG SDPYVK+ L+ + K+  + K   K  TLNP +NE F+F+VP+ ++    L++TV D+DR    + IG + +  N         +W D+
Sbjct:  130 ETEKEAEPKESEKLGKLQYSLDYNFTENTLMVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRK--TLNPVFNEQFTFKVPYVELGGKTLVMTVYDFDRFSKHDAIGDIKVPMNKVDFSHVTEEWRDL 263          
BLAST of Synaptotagmin, putative vs. Ensembl Medaka
Match: syt1a (synaptotagmin 1 [Source:NCBI gene;Acc:101166921])

HSP 1 Score: 338.961 bits (868), Expect = 1.329e-111
Identity = 187/260 (71.92%), Postives = 219/260 (84.23%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKEN--KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            FT+  L VGI+QA ELPA+DM GTSDPYVKV+L PDKKKKFETKVHRKTLNPVF+E F FKVP+ E+  KTL + +YDFDRFSKHD IG +++P+  +D   V +EW++L+    SAEKE   KLGDICFSLRYVPT GKLTVVVLEAKNLKKMDVGGLSDPYVKI LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQ++ +++TV+DYD+IG ++ IG+V +G N+SGT LR WSDMLANPRRPIAQW  L+
Sbjct:  154 FTENTLMVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYVELGGKTLVMTVYDFDRFSKHDAIGDIKVPMNKVDFSHVTEEWRDLQ----SAEKEEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVITVLDYDKIGKNDAIGKVFVGLNSSGTELRHWSDMLANPRRPIAQWHVLK 409          

HSP 2 Score: 79.7221 bits (195), Expect = 1.421e-15
Identity = 50/136 (36.76%), Postives = 78/136 (57.35%), Query Frame = 1
Query:  952 EPSKDSAEKEN-KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNAS--GTALRQWSDM 1350
            E  K++  KE+ KLG + +SL Y  T   L V +++A  L  MD+GG SDPYVK+ L+ + K+  + K   K  TLNP +NE F+F+VP+ ++    L++TV D+DR    + IG + +  N         +W D+
Sbjct:  130 ETEKEAEPKESEKLGKLQYSLDYNFTENTLMVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRK--TLNPVFNEQFTFKVPYVELGGKTLVMTVYDFDRFSKHDAIGDIKVPMNKVDFSHVTEEWRDL 263          
BLAST of Synaptotagmin, putative vs. Ensembl Medaka
Match: syt1a (synaptotagmin 1 [Source:NCBI gene;Acc:101166921])

HSP 1 Score: 338.191 bits (866), Expect = 6.502e-110
Identity = 187/260 (71.92%), Postives = 219/260 (84.23%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKEN--KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            FT+  L VGI+QA ELPA+DM GTSDPYVKV+L PDKKKKFETKVHRKTLNPVF+E F FKVP+ E+  KTL + +YDFDRFSKHD IG +++P+  +D   V +EW++L+    SAEKE   KLGDICFSLRYVPT GKLTVVVLEAKNLKKMDVGGLSDPYVKI LM NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQ++ +++TV+DYD+IG ++ IG+V +G N+SGT LR WSDMLANPRRPIAQW  L+
Sbjct:  268 FTENTLMVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYVELGGKTLVMTVYDFDRFSKHDAIGDIKVPMNKVDFSHVTEEWRDLQ----SAEKEEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVITVLDYDKIGKNDAIGKVFVGLNSSGTELRHWSDMLANPRRPIAQWHVLK 523          

HSP 2 Score: 79.7221 bits (195), Expect = 2.329e-15
Identity = 50/136 (36.76%), Postives = 78/136 (57.35%), Query Frame = 1
Query:  952 EPSKDSAEKEN-KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNAS--GTALRQWSDM 1350
            E  K++  KE+ KLG + +SL Y  T   L V +++A  L  MD+GG SDPYVK+ L+ + K+  + K   K  TLNP +NE F+F+VP+ ++    L++TV D+DR    + IG + +  N         +W D+
Sbjct:  244 ETEKEAEPKESEKLGKLQYSLDYNFTENTLMVGIIQAAELPAMDMGGTSDPYVKVYLLPDKKKKFETKVHRK--TLNPVFNEQFTFKVPYVELGGKTLVMTVYDFDRFSKHDAIGDIKVPMNKVDFSHVTEEWRDL 377          
BLAST of Synaptotagmin, putative vs. Ensembl Medaka
Match: syt1b (synaptotagmin-1-like [Source:NCBI gene;Acc:101162836])

HSP 1 Score: 319.316 bits (817), Expect = 3.092e-104
Identity = 174/258 (67.44%), Postives = 215/258 (83.33%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQ 1395
            FT+  L VG+L+A ELPA+D+ G+SDPYVK++L PDKKK+FETKVHRKTL P F+E F FKVP++E+  +TL + +YDFDRFSKHD IG ++IP+  +D  Q +QEW++L+  K   E+  +LGDIC SLRYVPT GKLTVV+LEAKNLKKMDVGGLSDPYVKI LM NGKR+KKKKTTIKK TLNPYYNESFSFEVP EQI+++ + VTV+DYD+IG ++ IG+V+LG N+SGT  R WSDMLANPRRPIAQW +L+
Sbjct:  139 FTENTLVVGVLEASELPAMDVGGSSDPYVKLYLLPDKKKRFETKVHRKTLEPTFNETFTFKVPYTEMGGRTLVMTVYDFDRFSKHDAIGAVKIPMRGVDFSQSMQEWRDLQ--KAEKEESERLGDICLSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPCEQIEKVQVAVTVLDYDKIGKNDAIGKVLLGGNSSGTEQRHWSDMLANPRRPIAQWHSLK 394          

HSP 2 Score: 85.5001 bits (210), Expect = 1.720e-17
Identity = 54/139 (38.85%), Postives = 84/139 (60.43%), Query Frame = 1
Query:  943 KELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVL---GCNASGTALRQWSDM 1350
            KE   S++  +++ KLG + F+L Y  T   L V VLEA  L  MDVGG SDPYVK+ L+ + K+  + K   K  TL P +NE+F+F+VP+ ++    L++TV D+DR    + IG V +   G + S  ++++W D+
Sbjct:  113 KETALSENELKEDEKLGRLHFTLDYNFTENTLVVGVLEASELPAMDVGGSSDPYVKLYLLPDKKKRFETKVHRK--TLEPTFNETFTFKVPYTEMGGRTLVMTVYDFDRFSKHDAIGAVKIPMRGVDFS-QSMQEWRDL 248          
BLAST of Synaptotagmin, putative vs. Planmine SMEST
Match: SMESG000021478.1 (SMESG000021478.1)

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 399/401 (99.50%), Postives = 400/401 (99.75%), Query Frame = 1
Query:  208 MTETKMKFHANFTASTTSGKTSTNAAKEKFQEIITYLSKKMKVPPWAVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNATKNMKIIGGAVDNKTQSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPEK 1410
            MTETKMKFHANFTASTTS KTSTNAAKEKFQEIITYLSKKMKVPPWAVYAIGVAIILVILIIFFCLIKICCCKRRKKSKGGGKKGKNATKNMKIIGGAVDNKTQSDEEDLVLDKDDDNEKKEEEKEYLGKLEYKLDYDFTKGELTVGILQAQELPALDMNGTSDPYVKVFLKPDKKKKFETKVHRKTLNPVFDEVFLFKVPF+EITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGKRIKKKKTTIKKCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPEK
Sbjct:    1 MTETKMKFHANFTASTTSSKTSTNAAKEKFQEIITYLSKKMKVPPWAVYAIGVAIILVILIIFFCLIKICCCKRRKKSKGGGKKGKNATKNMKIIGGAVDNKTQSDEEDLVLDKDDDNEKKEEEKEYLGKLEYKLDYDFTKGELTVGILQAQELPALDMNGTSDPYVKVFLKPDKKKKFETKVHRKTLNPVFDEVFLFKVPFAEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGKRIKKKKTTIKKCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPEK 401          
BLAST of Synaptotagmin, putative vs. Planmine SMEST
Match: SMESG000021478.1 (SMESG000021478.1)

HSP 1 Score: 556.599 bits (1433), Expect = 0.000e+0
Identity = 394/396 (99.49%), Postives = 395/396 (99.75%), Query Frame = 1
Query:  223 MKFHANFTASTTSGKTSTNAAKEKFQEIITYLSKKMKVPPWAVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNATKNMKIIGGAVDNKTQSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPEK 1410
            MKFHANFTASTTS KTSTNAAKEKFQEIITYLSKKMKVPPWAVYAIGVAIILVILIIFFCLIKICCCKRRKKSKGGGKKGKNATKNMKIIGGAVDNKTQSDEEDLVLDKDDDNEKKEEEKEYLGKLEYKLDYDFTKGELTVGILQAQELPALDMNGTSDPYVKVFLKPDKKKKFETKVHRKTLNPVFDEVFLFKVPF+EITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGKRIKKKKTTIKKCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPEK
Sbjct:    1 MKFHANFTASTTSSKTSTNAAKEKFQEIITYLSKKMKVPPWAVYAIGVAIILVILIIFFCLIKICCCKRRKKSKGGGKKGKNATKNMKIIGGAVDNKTQSDEEDLVLDKDDDNEKKEEEKEYLGKLEYKLDYDFTKGELTVGILQAQELPALDMNGTSDPYVKVFLKPDKKKKFETKVHRKTLNPVFDEVFLFKVPFAEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGKRIKKKKTTIKKCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPEK 396          
BLAST of Synaptotagmin, putative vs. Planmine SMEST
Match: SMESG000055143.1 (SMESG000055143.1)

HSP 1 Score: 409.838 bits (1052), Expect = 8.323e-140
Identity = 214/263 (81.37%), Postives = 244/263 (92.78%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPEK 1410
            FTKGELTVG++QA +LPA+DM+GTSDPYVKVFL PDKKKKFETKVHRK LNPVF+E F+FK+P+SE+ SKTL  +++DFDRFSKHDQIGQ++IPLGS+DLC+V++EWKEL P     EKEN+LGDICFSLRYVPT+GKL +V+LEAKNLKKMDVGGLSDPYVK+SLM+NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQ++NLIVTVVDYDRIGTSEPIGRVVLGCNA+G  LR WSDMLANPRRPIAQW TLQ+MPEK
Sbjct:  141 FTKGELTVGVVQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEK 403          

HSP 2 Score: 76.2554 bits (186), Expect = 1.187e-14
Identity = 47/137 (34.31%), Postives = 80/137 (58.39%), Query Frame = 1
Query:  949 LEPSKDSAEKEN-KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVV--LGCNASGTALRQWSDM 1350
            +E ++ + +KE   LG + +SL Y  T G+LTV V++A +L  MD+ G SDPYVK+ L+ + K+  + K   K   LNP +NE+F F++P+ ++    L+  V D+DR    + IG++   LG       + +W ++
Sbjct:  116 MEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVVQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRK--ILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKEL 250          
BLAST of Synaptotagmin, putative vs. Planmine SMEST
Match: SMESG000055143.1 (SMESG000055143.1)

HSP 1 Score: 410.223 bits (1053), Expect = 1.009e-139
Identity = 214/263 (81.37%), Postives = 244/263 (92.78%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPEK 1410
            FTKGELTVG++QA +LPA+DM+GTSDPYVKVFL PDKKKKFETKVHRK LNPVF+E F+FK+P+SE+ SKTL  +++DFDRFSKHDQIGQ++IPLGS+DLC+V++EWKEL P     EKEN+LGDICFSLRYVPT+GKL +V+LEAKNLKKMDVGGLSDPYVK+SLM+NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQ++NLIVTVVDYDRIGTSEPIGRVVLGCNA+G  LR WSDMLANPRRPIAQW TLQ+MPEK
Sbjct:  157 FTKGELTVGVVQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEK 419          

HSP 2 Score: 76.2554 bits (186), Expect = 1.247e-14
Identity = 47/137 (34.31%), Postives = 80/137 (58.39%), Query Frame = 1
Query:  949 LEPSKDSAEKEN-KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVV--LGCNASGTALRQWSDM 1350
            +E ++ + +KE   LG + +SL Y  T G+LTV V++A +L  MD+ G SDPYVK+ L+ + K+  + K   K   LNP +NE+F F++P+ ++    L+  V D+DR    + IG++   LG       + +W ++
Sbjct:  132 MEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVVQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRK--ILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKEL 266          
BLAST of Synaptotagmin, putative vs. Planmine SMEST
Match: SMESG000055143.1 (SMESG000055143.1)

HSP 1 Score: 409.838 bits (1052), Expect = 1.134e-139
Identity = 214/263 (81.37%), Postives = 244/263 (92.78%), Query Frame = 1
Query:  622 FTKGELTVGILQAQELPALDMNGTSDPYXXXXXXXXXXXXXXXXXHRKTLNPVFDEVFLFKVPFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEPSKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPEK 1410
            FTKGELTVG++QA +LPA+DM+GTSDPYVKVFL PDKKKKFETKVHRK LNPVF+E F+FK+P+SE+ SKTL  +++DFDRFSKHDQIGQ++IPLGS+DLC+V++EWKEL P     EKEN+LGDICFSLRYVPT+GKL +V+LEAKNLKKMDVGGLSDPYVK+SLM+NGKR+KKKKTTIKK TLNPYYNESFSFEVPFEQIQ++NLIVTVVDYDRIGTSEPIGRVVLGCNA+G  LR WSDMLANPRRPIAQW TLQ+MPEK
Sbjct:  145 FTKGELTVGVVQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKELGPPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNATGAELRHWSDMLANPRRPIAQWHTLQDMPEK 407          

HSP 2 Score: 76.2554 bits (186), Expect = 1.316e-14
Identity = 47/137 (34.31%), Postives = 80/137 (58.39%), Query Frame = 1
Query:  949 LEPSKDSAEKEN-KLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYVKISLMMNGXXXXXXXXXXXXCTLNPYYNESFSFEVPFEQIQRINLIVTVVDYDRIGTSEPIGRVV--LGCNASGTALRQWSDM 1350
            +E ++ + +KE   LG + +SL Y  T G+LTV V++A +L  MD+ G SDPYVK+ L+ + K+  + K   K   LNP +NE+F F++P+ ++    L+  V D+DR    + IG++   LG       + +W ++
Sbjct:  120 MEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVVQATDLPAMDMSGTSDPYVKVFLLPDKKKKFETKVHRK--ILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQIGQIQIPLGSVDLCKVIEEWKEL 254          
The following BLAST results are available for this feature:
BLAST of Synaptotagmin, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYT15.833e-11172.69synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509... [more]
SYT15.948e-11172.69synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509... [more]
SYT15.948e-11172.69synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509... [more]
SYT15.948e-11172.69synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509... [more]
SYT21.316e-10869.38synaptotagmin 2 [Source:HGNC Symbol;Acc:HGNC:11510... [more]
back to top
BLAST of Synaptotagmin, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snt-13.267e-11971.10Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snt-11.766e-10564.91Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snt-31.551e-9463.04SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5... [more]
snt-31.551e-9463.04SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5... [more]
snt-21.418e-7149.81Synaptotagmin 2 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
back to top
BLAST of Synaptotagmin, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syt13.355e-11572.35gene:FBgn0004242 transcript:FBtr0077726[more]
Syt13.365e-11572.35gene:FBgn0004242 transcript:FBtr0077728[more]
Syt13.365e-11572.35gene:FBgn0004242 transcript:FBtr0345331[more]
Syt13.365e-11572.35gene:FBgn0004242 transcript:FBtr0077727[more]
Syt18.684e-11572.35gene:FBgn0004242 transcript:FBtr0343993[more]
back to top
BLAST of Synaptotagmin, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt1a9.191e-11171.54synaptotagmin Ia [Source:ZFIN;Acc:ZDB-GENE-040718-... [more]
syt1a9.191e-11171.54synaptotagmin Ia [Source:ZFIN;Acc:ZDB-GENE-040718-... [more]
syt5a1.215e-10265.50synaptotagmin Va [Source:ZFIN;Acc:ZDB-GENE-040718-... [more]
syt2a6.770e-10266.15synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
syt2a6.770e-10266.15synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
back to top
BLAST of Synaptotagmin, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYT55.536e-11371.15synaptotagmin 5 [Source:NCBI gene;Acc:100493612][more]
SYT57.271e-11371.15synaptotagmin 5 [Source:NCBI gene;Acc:100493612][more]
luzp22.473e-11169.62leucine zipper protein 2 [Source:Xenbase;Acc:XB-GE... [more]
e2f43.583e-10972.20E2F transcription factor 4 [Source:Xenbase;Acc:XB-... [more]
syt84.100e-9257.25synaptotagmin 8 [Source:NCBI gene;Acc:100037878][more]
back to top
BLAST of Synaptotagmin, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syt13.513e-11172.69synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667][more]
Syt13.513e-11172.69synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667][more]
Syt29.014e-10969.38synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666][more]
Syt29.014e-10969.38synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666][more]
Syt51.002e-9362.02synaptotagmin V [Source:MGI Symbol;Acc:MGI:1926368... [more]
back to top
BLAST of Synaptotagmin, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P41823|SY65_APLCA5.071e-12576.43Synaptotagmin-1 OS=Aplysia californica OX=6500 GN=... [more]
sp|P34693|SYT1_CAEEL4.156e-11871.10Synaptotagmin-1 OS=Caenorhabditis elegans OX=6239 ... [more]
sp|P21521|SY65_DROME3.363e-11472.35Synaptotagmin 1 OS=Drosophila melanogaster OX=7227... [more]
sp|Q5R4J5|SYT1_PONAB1.567e-11172.31Synaptotagmin-1 OS=Pongo abelii OX=9601 GN=SYT1 PE... [more]
sp|P21707|SYT1_RAT2.405e-11072.69Synaptotagmin-1 OS=Rattus norvegicus OX=10116 GN=S... [more]
back to top
BLAST of Synaptotagmin, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q9U8R63.563e-13480.92Djsyt protein OS=Dugesia japonica OX=6161 GN=Djsyt... [more]
A0A183K2R82.556e-13176.43Uncharacterized protein OS=Schistosoma curassoni O... [more]
A0A267E6V13.882e-13177.19Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267E3333.968e-13177.19Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GS865.376e-13177.19Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Synaptotagmin, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt1a4.246e-11070.77synaptotagmin 1 [Source:NCBI gene;Acc:103044539][more]
syt1a6.010e-11070.77synaptotagmin 1 [Source:NCBI gene;Acc:103044539][more]
syt1b6.861e-10668.99synaptotagmin Ib [Source:ZFIN;Acc:ZDB-GENE-060503-... [more]
syt1b1.238e-10568.99synaptotagmin Ib [Source:ZFIN;Acc:ZDB-GENE-060503-... [more]
syt5b6.808e-10266.04synaptotagmin-1-like [Source:NCBI gene;Acc:1030298... [more]
back to top
BLAST of Synaptotagmin, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006908.13.086e-5562.59pep scaffold:Pmarinus_7.0:GL476344:649897:653668:1... [more]
syt2a1.527e-3865.83synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
syt2a1.998e-3865.83synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
SYT52.679e-3258.12synaptotagmin 5 [Source:HGNC Symbol;Acc:HGNC:11513... [more]
ENSPMAT00000000226.12.504e-2949.64pep scaffold:Pmarinus_7.0:GL478944:1404:4221:1 gen... [more]
back to top
BLAST of Synaptotagmin, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synaptotagmin, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO317467.973e-9058.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437048.181e-6650.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419331.600e-3737.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317472.810e-3537.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500135.922e-3537.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Synaptotagmin, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt1a1.329e-11171.92synaptotagmin 1 [Source:NCBI gene;Acc:101166921][more]
syt1a1.329e-11171.92synaptotagmin 1 [Source:NCBI gene;Acc:101166921][more]
syt1a1.329e-11171.92synaptotagmin 1 [Source:NCBI gene;Acc:101166921][more]
syt1a6.502e-11071.92synaptotagmin 1 [Source:NCBI gene;Acc:101166921][more]
syt1b3.092e-10467.44synaptotagmin-1-like [Source:NCBI gene;Acc:1011628... [more]
back to top
BLAST of Synaptotagmin, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021478.10.000e+099.50SMESG000021478.1[more]
SMESG000021478.10.000e+099.49SMESG000021478.1[more]
SMESG000055143.18.323e-14081.37SMESG000055143.1[more]
SMESG000055143.11.009e-13981.37SMESG000055143.1[more]
SMESG000055143.11.134e-13981.37SMESG000055143.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020209 ID=SMED30020209|Name=Synaptotagmin, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=1588bp
TGCTTGAACGCTGTTGGGCAATTTCATACTGGTTGAATGACTCTCCCAGC
TGTATTCTGACCTATGAAAGTTAAATTAATATAGTTATTTGTATGAGATT
GTTATATATGGAATTTCCCAGTGAATTGCGCCCAATAATTGGTATCTTGA
TGGGCCGATCTCGGTTTGTGGAATAATTCATTTGATTACAAGCTAAATTA
CCTTGAAATGACAGAAACAAAAATGAAATTTCATGCCAATTTCACTGCTT
CAACGACCTCCGGTAAAACCTCAACAAATGCTGCAAAAGAAAAATTCCAG
GAAATAATTACATATTTGTCGAAAAAAATGAAAGTACCCCCATGGGCAGT
TTACGCAATTGGAGTAGCAATCATACTTGTTATCCTCATAATTTTCTTTT
GTCTCATAAAGATTTGTTGCTGCAAACGACGCAAAAAATCAAAAGGTGGA
GGCAAAAAAGGAAAAAATGCAACAAAGAATATGAAAATCATTGGTGGAGC
TGTAGATAATAAGACCCAATCAGATGAAGAAGATTTGGTTCTAGATAAAG
ATGACGATAATGAAAAGAAAGAAGAGGAAAAAGAATATTTGGGAAAATTA
GAATACAAATTAGATTACGATTTTACAAAAGGAGAGCTTACAGTTGGAAT
TTTGCAAGCTCAAGAACTACCAGCACTCGATATGAATGGGACGTCAGACC
CATACGTCAAAGTCTTTTTAAAACCAGATAAAAAGAAAAAATTTGAAACA
AAAGTTCATCGAAAAACTTTAAATCCGGTCTTTGATGAAGTTTTTCTTTT
TAAAGTACCATTTTCAGAAATAACTTCCAAAACTCTTTGTCTTCATATTT
ACGATTTTGATAGATTCTCAAAGCATGATCAAATTGGTCAGTTGGAAATT
CCATTGGGTTCAATAGATTTGTGTCAAGTTGTGCAGGAATGGAAGGAACT
TGAACCAAGTAAAGATAGTGCTGAAAAAGAAAATAAACTTGGTGACATTT
GTTTTTCGTTGAGATACGTTCCAACAAATGGAAAACTGACCGTTGTCGTT
TTGGAAGCAAAGAACCTCAAAAAAATGGATGTTGGGGGATTATCTGATCC
TTACGTCAAAATTTCGTTAATGATGAATGGAAAACGAATAAAAAAGAAGA
AAACAACAATCAAAAAATGTACTTTAAATCCATATTACAATGAATCGTTT
TCGTTTGAGGTGCCATTCGAGCAGATACAGAGGATTAATCTAATAGTAAC
GGTTGTTGATTATGATAGAATCGGAACCTCGGAGCCGATTGGAAGGGTCG
TGTTAGGTTGTAATGCTTCAGGGACTGCTCTTCGTCAATGGTCTGACATG
CTTGCTAATCCTAGAAGACCAATTGCGCAATGGCAAACTTTACAAGAAAT
GCCAGAAAAATAACTTTTCCTATTTTTCCTATTATATGCTGATAAAAATT
TAAATCTAGTCATTCGTTATGTGATTTCTTATTTTTAGACGACAATTTTA
ATATTTTCATCGTTTAATGTAATTTTTTCTTAACTTTAAGGCTAGTTTTG
GTTTTTAGCAGTCTGTATCAAGTGAATGTGAAAATCTG
back to top

protein sequence of SMED30020209-orf-1

>SMED30020209-orf-1 ID=SMED30020209-orf-1|Name=SMED30020209-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=402bp
MTETKMKFHANFTASTTSGKTSTNAAKEKFQEIITYLSKKMKVPPWAVYA
IGVAIILVILIIFFCLIKICCCKRRKKSKGGGKKGKNATKNMKIIGGAVD
NKTQSDEEDLVLDKDDDNEKKEEEKEYLGKLEYKLDYDFTKGELTVGILQ
AQELPALDMNGTSDPYVKVFLKPDKKKKFETKVHRKTLNPVFDEVFLFKV
PFSEITSKTLCLHIYDFDRFSKHDQIGQLEIPLGSIDLCQVVQEWKELEP
SKDSAEKENKLGDICFSLRYVPTNGKLTVVVLEAKNLKKMDVGGLSDPYV
KISLMMNGKRIKKKKTTIKKCTLNPYYNESFSFEVPFEQIQRINLIVTVV
DYDRIGTSEPIGRVVLGCNASGTALRQWSDMLANPRRPIAQWQTLQEMPE
K*
back to top
Aliases
The feature 'Synaptotagmin, putative' has the following synonyms
Synonym
Dj-syt
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR015428Synaptotagmin1
IPR000008C2_dom
IPR001565Synaptotagmin
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0000149SNARE binding
GO:0005509calcium ion binding
GO:0005544calcium-dependent phospholipid binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0008021synaptic vesicle
GO:0016021integral component of membrane
GO:0030054cell junction
GO:0030285integral component of synaptic vesicle membrane
GO:0030672synaptic vesicle membrane
GO:0031410cytoplasmic vesicle
GO:0045202synapse
Vocabulary: biological process
TermDefinition
GO:0007269neurotransmitter secretion
GO:0016079synaptic vesicle exocytosis
GO:0045955negative regulation of calcium ion-dependent exocytosis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001565SynaptotagminPRINTSPR00399SYNAPTOTAGMNcoord: 221..231
score: 41.44
coord: 131..146
score: 40.26
coord: 146..159
score: 51.89
coord: 201..216
score: 30.15
IPR000008C2 domainPRINTSPR00360C2DOMAINcoord: 186..199
score: 53.9
coord: 159..171
score: 62.79
coord: 210..218
score: 39.41
IPR000008C2 domainSMARTSM00239C2_3ccoord: 143..245
e-value: 5.2E-21
score: 85.8
coord: 276..390
e-value: 9.2E-24
score: 94.9
IPR000008C2 domainPFAMPF00168C2coord: 142..248
e-value: 1.0E-26
score: 93.2
coord: 275..379
e-value: 7.4E-24
score: 84.0
IPR000008C2 domainPROSITEPS50004C2coord: 143..230
score: 19.84
IPR000008C2 domainPROSITEPS50004C2coord: 276..365
score: 21.053
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 113..254
e-value: 2.7E-45
score: 155.7
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 255..400
e-value: 2.2E-53
score: 182.1
NoneNo IPR availablePANTHERPTHR10024SYNAPTOTAGMINcoord: 9..397
NoneNo IPR availableCDDcd08402C2B_Synaptotagmin-1coord: 261..396
e-value: 3.84397E-91
score: 268.886
NoneNo IPR availableCDDcd08385C2A_Synaptotagmin-1-5-6-9-10coord: 127..250
e-value: 3.9449E-78
score: 235.237
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 121..253
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 256..387
NoneNo IPR availableTMHMMTMhelixcoord: 45..67
IPR015428Synaptotagmin 1PANTHERPTHR10024:SF239SYNAPTOTAGMIN-1coord: 9..397