SMED30020202

Overview
NameSMED30020202
Smed IDSMED30020202
Length (bp)3217
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30020202 (SMED30020202) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30020202 (SMED30020202) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30020202 (SMED30020202) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30020202 (SMED30020202) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020202

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
zeta neoblastSMED30020202SMESG000040789.1 dd_Smed_v4_11118_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30020202 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000873:16230..25655 -15947
Homology
BLAST of SMED30020202 vs. Ensembl Human
Match: ZNF281 (zinc finger protein 281 [Source:HGNC Symbol;Acc:HGNC:13075])

HSP 1 Score: 59.3066 bits (142), Expect = 3.937e-8
Identity = 29/96 (30.21%), Postives = 48/96 (50.00%), Query Frame = 3
Query: 1269 RNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDTKCVVSNPIVGVNCEANNQCIKCCTYFASSNSHLSHCKKVCKIIV 1556
            R + CS CSM F  + +  RH  +H R K FGC+ C M F + + +++H+ T           + E   +C  C  YF+ ++  L H +   ++IV
Sbjct:  251 RPFQCSQCSMGFIQKYLLQRHEKIHSREKPFGCDQCSMKFIQKYHMERHKRTH----------SGEKPYKCDTCQQYFSRTDRLLKHRRTCGEVIV 336          
BLAST of SMED30020202 vs. Ensembl Human
Match: ZNF281 (zinc finger protein 281 [Source:HGNC Symbol;Acc:HGNC:13075])

HSP 1 Score: 59.3066 bits (142), Expect = 3.964e-8
Identity = 29/96 (30.21%), Postives = 48/96 (50.00%), Query Frame = 3
Query: 1269 RNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDTKCVVSNPIVGVNCEANNQCIKCCTYFASSNSHLSHCKKVCKIIV 1556
            R + CS CSM F  + +  RH  +H R K FGC+ C M F + + +++H+ T           + E   +C  C  YF+ ++  L H +   ++IV
Sbjct:  287 RPFQCSQCSMGFIQKYLLQRHEKIHSREKPFGCDQCSMKFIQKYHMERHKRTH----------SGEKPYKCDTCQQYFSRTDRLLKHRRTCGEVIV 372          
BLAST of SMED30020202 vs. Ensembl Human
Match: ZNF281 (zinc finger protein 281 [Source:HGNC Symbol;Acc:HGNC:13075])

HSP 1 Score: 59.3066 bits (142), Expect = 3.964e-8
Identity = 29/96 (30.21%), Postives = 48/96 (50.00%), Query Frame = 3
Query: 1269 RNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDTKCVVSNPIVGVNCEANNQCIKCCTYFASSNSHLSHCKKVCKIIV 1556
            R + CS CSM F  + +  RH  +H R K FGC+ C M F + + +++H+ T           + E   +C  C  YF+ ++  L H +   ++IV
Sbjct:  287 RPFQCSQCSMGFIQKYLLQRHEKIHSREKPFGCDQCSMKFIQKYHMERHKRTH----------SGEKPYKCDTCQQYFSRTDRLLKHRRTCGEVIV 372          
BLAST of SMED30020202 vs. Ensembl Human
Match: ZNF559-ZNF177 (ZNF559-ZNF177 readthrough [Source:HGNC Symbol;Acc:HGNC:42964])

HSP 1 Score: 52.373 bits (124), Expect = 2.571e-6
Identity = 40/151 (26.49%), Postives = 66/151 (43.71%), Query Frame = 3
Query: 2247 FECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDCKQGFMSQISYQEHRKS----------QCPKLYGTNAFESNGXXXXXXXXXXXXXXXXXXXXXXXXXXXCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCMKCTRSFTTYMAFRVH 2669
            ++C EC KAF   SSL  H+++H     KP+ C DC + F+ Q S ++H +S          QC K + T ++                L +   +    +   C  C  AF + S L  H  + H+ E     C++C ++F+T     +H
Sbjct:  180 YDCKECGKAFTVPSSLQKHVRTHTG--EKPYECSDCGKAFIDQSSLKKHTRSHTGEKPYECNQCGKSFSTGSY----------------LIVHKRTHTGEKTYECKECGKAFRNSSCLRVH-VRTHTGEK-PYKCIQCEKAFSTSTNLIMH 310          
BLAST of SMED30020202 vs. Ensembl Human
Match: ZNF177 (zinc finger protein 177 [Source:HGNC Symbol;Acc:HGNC:12966])

HSP 1 Score: 52.373 bits (124), Expect = 2.571e-6
Identity = 40/151 (26.49%), Postives = 66/151 (43.71%), Query Frame = 3
Query: 2247 FECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDCKQGFMSQISYQEHRKS----------QCPKLYGTNAFESNGXXXXXXXXXXXXXXXXXXXXXXXXXXXCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCMKCTRSFTTYMAFRVH 2669
            ++C EC KAF   SSL  H+++H     KP+ C DC + F+ Q S ++H +S          QC K + T ++                L +   +    +   C  C  AF + S L  H  + H+ E     C++C ++F+T     +H
Sbjct:  180 YDCKECGKAFTVPSSLQKHVRTHTG--EKPYECSDCGKAFIDQSSLKKHTRSHTGEKPYECNQCGKSFSTGSY----------------LIVHKRTHTGEKTYECKECGKAFRNSSCLRVH-VRTHTGEK-PYKCIQCEKAFSTSTNLIMH 310          
BLAST of SMED30020202 vs. Ensembl Fly
Match: CG5245 (gene:FBgn0038047 transcript:FBtr0082589)

HSP 1 Score: 52.7582 bits (125), Expect = 1.572e-6
Identity = 36/104 (34.62%), Postives = 50/104 (48.08%), Query Frame = 3
Query: 1212 KTDIKATNIKSAEPFNLATRNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDTKCVVSNPIVGVNCEANNQCIKCCTYFASSNSHL 1523
            KT  +  N++S    +   R + CSHCS  FG R  Y RH+L H + +   C +C   FT+N +LKQH          +     E   +C +C T FA   SHL
Sbjct:   89 KTFTRKENLESHLRLHAEERPFECSHCSKSFGRRTHYKRHLLKHEK-RPHKCSHCSKTFTQNSSLKQH----------LHEHTGERPFKCTQCSTSFA-RKSHL 180          
BLAST of SMED30020202 vs. Ensembl Zebrafish
Match: ZNF423 (si:ch211-216l23.1 [Source:NCBI gene;Acc:566696])

HSP 1 Score: 55.8398 bits (133), Expect = 3.279e-7
Identity = 77/354 (21.75%), Postives = 125/354 (35.31%), Query Frame = 3
Query: 1677 NDLINNPAFVTKRINEFNCNLCCCYFASYKSIGHHLEHYHRIEIRSGNTKKTPETENMNVIQDFIHKCDECDSKYASKEALVKHKQQNHPLKHSESIPNKNFNPTEIFNRLPIEKPCKIQPQSSPPRKLLTPSSFSLSNLVPMFSPEALNLSTTQSSIYHNVPI--------LQRISPM-------IPKQNSIKRSKVPPNANGEFECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDC-KQGFMSQISYQEHRKSQCPKLYGTNAFESNGXXXXXXXXXXXXXXXXXXXXXXXXXXXCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCMKCTRSFTTYMAFRVHTTKTHGG 2690
            N   N P      ++ F+CN C   FA   S+  H+   H +   SG       T   N    F   C++C   + ++ +L +H QQ H               + +     +E P  +QP  S     +   S       P+F    L L+      + N+P+        +  +SP         PK++ +     P  ANG++ C +C   F        H+KSH  L  +   C  C K+ F SQ +  +H        Y T + +    +     +    L        +     C  C   F  +  ++ H A +HSNE     C  C   F      ++H   +H G
Sbjct:  504 NSASNFPLLQFSNVSAFHCNYCPDMFADINSLQEHIRVSHCL---SGGVVAGSTTLEGN--HAFF--CNQCSMGFLTESSLTEHIQQTH--------------CSSVGGVTKMESPV-LQPSQS----FMEVYSCPYCTNSPIFG-SLLKLTKHIKENHKNIPLANNKRKVKVADLSPASSDVEISSPKRHRVTGDSTPAVANGDYPCNQCDLRFSSFEGFQAHLKSHLELLLRRQSCPQCNKEDFDSQEALLQHLTIH----YTTTSTQYVCESCDKQFSSVDDLQKHLLDMHTFVLYHCTLCQEVFDSKVSIQVHLAVKHSNEKKMYRCTACAWDFRKESDLQLHVKHSHLG 826          
BLAST of SMED30020202 vs. Ensembl Zebrafish
Match: ZNF423 (si:ch211-216l23.1 [Source:NCBI gene;Acc:566696])

HSP 1 Score: 55.8398 bits (133), Expect = 3.446e-7
Identity = 77/354 (21.75%), Postives = 125/354 (35.31%), Query Frame = 3
Query: 1677 NDLINNPAFVTKRINEFNCNLCCCYFASYKSIGHHLEHYHRIEIRSGNTKKTPETENMNVIQDFIHKCDECDSKYASKEALVKHKQQNHPLKHSESIPNKNFNPTEIFNRLPIEKPCKIQPQSSPPRKLLTPSSFSLSNLVPMFSPEALNLSTTQSSIYHNVPI--------LQRISPM-------IPKQNSIKRSKVPPNANGEFECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDC-KQGFMSQISYQEHRKSQCPKLYGTNAFESNGXXXXXXXXXXXXXXXXXXXXXXXXXXXCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCMKCTRSFTTYMAFRVHTTKTHGG 2690
            N   N P      ++ F+CN C   FA   S+  H+   H +   SG       T   N    F   C++C   + ++ +L +H QQ H               + +     +E P  +QP  S     +   S       P+F    L L+      + N+P+        +  +SP         PK++ +     P  ANG++ C +C   F        H+KSH  L  +   C  C K+ F SQ +  +H        Y T + +    +     +    L        +     C  C   F  +  ++ H A +HSNE     C  C   F      ++H   +H G
Sbjct:  504 NSASNFPLLQFSNVSAFHCNYCPDMFADINSLQEHIRVSHCL---SGGVVAGSTTLEGN--HAFF--CNQCSMGFLTESSLTEHIQQTH--------------CSSVGGVTKMESPV-LQPSQS----FMEVYSCPYCTNSPIFG-SLLKLTKHIKENHKNIPLANNKRKVKVADLSPASSDVEISSPKRHRVTGDSTPAVANGDYPCNQCDLRFSSFEGFQAHLKSHLELLLRRQSCPQCNKEDFDSQEALLQHLTIH----YTTTSTQYVCESCDKQFSSVDDLQKHLLDMHTFVLYHCTLCQEVFDSKVSIQVHLAVKHSNEKKMYRCTACAWDFRKESDLQLHVKHSHLG 826          
BLAST of SMED30020202 vs. Ensembl Zebrafish
Match: si:ch211-216l23.1 (si:ch211-216l23.1 [Source:NCBI gene;Acc:566696])

HSP 1 Score: 55.8398 bits (133), Expect = 3.687e-7
Identity = 77/354 (21.75%), Postives = 125/354 (35.31%), Query Frame = 3
Query: 1677 NDLINNPAFVTKRINEFNCNLCCCYFASYKSIGHHLEHYHRIEIRSGNTKKTPETENMNVIQDFIHKCDECDSKYASKEALVKHKQQNHPLKHSESIPNKNFNPTEIFNRLPIEKPCKIQPQSSPPRKLLTPSSFSLSNLVPMFSPEALNLSTTQSSIYHNVPI--------LQRISPM-------IPKQNSIKRSKVPPNANGEFECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDC-KQGFMSQISYQEHRKSQCPKLYGTNAFESNGXXXXXXXXXXXXXXXXXXXXXXXXXXXCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCMKCTRSFTTYMAFRVHTTKTHGG 2690
            N   N P      ++ F+CN C   FA   S+  H+   H +   SG       T   N    F   C++C   + ++ +L +H QQ H               + +     +E P  +QP  S     +   S       P+F    L L+      + N+P+        +  +SP         PK++ +     P  ANG++ C +C   F        H+KSH  L  +   C  C K+ F SQ +  +H        Y T + +    +     +    L        +     C  C   F  +  ++ H A +HSNE     C  C   F      ++H   +H G
Sbjct:  495 NSASNFPLLQFSNVSAFHCNYCPDMFADINSLQEHIRVSHCL---SGGVVAGSTTLEGN--HAFF--CNQCSMGFLTESSLTEHIQQTH--------------CSSVGGVTKMESPV-LQPSQS----FMEVYSCPYCTNSPIFG-SLLKLTKHIKENHKNIPLANNKRKVKVADLSPASSDVEISSPKRHRVTGDSTPAVANGDYPCNQCDLRFSSFEGFQAHLKSHLELLLRRQSCPQCNKEDFDSQEALLQHLTIH----YTTTSTQYVCESCDKQFSSVDDLQKHLLDMHTFVLYHCTLCQEVFDSKVSIQVHLAVKHSNEKKMYRCTACAWDFRKESDLQLHVKHSHLG 817          
BLAST of SMED30020202 vs. Ensembl Zebrafish
Match: ZNF423 (si:ch211-216l23.1 [Source:NCBI gene;Acc:566696])

HSP 1 Score: 55.8398 bits (133), Expect = 3.691e-7
Identity = 77/354 (21.75%), Postives = 125/354 (35.31%), Query Frame = 3
Query: 1677 NDLINNPAFVTKRINEFNCNLCCCYFASYKSIGHHLEHYHRIEIRSGNTKKTPETENMNVIQDFIHKCDECDSKYASKEALVKHKQQNHPLKHSESIPNKNFNPTEIFNRLPIEKPCKIQPQSSPPRKLLTPSSFSLSNLVPMFSPEALNLSTTQSSIYHNVPI--------LQRISPM-------IPKQNSIKRSKVPPNANGEFECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDC-KQGFMSQISYQEHRKSQCPKLYGTNAFESNGXXXXXXXXXXXXXXXXXXXXXXXXXXXCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCMKCTRSFTTYMAFRVHTTKTHGG 2690
            N   N P      ++ F+CN C   FA   S+  H+   H +   SG       T   N    F   C++C   + ++ +L +H QQ H               + +     +E P  +QP  S     +   S       P+F    L L+      + N+P+        +  +SP         PK++ +     P  ANG++ C +C   F        H+KSH  L  +   C  C K+ F SQ +  +H        Y T + +    +     +    L        +     C  C   F  +  ++ H A +HSNE     C  C   F      ++H   +H G
Sbjct:  497 NSASNFPLLQFSNVSAFHCNYCPDMFADINSLQEHIRVSHCL---SGGVVAGSTTLEGN--HAFF--CNQCSMGFLTESSLTEHIQQTH--------------CSSVGGVTKMESPV-LQPSQS----FMEVYSCPYCTNSPIFG-SLLKLTKHIKENHKNIPLANNKRKVKVADLSPASSDVEISSPKRHRVTGDSTPAVANGDYPCNQCDLRFSSFEGFQAHLKSHLELLLRRQSCPQCNKEDFDSQEALLQHLTIH----YTTTSTQYVCESCDKQFSSVDDLQKHLLDMHTFVLYHCTLCQEVFDSKVSIQVHLAVKHSNEKKMYRCTACAWDFRKESDLQLHVKHSHLG 819          
BLAST of SMED30020202 vs. Ensembl Zebrafish
Match: ZNF423 (si:ch211-216l23.1 [Source:NCBI gene;Acc:566696])

HSP 1 Score: 55.4546 bits (132), Expect = 3.969e-7
Identity = 77/354 (21.75%), Postives = 125/354 (35.31%), Query Frame = 3
Query: 1677 NDLINNPAFVTKRINEFNCNLCCCYFASYKSIGHHLEHYHRIEIRSGNTKKTPETENMNVIQDFIHKCDECDSKYASKEALVKHKQQNHPLKHSESIPNKNFNPTEIFNRLPIEKPCKIQPQSSPPRKLLTPSSFSLSNLVPMFSPEALNLSTTQSSIYHNVPI--------LQRISPM-------IPKQNSIKRSKVPPNANGEFECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDC-KQGFMSQISYQEHRKSQCPKLYGTNAFESNGXXXXXXXXXXXXXXXXXXXXXXXXXXXCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCMKCTRSFTTYMAFRVHTTKTHGG 2690
            N   N P      ++ F+CN C   FA   S+  H+   H +   SG       T   N    F   C++C   + ++ +L +H QQ H               + +     +E P  +QP  S     +   S       P+F    L L+      + N+P+        +  +SP         PK++ +     P  ANG++ C +C   F        H+KSH  L  +   C  C K+ F SQ +  +H        Y T + +    +     +    L        +     C  C   F  +  ++ H A +HSNE     C  C   F      ++H   +H G
Sbjct:  477 NSASNFPLLQFSNVSAFHCNYCPDMFADINSLQEHIRVSHCL---SGGVVAGSTTLEGN--HAFF--CNQCSMGFLTESSLTEHIQQTH--------------CSSVGGVTKMESPV-LQPSQS----FMEVYSCPYCTNSPIFG-SLLKLTKHIKENHKNIPLANNKRKVKVADLSPASSDVEISSPKRHRVTGDSTPAVANGDYPCNQCDLRFSSFEGFQAHLKSHLELLLRRQSCPQCNKEDFDSQEALLQHLTIH----YTTTSTQYVCESCDKQFSSVDDLQKHLLDMHTFVLYHCTLCQEVFDSKVSIQVHLAVKHSNEKKMYRCTACAWDFRKESDLQLHVKHSHLG 799          
BLAST of SMED30020202 vs. Ensembl Xenopus
Match: ZNF423 (zinc finger protein 423 [Source:NCBI gene;Acc:100491000])

HSP 1 Score: 58.9214 bits (141), Expect = 5.949e-8
Identity = 74/334 (22.16%), Postives = 118/334 (35.33%), Query Frame = 3
Query: 1695 PAFVTKRINEFNCNLCCCYFASYKSIGHHLEHYHRIEIRSGNTKKTPETENMNVIQDFIHKCDECDSKYASKEALVKHKQQNHPLKHSESIPNKNFNPTEIFNRLPIEKPCKIQPQSSPPRKLLTPSSFSLSNLVPMFSPEALN--LSTTQSSIYHNVPILQRISPMIPKQNSIKRSKVPPNANGEFECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDCKQGFMSQISYQEHRKSQCPKLYGTNAFESNGXXXXXXXXXXXXXXXXXXXXXXXXXXXCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCMKCTRSFTTYMAFRVHTTKTHGG 2690
            P      I  F+CN C   FA   S+  H+   H      G    T E  N          C++C   + ++ +L +H QQ H    S  + +    PT+ F  +            S P    +P   S+  L         N  L+  + S     P+   +    PK+  +  + +   +NGE+ C +C   F    +   H+KSH  L  +   C  CK+ F SQ S  +H        Y T +      +     +    L        +     C  C   F  +  ++ H A +HSNE     C  C   F   +  ++H   +H G
Sbjct:  425 PMVQFSNITAFHCNYCPEMFADINSLQEHIRVTH-----CGPNATTQEGNNAFF-------CNQCSMGFLTESSLTEHIQQTHCNVGSSKLESPVIQPTQSFMEV-----------YSCPYCTNSPIFGSILKLTKHIKENHKNIPLANHKKSKSEQSPVSSDVEVSSPKRQRLCVN-LNSVSNGEYPCNQCDLKFSNFETFQTHLKSHLELLLRKQSCPQCKEDFDSQESLLQHLTIH----YMTTSTHYVCESCDKQFSSVDDLQKHLLDMHTFVLYHCTLCQEVFDSKVSIQVHLAVKHSNEKKMYRCTACNWDFRREVDLQLHVKHSHLG 730          
BLAST of SMED30020202 vs. Ensembl Xenopus
Match: ZNF423 (zinc finger protein 423 [Source:NCBI gene;Acc:100491000])

HSP 1 Score: 58.5362 bits (140), Expect = 6.565e-8
Identity = 74/334 (22.16%), Postives = 118/334 (35.33%), Query Frame = 3
Query: 1695 PAFVTKRINEFNCNLCCCYFASYKSIGHHLEHYHRIEIRSGNTKKTPETENMNVIQDFIHKCDECDSKYASKEALVKHKQQNHPLKHSESIPNKNFNPTEIFNRLPIEKPCKIQPQSSPPRKLLTPSSFSLSNLVPMFSPEALN--LSTTQSSIYHNVPILQRISPMIPKQNSIKRSKVPPNANGEFECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDCKQGFMSQISYQEHRKSQCPKLYGTNAFESNGXXXXXXXXXXXXXXXXXXXXXXXXXXXCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCMKCTRSFTTYMAFRVHTTKTHGG 2690
            P      I  F+CN C   FA   S+  H+   H      G    T E  N          C++C   + ++ +L +H QQ H    S  + +    PT+ F  +            S P    +P   S+  L         N  L+  + S     P+   +    PK+  +  + +   +NGE+ C +C   F    +   H+KSH  L  +   C  CK+ F SQ S  +H        Y T +      +     +    L        +     C  C   F  +  ++ H A +HSNE     C  C   F   +  ++H   +H G
Sbjct:  455 PMVQFSNITAFHCNYCPEMFADINSLQEHIRVTH-----CGPNATTQEGNNAFF-------CNQCSMGFLTESSLTEHIQQTHCNVGSSKLESPVIQPTQSFMEV-----------YSCPYCTNSPIFGSILKLTKHIKENHKNIPLANHKKSKSEQSPVSSDVEVSSPKRQRLCVN-LNSVSNGEYPCNQCDLKFSNFETFQTHLKSHLELLLRKQSCPQCKEDFDSQESLLQHLTIH----YMTTSTHYVCESCDKQFSSVDDLQKHLLDMHTFVLYHCTLCQEVFDSKVSIQVHLAVKHSNEKKMYRCTACNWDFRREVDLQLHVKHSHLG 760          
BLAST of SMED30020202 vs. Ensembl Xenopus
Match: ZNF423 (zinc finger protein 423 [Source:NCBI gene;Acc:100491000])

HSP 1 Score: 58.151 bits (139), Expect = 7.965e-8
Identity = 74/334 (22.16%), Postives = 118/334 (35.33%), Query Frame = 3
Query: 1695 PAFVTKRINEFNCNLCCCYFASYKSIGHHLEHYHRIEIRSGNTKKTPETENMNVIQDFIHKCDECDSKYASKEALVKHKQQNHPLKHSESIPNKNFNPTEIFNRLPIEKPCKIQPQSSPPRKLLTPSSFSLSNLVPMFSPEALN--LSTTQSSIYHNVPILQRISPMIPKQNSIKRSKVPPNANGEFECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDCKQGFMSQISYQEHRKSQCPKLYGTNAFESNGXXXXXXXXXXXXXXXXXXXXXXXXXXXCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCMKCTRSFTTYMAFRVHTTKTHGG 2690
            P      I  F+CN C   FA   S+  H+   H      G    T E  N          C++C   + ++ +L +H QQ H    S  + +    PT+ F  +            S P    +P   S+  L         N  L+  + S     P+   +    PK+  +  + +   +NGE+ C +C   F    +   H+KSH  L  +   C  CK+ F SQ S  +H        Y T +      +     +    L        +     C  C   F  +  ++ H A +HSNE     C  C   F   +  ++H   +H G
Sbjct:  413 PMVQFSNITAFHCNYCPEMFADINSLQEHIRVTH-----CGPNATTQEGNNAFF-------CNQCSMGFLTESSLTEHIQQTHCNVGSSKLESPVIQPTQSFMEV-----------YSCPYCTNSPIFGSILKLTKHIKENHKNIPLANHKKSKSEQSPVSSDVEVSSPKRQRLCVN-LNSVSNGEYPCNQCDLKFSNFETFQTHLKSHLELLLRKQSCPQCKEDFDSQESLLQHLTIH----YMTTSTHYVCESCDKQFSSVDDLQKHLLDMHTFVLYHCTLCQEVFDSKVSIQVHLAVKHSNEKKMYRCTACNWDFRREVDLQLHVKHSHLG 718          
BLAST of SMED30020202 vs. Ensembl Xenopus
Match: ZNF423 (zinc finger protein 423 [Source:NCBI gene;Acc:100491000])

HSP 1 Score: 58.151 bits (139), Expect = 8.004e-8
Identity = 74/334 (22.16%), Postives = 118/334 (35.33%), Query Frame = 3
Query: 1695 PAFVTKRINEFNCNLCCCYFASYKSIGHHLEHYHRIEIRSGNTKKTPETENMNVIQDFIHKCDECDSKYASKEALVKHKQQNHPLKHSESIPNKNFNPTEIFNRLPIEKPCKIQPQSSPPRKLLTPSSFSLSNLVPMFSPEALN--LSTTQSSIYHNVPILQRISPMIPKQNSIKRSKVPPNANGEFECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDCKQGFMSQISYQEHRKSQCPKLYGTNAFESNGXXXXXXXXXXXXXXXXXXXXXXXXXXXCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCMKCTRSFTTYMAFRVHTTKTHGG 2690
            P      I  F+CN C   FA   S+  H+   H      G    T E  N          C++C   + ++ +L +H QQ H    S  + +    PT+ F  +            S P    +P   S+  L         N  L+  + S     P+   +    PK+  +  + +   +NGE+ C +C   F    +   H+KSH  L  +   C  CK+ F SQ S  +H        Y T +      +     +    L        +     C  C   F  +  ++ H A +HSNE     C  C   F   +  ++H   +H G
Sbjct:  395 PMVQFSNITAFHCNYCPEMFADINSLQEHIRVTH-----CGPNATTQEGNNAFF-------CNQCSMGFLTESSLTEHIQQTHCNVGSSKLESPVIQPTQSFMEV-----------YSCPYCTNSPIFGSILKLTKHIKENHKNIPLANHKKSKSEQSPVSSDVEVSSPKRQRLCVN-LNSVSNGEYPCNQCDLKFSNFETFQTHLKSHLELLLRKQSCPQCKEDFDSQESLLQHLTIH----YMTTSTHYVCESCDKQFSSVDDLQKHLLDMHTFVLYHCTLCQEVFDSKVSIQVHLAVKHSNEKKMYRCTACNWDFRREVDLQLHVKHSHLG 700          
BLAST of SMED30020202 vs. Ensembl Xenopus
Match: ZNF423 (zinc finger protein 423 [Source:NCBI gene;Acc:100491000])

HSP 1 Score: 58.151 bits (139), Expect = 8.524e-8
Identity = 74/334 (22.16%), Postives = 118/334 (35.33%), Query Frame = 3
Query: 1695 PAFVTKRINEFNCNLCCCYFASYKSIGHHLEHYHRIEIRSGNTKKTPETENMNVIQDFIHKCDECDSKYASKEALVKHKQQNHPLKHSESIPNKNFNPTEIFNRLPIEKPCKIQPQSSPPRKLLTPSSFSLSNLVPMFSPEALN--LSTTQSSIYHNVPILQRISPMIPKQNSIKRSKVPPNANGEFECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDCKQGFMSQISYQEHRKSQCPKLYGTNAFESNGXXXXXXXXXXXXXXXXXXXXXXXXXXXCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCMKCTRSFTTYMAFRVHTTKTHGG 2690
            P      I  F+CN C   FA   S+  H+   H      G    T E  N          C++C   + ++ +L +H QQ H    S  + +    PT+ F  +            S P    +P   S+  L         N  L+  + S     P+   +    PK+  +  + +   +NGE+ C +C   F    +   H+KSH  L  +   C  CK+ F SQ S  +H        Y T +      +     +    L        +     C  C   F  +  ++ H A +HSNE     C  C   F   +  ++H   +H G
Sbjct:  476 PMVQFSNITAFHCNYCPEMFADINSLQEHIRVTH-----CGPNATTQEGNNAFF-------CNQCSMGFLTESSLTEHIQQTHCNVGSSKLESPVIQPTQSFMEV-----------YSCPYCTNSPIFGSILKLTKHIKENHKNIPLANHKKSKSEQSPVSSDVEVSSPKRQRLCVN-LNSVSNGEYPCNQCDLKFSNFETFQTHLKSHLELLLRKQSCPQCKEDFDSQESLLQHLTIH----YMTTSTHYVCESCDKQFSSVDDLQKHLLDMHTFVLYHCTLCQEVFDSKVSIQVHLAVKHSNEKKMYRCTACNWDFRREVDLQLHVKHSHLG 781          
BLAST of SMED30020202 vs. Ensembl Mouse
Match: Gm17655 (predicted gene, 17655 [Source:MGI Symbol;Acc:MGI:4937289])

HSP 1 Score: 59.3066 bits (142), Expect = 2.355e-8
Identity = 88/431 (20.42%), Postives = 152/431 (35.27%), Query Frame = 3
Query: 1275 YMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDT-------KCVVSNPIVGVN-----------CEANNQCIKCCTYFASSNSHLSHCKKVCKIIVANPXXXXXXXXXXXXXTNAQYESQLEIDLGD-----SDNLTPMIVNDLINNPAFVTKRINEFNCNLCCCYFASYKSIGHHLEHYHRIEIRSGNTKKTPETENMNVIQDF-------IH------KCDECDSKYASKEALVKHKQQNHPLKHSESIPNKNFNPTEIFNRLPIEKPCKIQPQSSPPRKLLT-PSSFSLSNLVPMFS-------PEALNLSTTQSSIYHNVPILQRI------------SPMIPKQNSIKRSKVPPNANGEFECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDCKQGFMSQISYQEHRK 2399
            Y C  CS  F S   + +H  +H RGK++ C  CG AF ++  LK+H+ T       KC         +            E   +C +C   FA  +S   H     K I    +     E  K+   N+Q      I  G+     +    P +  + +     +  R+  + CN C   FAS   +  H        I +G    T        ++ +       IH      +C +C+  +AS   L  H++      H+   P K     + + +L   K  KI      P +      +F+  + + +         P   N  +   + +  + I +RI                 +   +K  K+       ++C +C K F    +   H ++H     KP+ CE C + F  Q  +Q H++
Sbjct:  144 YECKQCSKSFASHDQFQKHERIHTRGKSYKCNQCGKAFAQHSHLKKHKITHTGEKHYKCNQCGKGFAYHKNLRIHKRTHTGEKPYECNQCGKAFAYQSSFQVH-----KRIHTGEKPYKCNECGKAFACNSQLRKHERIHTGEKPYKCNQCGKPFVCQNALQRHERIHTRVKRYECNQCSKSFASCAQLRKHE------RIHTGEKPYTCSQCGKAFVRQYDLQRHERIHTGDKPYECKQCNKSFASHNQLRLHER-----IHTGEKPYKCNQCGKAYAQLGPLKMHKITHTGEKPYECKQCGKAFAYRDQLRIHERTHTGEKPYECNQCSKTFASHGQLRIHERIHTGEKPYKCNQCGKAFARHGHLKMHKITHTGEKPYKCNQCGKGFAYHRTFQVHKRTHTG--EKPYECEQCGKAFAYQNYFQVHKR 556          
BLAST of SMED30020202 vs. Ensembl Mouse
Match: Zfp281 (zinc finger protein 281 [Source:MGI Symbol;Acc:MGI:3029290])

HSP 1 Score: 57.7658 bits (138), Expect = 8.568e-8
Identity = 29/97 (29.90%), Postives = 48/97 (49.48%), Query Frame = 3
Query: 1269 RNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDTKCVVSNPIVGVNCEANNQCIKCCTYFASSNSHLSHCKKVCKIIVA 1559
            R + CS CSM F  + +  RH  +H R K FGC+ C M F + + +++H+ T           + E   +C  C  YF+ ++  L H ++ C   +A
Sbjct:  284 RPFQCSQCSMGFIQKYLLQRHEKIHSREKPFGCDQCSMKFIQKYHMERHKRTH----------SGEKPYKCDTCQQYFSRTDRLLKH-RRTCGEAIA 369          
BLAST of SMED30020202 vs. Ensembl Mouse
Match: Zfp281 (zinc finger protein 281 [Source:MGI Symbol;Acc:MGI:3029290])

HSP 1 Score: 57.7658 bits (138), Expect = 8.568e-8
Identity = 29/97 (29.90%), Postives = 48/97 (49.48%), Query Frame = 3
Query: 1269 RNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDTKCVVSNPIVGVNCEANNQCIKCCTYFASSNSHLSHCKKVCKIIVA 1559
            R + CS CSM F  + +  RH  +H R K FGC+ C M F + + +++H+ T           + E   +C  C  YF+ ++  L H ++ C   +A
Sbjct:  284 RPFQCSQCSMGFIQKYLLQRHEKIHSREKPFGCDQCSMKFIQKYHMERHKRTH----------SGEKPYKCDTCQQYFSRTDRLLKH-RRTCGEAIA 369          
BLAST of SMED30020202 vs. Ensembl Mouse
Match: Zfp715 (zinc finger protein 715 [Source:MGI Symbol;Acc:MGI:1917180])

HSP 1 Score: 55.0694 bits (131), Expect = 5.451e-7
Identity = 24/65 (36.92%), Postives = 35/65 (53.85%), Query Frame = 3
Query: 1230 TNIKSAEPFNLATRNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDT 1424
              ++  E  +   R Y+C+HC   F SR+V+S+H L+HR+   F CE CG  F +   L  H  T
Sbjct:  816 VQLQEHERIHTGERPYVCTHCGKAFRSRSVFSKHKLIHRKETPFICERCGKVFLQKSELTSHLQT 880          
BLAST of SMED30020202 vs. Ensembl Mouse
Match: Zfp715 (zinc finger protein 715 [Source:MGI Symbol;Acc:MGI:1917180])

HSP 1 Score: 55.0694 bits (131), Expect = 5.451e-7
Identity = 24/65 (36.92%), Postives = 35/65 (53.85%), Query Frame = 3
Query: 1230 TNIKSAEPFNLATRNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDT 1424
              ++  E  +   R Y+C+HC   F SR+V+S+H L+HR+   F CE CG  F +   L  H  T
Sbjct:  816 VQLQEHERIHTGERPYVCTHCGKAFRSRSVFSKHKLIHRKETPFICERCGKVFLQKSELTSHLQT 880          
BLAST of SMED30020202 vs. UniProt/SwissProt
Match: sp|Q9Y2X9|ZN281_HUMAN (Zinc finger protein 281 OS=Homo sapiens OX=9606 GN=ZNF281 PE=1 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 1.903e-7
Identity = 29/96 (30.21%), Postives = 48/96 (50.00%), Query Frame = 3
Query: 1269 RNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDTKCVVSNPIVGVNCEANNQCIKCCTYFASSNSHLSHCKKVCKIIV 1556
            R + CS CSM F  + +  RH  +H R K FGC+ C M F + + +++H+ T           + E   +C  C  YF+ ++  L H +   ++IV
Sbjct:  287 RPFQCSQCSMGFIQKYLLQRHEKIHSREKPFGCDQCSMKFIQKYHMERHKRTH----------SGEKPYKCDTCQQYFSRTDRLLKHRRTCGEVIV 372          
BLAST of SMED30020202 vs. UniProt/SwissProt
Match: sp|Q99LI5|ZN281_MOUSE (Zinc finger protein 281 OS=Mus musculus OX=10090 GN=Znf281 PE=1 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 5.993e-7
Identity = 29/97 (29.90%), Postives = 48/97 (49.48%), Query Frame = 3
Query: 1269 RNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDTKCVVSNPIVGVNCEANNQCIKCCTYFASSNSHLSHCKKVCKIIVA 1559
            R + CS CSM F  + +  RH  +H R K FGC+ C M F + + +++H+ T           + E   +C  C  YF+ ++  L H ++ C   +A
Sbjct:  284 RPFQCSQCSMGFIQKYLLQRHEKIHSREKPFGCDQCSMKFIQKYHMERHKRTH----------SGEKPYKCDTCQQYFSRTDRLLKH-RRTCGEAIA 369          
BLAST of SMED30020202 vs. UniProt/SwissProt
Match: sp|A1L1R6|ZN423_DANRE (Zinc finger protein 423 OS=Danio rerio OX=7955 GN=znf423 PE=2 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 3.212e-6
Identity = 77/354 (21.75%), Postives = 125/354 (35.31%), Query Frame = 3
Query: 1677 NDLINNPAFVTKRINEFNCNLCCCYFASYKSIGHHLEHYHRIEIRSGNTKKTPETENMNVIQDFIHKCDECDSKYASKEALVKHKQQNHPLKHSESIPNKNFNPTEIFNRLPIEKPCKIQPQSSPPRKLLTPSSFSLSNLVPMFSPEALNLSTTQSSIYHNVPI--------LQRISPM-------IPKQNSIKRSKVPPNANGEFECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDC-KQGFMSQISYQEHRKSQCPKLYGTNAFESNGXXXXXXXXXXXXXXXXXXXXXXXXXXXCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCMKCTRSFTTYMAFRVHTTKTHGG 2690
            N   N P      ++ F+CN C   FA   S+  H+   H +   SG       T   N    F   C++C   + ++ +L +H QQ H               + +     +E P  +QP  S     +   S       P+F    L L+      + N+P+        +  +SP         PK++ +     P  ANG++ C +C   F        H+KSH  L  +   C  C K+ F SQ +  +H        Y T + +    +     +    L        +     C  C   F  +  ++ H A +HSNE     C  C   F      ++H   +H G
Sbjct:  497 NSASNFPLLQFSNVSAFHCNYCPDMFADINSLQEHIRVSHCL---SGGVVAGSTTLEGN--HAFF--CNQCSMGFLTESSLTEHIQQTH--------------CSSVGGVTKMESPV-LQPSQS----FMEVYSCPYCTNSPIFG-SLLKLTKHIKENHKNIPLANNKRKVKVADLSPASSDVEISSPKRHRVTGDSTPAVANGDYPCNQCDLRFSSFEGFQAHLKSHLELLLRRQSCPQCNKEDFDSQEALLQHLTIH----YTTTSTQYVCESCDKQFSSVDDLQKHLLDMHTFVLYHCTLCQEVFDSKVSIQVHLAVKHSNEKKMYRCTACAWDFRKESDLQLHVKHSHLG 819          
BLAST of SMED30020202 vs. TrEMBL
Match: W5ML20 (Zinc finger protein 423 OS=Lepisosteus oculatus OX=7918 GN=ZNF423 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 5.966e-6
Identity = 72/340 (21.18%), Postives = 121/340 (35.59%), Query Frame = 3
Query: 1695 PAFVTKRINEFNCNLCCCYFASYKSIGHHLEHYHRIEIRSGNTKKTPETENMNVIQDFIHKCDECDSKYASKEALVKHKQQNHPLKHSESIPNKNFNPTEIFNRLPIEKPCKIQPQSSPPRKLLTPSSFSLSNLVPMFSPEALN--LSTTQSSIYHNVPILQRISPMIPKQNSIKRSKVPPNANGEFECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDCKQGFMSQISYQEHRKSQCPKLYGTNAFESNGXXXXXXXXXXXXXXXXXXXXXXXXXXXCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCMKCTRSFTTYMAFRVHTTKTH-GGPNGTR 2705
            P      ++ F+CN C   FA   S+  H+   H +          P   +  +  +    C++C   + ++ +L +H QQ H    S  + +    P++ F  +            S P    +P   S+  L         N  L+  + S   + P+   +    PK+  +  +   P +NGE+ C +C   F        H+KSH  L  +   C  CK+ F SQ S  +H        Y T +      +     +    L        +     C  C   F  +  ++ H A +HSNE     C  C   F      ++H   +H G P   R
Sbjct:  485 PVLQFSNVSAFHCNYCPEMFADINSLQEHIRMTHCL----------PGAASSTLEGNHAFFCNQCSMGFLTESSLTEHIQQTHCNVGSSKLESPVIQPSQSFMEV-----------YSCPYCTNSPIFGSILKLTKHIKENHKNIPLANNKRSKADHSPVSSDVEISSPKRQRLV-ANATPGSNGEYPCNQCDLKFASFEGFQAHLKSHLELLLRKQSCPQCKEDFDSQDSLLQHLTVH----YMTTSTHYVCESCDKQFSSVDDLQKHLLDMHTFVLYHCTLCQEVFDSKVSIQVHLAVKHSNEKKMYRCTACNWDFRKETDLQLHVKHSHLGNPAKAR 798          
BLAST of SMED30020202 vs. TrEMBL
Match: W5ML01 (Zinc finger protein 423 OS=Lepisosteus oculatus OX=7918 GN=ZNF423 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 6.128e-6
Identity = 72/340 (21.18%), Postives = 121/340 (35.59%), Query Frame = 3
Query: 1695 PAFVTKRINEFNCNLCCCYFASYKSIGHHLEHYHRIEIRSGNTKKTPETENMNVIQDFIHKCDECDSKYASKEALVKHKQQNHPLKHSESIPNKNFNPTEIFNRLPIEKPCKIQPQSSPPRKLLTPSSFSLSNLVPMFSPEALN--LSTTQSSIYHNVPILQRISPMIPKQNSIKRSKVPPNANGEFECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDCKQGFMSQISYQEHRKSQCPKLYGTNAFESNGXXXXXXXXXXXXXXXXXXXXXXXXXXXCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCMKCTRSFTTYMAFRVHTTKTH-GGPNGTR 2705
            P      ++ F+CN C   FA   S+  H+   H +          P   +  +  +    C++C   + ++ +L +H QQ H    S  + +    P++ F  +            S P    +P   S+  L         N  L+  + S   + P+   +    PK+  +  +   P +NGE+ C +C   F        H+KSH  L  +   C  CK+ F SQ S  +H        Y T +      +     +    L        +     C  C   F  +  ++ H A +HSNE     C  C   F      ++H   +H G P   R
Sbjct:  485 PVLQFSNVSAFHCNYCPEMFADINSLQEHIRMTHCL----------PGAASSTLEGNHAFFCNQCSMGFLTESSLTEHIQQTHCNVGSSKLESPVIQPSQSFMEV-----------YSCPYCTNSPIFGSILKLTKHIKENHKNIPLANNKRSKADHSPVSSDVEISSPKRQRLV-ANATPGSNGEYPCNQCDLKFASFEGFQAHLKSHLELLLRKQSCPQCKEDFDSQDSLLQHLTVH----YMTTSTHYVCESCDKQFSSVDDLQKHLLDMHTFVLYHCTLCQEVFDSKVSIQVHLAVKHSNEKKMYRCTACNWDFRKETDLQLHVKHSHLGNPAKAR 798          
BLAST of SMED30020202 vs. TrEMBL
Match: A0A1I8Q3D1 (Uncharacterized protein OS=Stomoxys calcitrans OX=35570 GN=106088697 PE=4 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 9.758e-6
Identity = 108/485 (22.27%), Postives = 177/485 (36.49%), Query Frame = 3
Query: 1275 YMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDTKCVVSNPIVGVNCEANNQCIKCCTYF---ASSNSHLSHCKKVCKIIVA--NPXXXXXXXXXXXXXTNAQYESQLEIDLGDSDNLTPMIVNDLINNPAFVTKRINEFNCNLCC-CYFASYKSIGHHLEHYHRIEIRSGNTKKTPETENMNVIQDFIHKCDECDSKYASKEALVKHKQQNHPLKHSESIPNKNFNPTEIFNRLP---IEKPCKIQPQSSPPRKLLTPSSFSLSNLVPMFSPEALNLSTTQSSIYHNVPI------LQRISPMIPKQNSIKRSKVPPNANGEFECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDCKQGFMSQISYQEHRKSQCPKLYGTNAFESNGXXXXXXXXXXXXXXXXXXXXXXXXXXXCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCMKCTRSFTTYMAFRVHTTKTH 2684
            + C +C+  F  +    RH  +H   + + C +C  AF+R+  LK H  T           + +   QC  C   +   A+  SH+ + KK   ++ A  NP+  +         ++     +    L      +P   + L  N    +   N   C  C    F + + +  HL+  H  E+    T  TP         +F   C+ C  K+A+  A+ +H +  H  + +   PN  F   E FNRL       P  +  Q  P R   +    S+     + SP++L+ S  QS    + P        + I+P    Q S + + +  +  G F C +C+       S  NH+KSH   +     C  C      Q  Y+ H  S       TN+  +   +   S      L        ++    C  C+  F  +  ++ H A  HS E+    C  C   F     F VH    H
Sbjct:  347 FKCDYCARLFKHKRSRDRHTKLHTGDRRYRCPHCEAAFSRSDHLKIHMKTH----------DNQKPFQCTICNRGYNTAAALTSHMQNHKKQAALLAAGGNPQALNYSPRSTGSASSNSSLQKRRYALSLGSEHSP---SRLEFNKRGRSSSSNLLKCTFCSKSDFTTVEQLNSHLQAQHEKELAHSMTPPTPTNVPSTDAPNFQMTCEYCTMKFANIAAMFQHMRSAHVDRLTS--PNSYF---EHFNRLAACGTFSPRLLTGQ--PLRSTASADENSIKEESTLASPKSLDASVRQSE---DEPTDLSQNNRRSITPSRTPQKSPQDTAM-ADKPGVFLCNQCNAGLPDFESFRNHLKSHI-AQGLNMVCHHCGLMLREQSEYERHIISH---FLITNSEYNCSTSCQKSFGKPEELQKHLMEQHATTMYKCGLCSEMFETKVAIQVHFACTHSAETKLFRCSACMDVFRAESDFNVHVKTRH 803          
BLAST of SMED30020202 vs. Ensembl Cavefish
Match: znf740b (zinc finger protein 740 [Source:NCBI gene;Acc:103043273])

HSP 1 Score: 51.6026 bits (122), Expect = 1.700e-6
Identity = 30/97 (30.93%), Postives = 48/97 (49.48%), Query Frame = 3
Query: 1269 RNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDTKCVVSNPIVGVNCEANNQCIKCCTYFASSNSHLSHCKKVCKIIVA 1559
            +N++C HC   F S     RHIL H   K FGC+ C M F + + L++H+             + E   QC +C   F+ ++  L H +++C + VA
Sbjct:  149 KNFICEHCYGAFRSSYHLKRHILTHTGEKPFGCDVCDMRFIQRYHLERHKRVH----------SGEKPYQCDRCQQNFSRTDRLLRH-RRLCAVGVA 234          
BLAST of SMED30020202 vs. Ensembl Cavefish
Match: hic1 (HIC ZBTB transcriptional repressor 1 [Source:NCBI gene;Acc:103024838])

HSP 1 Score: 52.7582 bits (125), Expect = 2.149e-6
Identity = 31/102 (30.39%), Postives = 43/102 (42.16%), Query Frame = 3
Query: 1230 TNIKSAEPFNLATRNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDTKCVVSNPIVGVNCEANNQCIKCCTYFASSNSHLSHCK 1535
              ++  E  +  TR Y CS C   F  R   +RH+  H   K F C+ CGM FTR + L +H              + E   +C  C   FA   + +SH K
Sbjct:  560 ATLRQHEKTHWLTRPYPCSICGKKFTQRGTMTRHMRSHLGLKPFACDACGMRFTRQYRLTEHMRIH----------SGEKPYECQVCGGKFAQQRNLISHMK 651          
BLAST of SMED30020202 vs. Ensembl Cavefish
Match: znf148 (zinc finger protein 148 [Source:NCBI gene;Acc:103046119])

HSP 1 Score: 51.9878 bits (123), Expect = 3.596e-6
Identity = 25/92 (27.17%), Postives = 47/92 (51.09%), Query Frame = 3
Query: 1269 RNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDTKCVVSNPIVGVNCEANNQCIKCCTYFASSNSHLSHCKKVC 1544
            ++++C HC+  F +     RH+ +H   K F C+ CGM F + + +++H+ T           + E   QC  C  YF+ ++  L H +++C
Sbjct:  178 KSHICEHCNAAFRTNYHLQRHVFIHTGEKPFRCDECGMRFIQKYHMERHKRTH----------SGEKPYQCDYCHQYFSRTDRVLKH-RRMC 258          
BLAST of SMED30020202 vs. Ensembl Cavefish
Match: znf148 (zinc finger protein 148 [Source:NCBI gene;Acc:103046119])

HSP 1 Score: 50.8322 bits (120), Expect = 7.692e-6
Identity = 26/90 (28.89%), Postives = 44/90 (48.89%), Query Frame = 3
Query: 1275 YMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDTKCVVSNPIVGVNCEANNQCIKCCTYFASSNSHLSHCKKVC 1544
            + CS C M F  + +  RH  +H   K F C+ CGM F + + +++H+ T           + E   QC  C  YF+ ++  L H +++C
Sbjct:  208 FQCSQCDMRFIQKYLLQRHEKIHTGEKPFRCDECGMRFIQKYHMERHKRTH----------SGEKPYQCDYCHQYFSRTDRVLKH-RRMC 286          
BLAST of SMED30020202 vs. Ensembl Cavefish
Match: ENSAMXT00000054352.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001626.1:135843:137033:-1 gene:ENSAMXG00000043978.1 transcript:ENSAMXT00000054352.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 8.091e-6
Identity = 22/69 (31.88%), Postives = 38/69 (55.07%), Query Frame = 3
Query: 1212 KTDIKATNIKSAEPFNLATRNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHR 1418
            K+  + +N+++    +   + Y CS C M F  ++   +H L+H   K + C  CG+AF  + TLKQH+
Sbjct:  158 KSFSQKSNLQTHRRIHTGEKTYYCSECKMSFSQQSALQKHQLIHTGEKPYQCSECGIAFRESGTLKQHQ 226          
BLAST of SMED30020202 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005004.1 (pep scaffold:Pmarinus_7.0:GL484587:30140:35096:1 gene:ENSPMAG00000004537.1 transcript:ENSPMAT00000005004.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.6766 bits (117), Expect = 2.666e-6
Identity = 27/92 (29.35%), Postives = 45/92 (48.91%), Query Frame = 3
Query: 1269 RNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDTKCVVSNPIVGVNCEANNQCIKCCTYFASSNSHLSHCKKVC 1544
            + Y CS C+M F  + +  RH  +H   K F CE CGM F + + L++H+ T           + E   +C  C  Y++ ++    H K++C
Sbjct:   32 KAYQCSQCTMRFIQKYLLQRHEKIHSGEKPFTCEQCGMRFIQKYHLERHKRTH----------SGEKPYECDYCHQYYSRTDQLAKH-KRMC 112          
BLAST of SMED30020202 vs. Ensembl Medaka
Match: ENSORLT00000037362.1 (gastrula zinc finger protein XlCGF57.1 [Source:NCBI gene;Acc:101169270])

HSP 1 Score: 54.299 bits (129), Expect = 5.536e-7
Identity = 26/69 (37.68%), Postives = 38/69 (55.07%), Query Frame = 3
Query: 1212 KTDIKATNIKSAEPFNLATRNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHR 1418
            KT  + +++KS  P +   + + CS C   F       RH++VHR  KAF C  CG  FT + +LK+HR
Sbjct:  238 KTFTQNSSLKSHRPVHTGEKPFSCSVCGKPFSLENNLKRHLMVHRDQKAFSCHVCGEGFTESGSLKRHR 306          
BLAST of SMED30020202 vs. Ensembl Medaka
Match: hic1 (HIC ZBTB transcriptional repressor 1 [Source:NCBI gene;Acc:101164578])

HSP 1 Score: 53.1434 bits (126), Expect = 1.390e-6
Identity = 31/102 (30.39%), Postives = 44/102 (43.14%), Query Frame = 3
Query: 1230 TNIKSAEPFNLATRNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDTKCVVSNPIVGVNCEANNQCIKCCTYFASSNSHLSHCK 1535
              ++  E  +  TR Y CS C   F  R   +RH+  H   K F C++CGM FTR + L +H              + E   +C  C   FA   + +SH K
Sbjct:  552 ATLRQHEKTHWLTRPYPCSICGKKFTQRGTMTRHMRSHLGLKPFACDSCGMRFTRQYRLTEHMRIH----------SGEKPYECQVCGGKFAQQRNLISHMK 643          
BLAST of SMED30020202 vs. Ensembl Medaka
Match: znf148 (zinc finger protein 148 [Source:NCBI gene;Acc:101167003])

HSP 1 Score: 51.2174 bits (121), Expect = 6.079e-6
Identity = 26/90 (28.89%), Postives = 44/90 (48.89%), Query Frame = 3
Query: 1275 YMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDTKCVVSNPIVGVNCEANNQCIKCCTYFASSNSHLSHCKKVC 1544
            + CS C M F  + +  RH  +H   K F C+ CGM F + + +++H+ T           + E   QC  C  YF+ ++  L H +++C
Sbjct:   88 FQCSQCDMRFIQKYLLQRHEKIHTGEKPFRCDECGMRFIQKYHMERHKRTH----------SGEKPYQCDYCHQYFSRTDRVLKH-RRMC 166          
BLAST of SMED30020202 vs. Ensembl Medaka
Match: znf148 (zinc finger protein 148 [Source:NCBI gene;Acc:101167003])

HSP 1 Score: 50.8322 bits (120), Expect = 8.081e-6
Identity = 26/90 (28.89%), Postives = 44/90 (48.89%), Query Frame = 3
Query: 1275 YMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDTKCVVSNPIVGVNCEANNQCIKCCTYFASSNSHLSHCKKVC 1544
            + CS C M F  + +  RH  +H   K F C+ CGM F + + +++H+ T           + E   QC  C  YF+ ++  L H +++C
Sbjct:  199 FQCSQCDMRFIQKYLLQRHEKIHTGEKPFRCDECGMRFIQKYHMERHKRTH----------SGEKPYQCDYCHQYFSRTDRVLKH-RRMC 277          
BLAST of SMED30020202 vs. Ensembl Medaka
Match: ENSORLT00000027537.1 (pep primary_assembly:ASM223467v1:1:16241673:16245538:1 gene:ENSORLG00000029994.1 transcript:ENSORLT00000027537.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 8.440e-6
Identity = 40/154 (25.97%), Postives = 66/154 (42.86%), Query Frame = 3
Query:  972 AIPLRISPIPETNGNHNSPISDLNNQQTINESETESQSHVIDLXXXXXXXXXXXXDCETVWKIKSLDPEDTKISLSKIQL------KTDIKATNIKSAEPFNLATRNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQH 1415
            A  L  SP   TN    S  +DLNNQQ +NE++++ ++        S        +C T +K K       +I   +         ++  +A+ +KS    +   R + C  C   F  +    RH+ +H   K F C++CG +F     LK+H
Sbjct:   17 AGTLMESP---TNEEDESSEADLNNQQKLNETDSQDEA---GSQHESDEEPYVCKECGTSFKRKCNLKRHMRIHTGEKPFSCKDCGRSFNRASILKSHLRIHAGERPFSCKECETSFTQKGALKRHMRIHTGEKPFSCKDCGRSFNHETILKRH 164          
BLAST of SMED30020202 vs. Planmine SMEST
Match: SMESG000040789.1 (SMESG000040789.1)

HSP 1 Score: 1696.4 bits (4392), Expect = 0.000e+0
Identity = 903/903 (100.00%), Postives = 903/903 (100.00%), Query Frame = 3
Query:  225 MSFNEEYPIQCKTESYLEVKLKIEESCEMEDSDIYCVFCSKFFDSIEKVENHVAEFHNGDESTTDKPETNDFLNHTETDLEIQIPYQKLSQTLSRISDDKTHLGLSDKLTVYDSNLNVVYVDGRKLDQIKFCVRCSRHFDGEDNFRQHQLKDHAIRKRKRSNHPNGVEGIVVTGDGRWSCDVCGREFPTLKQAKVHKFKSHIEPIQKQEMLSHEFMIRNNSVQETGNEQVVARNPYQNTQQVVNNQADNAIPLRISPIPETNGNHNSPISDLNNQQTINESETESQSHVIDLXXXXXXXXXXXXDCETVWKIKSLDPEDTKISLSKIQLKTDIKATNIKSAEPFNLATRNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDTKCVVSNPIVGVNCEANNQCIKCCTYFASSNSHLSHCKKVCKIIVANPXXXXXXXXXXXXXTNAQYESQLEIDLGDSDNLTPMIVNDLINNPAFVTKRINEFNCNLCCCYFASYKSIGHHLEHYHRIEIRSGNTKKTPETENMNVIQDFIHKCDECDSKYASKEALVKHKQQNHPLKHSESIPNKNFNPTEIFNRLPIEKPCKIQPQSSPPRKLLTPSSFSLSNLVPMFSPEALNLSTTQSSIYHNVPILQRISPMIPKQNSIKRSKVPPNANGEFECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDCKQGFMSQISYQEHRKSQCPKLYGTNAFESNGXXXXXXXXXXXXXXXXXXXXXXXXXXXCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCMKCTRSFTTYMAFRVHTTKTHGGPNGTRLKNSQITKTXXXXXXXXXXXXXXXXXXXXXXXXXXRHTCQTCKKDFGTAQALGNHKRVCELPIFSETSVSKDQLII 2933
            MSFNEEYPIQCKTESYLEVKLKIEESCEMEDSDIYCVFCSKFFDSIEKVENHVAEFHNGDESTTDKPETNDFLNHTETDLEIQIPYQKLSQTLSRISDDKTHLGLSDKLTVYDSNLNVVYVDGRKLDQIKFCVRCSRHFDGEDNFRQHQLKDHAIRKRKRSNHPNGVEGIVVTGDGRWSCDVCGREFPTLKQAKVHKFKSHIEPIQKQEMLSHEFMIRNNSVQETGNEQVVARNPYQNTQQVVNNQADNAIPLRISPIPETNGNHNSPISDLNNQQTINESETESQSHVIDLSQSSSPNNANNPDCETVWKIKSLDPEDTKISLSKIQLKTDIKATNIKSAEPFNLATRNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDTKCVVSNPIVGVNCEANNQCIKCCTYFASSNSHLSHCKKVCKIIVANPEEESSKESVKSEETNAQYESQLEIDLGDSDNLTPMIVNDLINNPAFVTKRINEFNCNLCCCYFASYKSIGHHLEHYHRIEIRSGNTKKTPETENMNVIQDFIHKCDECDSKYASKEALVKHKQQNHPLKHSESIPNKNFNPTEIFNRLPIEKPCKIQPQSSPPRKLLTPSSFSLSNLVPMFSPEALNLSTTQSSIYHNVPILQRISPMIPKQNSIKRSKVPPNANGEFECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDCKQGFMSQISYQEHRKSQCPKLYGTNAFESNGVTSFSSPTVSFSLSITSPSSASSRATSCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCMKCTRSFTTYMAFRVHTTKTHGGPNGTRLKNSQITKTPPQSPISSFSESPFSTFHLSTFSSLTRHTCQTCKKDFGTAQALGNHKRVCELPIFSETSVSKDQLII
Sbjct:    1 MSFNEEYPIQCKTESYLEVKLKIEESCEMEDSDIYCVFCSKFFDSIEKVENHVAEFHNGDESTTDKPETNDFLNHTETDLEIQIPYQKLSQTLSRISDDKTHLGLSDKLTVYDSNLNVVYVDGRKLDQIKFCVRCSRHFDGEDNFRQHQLKDHAIRKRKRSNHPNGVEGIVVTGDGRWSCDVCGREFPTLKQAKVHKFKSHIEPIQKQEMLSHEFMIRNNSVQETGNEQVVARNPYQNTQQVVNNQADNAIPLRISPIPETNGNHNSPISDLNNQQTINESETESQSHVIDLSQSSSPNNANNPDCETVWKIKSLDPEDTKISLSKIQLKTDIKATNIKSAEPFNLATRNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDTKCVVSNPIVGVNCEANNQCIKCCTYFASSNSHLSHCKKVCKIIVANPEEESSKESVKSEETNAQYESQLEIDLGDSDNLTPMIVNDLINNPAFVTKRINEFNCNLCCCYFASYKSIGHHLEHYHRIEIRSGNTKKTPETENMNVIQDFIHKCDECDSKYASKEALVKHKQQNHPLKHSESIPNKNFNPTEIFNRLPIEKPCKIQPQSSPPRKLLTPSSFSLSNLVPMFSPEALNLSTTQSSIYHNVPILQRISPMIPKQNSIKRSKVPPNANGEFECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDCKQGFMSQISYQEHRKSQCPKLYGTNAFESNGVTSFSSPTVSFSLSITSPSSASSRATSCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCMKCTRSFTTYMAFRVHTTKTHGGPNGTRLKNSQITKTPPQSPISSFSESPFSTFHLSTFSSLTRHTCQTCKKDFGTAQALGNHKRVCELPIFSETSVSKDQLII 903          
BLAST of SMED30020202 vs. Planmine SMEST
Match: SMESG000040789.1 (SMESG000040789.1)

HSP 1 Score: 1688.7 bits (4372), Expect = 0.000e+0
Identity = 901/901 (100.00%), Postives = 901/901 (100.00%), Query Frame = 3
Query:  225 MSFNEEYPIQCKTESYLEVKLKIEESCEMEDSDIYCVFCSKFFDSIEKVENHVAEFHNGDESTTDKPETNDFLNHTETDLEIQIPYQKLSQTLSRISDDKTHLGLSDKLTVYDSNLNVVYVDGRKLDQIKFCVRCSRHFDGEDNFRQHQLKDHAIRKRKRSNHPNGVEGIVVTGDGRWSCDVCGREFPTLKQAKVHKFKSHIEPIQKQEMLSHEFMIRNNSVQETGNEQVVARNPYQNTQQVVNNQADNAIPLRISPIPETNGNHNSPISDLNNQQTINESETESQSHVIDLXXXXXXXXXXXXDCETVWKIKSLDPEDTKISLSKIQLKTDIKATNIKSAEPFNLATRNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDTKCVVSNPIVGVNCEANNQCIKCCTYFASSNSHLSHCKKVCKIIVANPXXXXXXXXXXXXXTNAQYESQLEIDLGDSDNLTPMIVNDLINNPAFVTKRINEFNCNLCCCYFASYKSIGHHLEHYHRIEIRSGNTKKTPETENMNVIQDFIHKCDECDSKYASKEALVKHKQQNHPLKHSESIPNKNFNPTEIFNRLPIEKPCKIQPQSSPPRKLLTPSSFSLSNLVPMFSPEALNLSTTQSSIYHNVPILQRISPMIPKQNSIKRSKVPPNANGEFECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDCKQGFMSQISYQEHRKSQCPKLYGTNAFESNGXXXXXXXXXXXXXXXXXXXXXXXXXXXCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCMKCTRSFTTYMAFRVHTTKTHGGPNGTRLKNSQITKTXXXXXXXXXXXXXXXXXXXXXXXXXXRHTCQTCKKDFGTAQALGNHKRVCELPIFSETSVSKDQL 2927
            MSFNEEYPIQCKTESYLEVKLKIEESCEMEDSDIYCVFCSKFFDSIEKVENHVAEFHNGDESTTDKPETNDFLNHTETDLEIQIPYQKLSQTLSRISDDKTHLGLSDKLTVYDSNLNVVYVDGRKLDQIKFCVRCSRHFDGEDNFRQHQLKDHAIRKRKRSNHPNGVEGIVVTGDGRWSCDVCGREFPTLKQAKVHKFKSHIEPIQKQEMLSHEFMIRNNSVQETGNEQVVARNPYQNTQQVVNNQADNAIPLRISPIPETNGNHNSPISDLNNQQTINESETESQSHVIDLSQSSSPNNANNPDCETVWKIKSLDPEDTKISLSKIQLKTDIKATNIKSAEPFNLATRNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDTKCVVSNPIVGVNCEANNQCIKCCTYFASSNSHLSHCKKVCKIIVANPEEESSKESVKSEETNAQYESQLEIDLGDSDNLTPMIVNDLINNPAFVTKRINEFNCNLCCCYFASYKSIGHHLEHYHRIEIRSGNTKKTPETENMNVIQDFIHKCDECDSKYASKEALVKHKQQNHPLKHSESIPNKNFNPTEIFNRLPIEKPCKIQPQSSPPRKLLTPSSFSLSNLVPMFSPEALNLSTTQSSIYHNVPILQRISPMIPKQNSIKRSKVPPNANGEFECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDCKQGFMSQISYQEHRKSQCPKLYGTNAFESNGVTSFSSPTVSFSLSITSPSSASSRATSCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCMKCTRSFTTYMAFRVHTTKTHGGPNGTRLKNSQITKTPPQSPISSFSESPFSTFHLSTFSSLTRHTCQTCKKDFGTAQALGNHKRVCELPIFSETSVSKDQL
Sbjct:    1 MSFNEEYPIQCKTESYLEVKLKIEESCEMEDSDIYCVFCSKFFDSIEKVENHVAEFHNGDESTTDKPETNDFLNHTETDLEIQIPYQKLSQTLSRISDDKTHLGLSDKLTVYDSNLNVVYVDGRKLDQIKFCVRCSRHFDGEDNFRQHQLKDHAIRKRKRSNHPNGVEGIVVTGDGRWSCDVCGREFPTLKQAKVHKFKSHIEPIQKQEMLSHEFMIRNNSVQETGNEQVVARNPYQNTQQVVNNQADNAIPLRISPIPETNGNHNSPISDLNNQQTINESETESQSHVIDLSQSSSPNNANNPDCETVWKIKSLDPEDTKISLSKIQLKTDIKATNIKSAEPFNLATRNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDTKCVVSNPIVGVNCEANNQCIKCCTYFASSNSHLSHCKKVCKIIVANPEEESSKESVKSEETNAQYESQLEIDLGDSDNLTPMIVNDLINNPAFVTKRINEFNCNLCCCYFASYKSIGHHLEHYHRIEIRSGNTKKTPETENMNVIQDFIHKCDECDSKYASKEALVKHKQQNHPLKHSESIPNKNFNPTEIFNRLPIEKPCKIQPQSSPPRKLLTPSSFSLSNLVPMFSPEALNLSTTQSSIYHNVPILQRISPMIPKQNSIKRSKVPPNANGEFECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDCKQGFMSQISYQEHRKSQCPKLYGTNAFESNGVTSFSSPTVSFSLSITSPSSASSRATSCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCMKCTRSFTTYMAFRVHTTKTHGGPNGTRLKNSQITKTPPQSPISSFSESPFSTFHLSTFSSLTRHTCQTCKKDFGTAQALGNHKRVCELPIFSETSVSKDQL 901          
BLAST of SMED30020202 vs. Planmine SMEST
Match: SMESG000040789.1 (SMESG000040789.1)

HSP 1 Score: 1658.27 bits (4293), Expect = 0.000e+0
Identity = 885/890 (99.44%), Postives = 887/890 (99.66%), Query Frame = 3
Query:  225 MSFNEEYPIQCKTESYLEVKLKIEESCEMEDSDIYCVFCSKFFDSIEKVENHVAEFHNGDESTTDKPETNDFLNHTETDLEIQIPYQKLSQTLSRISDDKTHLGLSDKLTVYDSNLNVVYVDGRKLDQIKFCVRCSRHFDGEDNFRQHQLKDHAIRKRKRSNHPNGVEGIVVTGDGRWSCDVCGREFPTLKQAKVHKFKSHIEPIQKQEMLSHEFMIRNNSVQETGNEQVVARNPYQNTQQVVNNQADNAIPLRISPIPETNGNHNSPISDLNNQQTINESETESQSHVIDLXXXXXXXXXXXXDCETVWKIKSLDPEDTKISLSKIQLKTDIKATNIKSAEPFNLATRNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDTKCVVSNPIVGVNCEANNQCIKCCTYFASSNSHLSHCKKVCKIIVANPXXXXXXXXXXXXXTNAQYESQLEIDLGDSDNLTPMIVNDLINNPAFVTKRINEFNCNLCCCYFASYKSIGHHLEHYHRIEIRSGNTKKTPETENMNVIQDFIHKCDECDSKYASKEALVKHKQQNHPLKHSESIPNKNFNPTEIFNRLPIEKPCKIQPQSSPPRKLLTPSSFSLSNLVPMFSPEALNLSTTQSSIYHNVPILQRISPMIPKQNSIKRSKVPPNANGEFECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDCKQGFMSQISYQEHRKSQCPKLYGTNAFESNGXXXXXXXXXXXXXXXXXXXXXXXXXXXCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCMKCTRSFTTYMAFRVHTTKTHGGPNGTRLKNSQITKTXXXXXXXXXXXXXXXXXXXXXXXXXXRHTCQTCKKDFGTAQALGNHKRVCELPI 2894
            MSFNEEYPIQCKTESYLEVKLKIEESCEMEDSDIYCVFCSKFFDSIEKVENHVAEFHNGDESTTDKPETNDFLNHTETDLEIQIPYQKLSQTLSRISDDKTHLGLSDKLTVYDSNLNVVYVDGRKLDQIKFCVRCSRHFDGEDNFRQHQLKDHAIRKRKRSNHPNGVEGIVVTGDGRWSCDVCGREFPTLKQAKVHKFKSHIEPIQKQEMLSHEFMIRNNSVQETGNEQVVARNPYQNTQQVVNNQADNAIPLRISPIPETNGNHNSPISDLNNQQTINESETESQSHVIDLSQSSSPNNANNPDCETVWKIKSLDPEDTKISLSKIQLKTDIKATNIKSAEPFNLATRNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDTKCVVSNPIVGVNCEANNQCIKCCTYFASSNSHLSHCKKVCKIIVANPEEESSKESVKSEETNAQYESQLEIDLGDSDNLTPMIVNDLINNPAFVTKRINEFNCNLCCCYFASYKSIGHHLEHYHRIEIRSGNTKKTPETENMNVIQDFIHKCDECDSKYASKEALVKHKQQNHPLKHSESIPNKNFNPTEIFNRLPIEKPCKIQPQSSPPRKLLTPSSFSLSNLVPMFSPEALNLSTTQSSIYHNVPILQRISPMIPKQNSIKRSKVPPNANGEFECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDCKQGFMSQISYQEHRKSQCPKLYGTNAFESNGVTSFSSPTVSFSLSITSPSSASSRATSCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCMKCTRSFTTYMAFRVHTTKTHGGPNGTRLKNSQITKTPPQSPISSFSESPFSTFHLSTFSSLTRHTCQTCKKDFGTAQALGNHKRV  + +
Sbjct:    1 MSFNEEYPIQCKTESYLEVKLKIEESCEMEDSDIYCVFCSKFFDSIEKVENHVAEFHNGDESTTDKPETNDFLNHTETDLEIQIPYQKLSQTLSRISDDKTHLGLSDKLTVYDSNLNVVYVDGRKLDQIKFCVRCSRHFDGEDNFRQHQLKDHAIRKRKRSNHPNGVEGIVVTGDGRWSCDVCGREFPTLKQAKVHKFKSHIEPIQKQEMLSHEFMIRNNSVQETGNEQVVARNPYQNTQQVVNNQADNAIPLRISPIPETNGNHNSPISDLNNQQTINESETESQSHVIDLSQSSSPNNANNPDCETVWKIKSLDPEDTKISLSKIQLKTDIKATNIKSAEPFNLATRNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDTKCVVSNPIVGVNCEANNQCIKCCTYFASSNSHLSHCKKVCKIIVANPEEESSKESVKSEETNAQYESQLEIDLGDSDNLTPMIVNDLINNPAFVTKRINEFNCNLCCCYFASYKSIGHHLEHYHRIEIRSGNTKKTPETENMNVIQDFIHKCDECDSKYASKEALVKHKQQNHPLKHSESIPNKNFNPTEIFNRLPIEKPCKIQPQSSPPRKLLTPSSFSLSNLVPMFSPEALNLSTTQSSIYHNVPILQRISPMIPKQNSIKRSKVPPNANGEFECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDCKQGFMSQISYQEHRKSQCPKLYGTNAFESNGVTSFSSPTVSFSLSITSPSSASSRATSCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCMKCTRSFTTYMAFRVHTTKTHGGPNGTRLKNSQITKTPPQSPISSFSESPFSTFHLSTFSSLTRHTCQTCKKDFGTAQALGNHKRVYAIGV 890          
BLAST of SMED30020202 vs. Planmine SMEST
Match: SMESG000065210.1 (SMESG000065210.1)

HSP 1 Score: 219.935 bits (559), Expect = 8.133e-60
Identity = 185/543 (34.07%), Postives = 257/543 (47.33%), Query Frame = 3
Query: 1434 VSNPIVGVNCEANNQCIKCCTYFASSNSHLSHCKKVCKIIVANPXXXXXXXXXXXXXTNAQYESQLEIDLGDSDNLTPMIVNDLINNPAFVT-KRINEF--NCNLCCCYFASYKSIGHHLEHYH---RIEIR-SGNTKKTPETENMNVIQDFIH-------------KCDECDSKYASKEALVKHKQQNHPLKHSESIPNKNFNPTEIFNRLPIEKPCKIQPQSSPPRKLLTPSSFSLSNLVPMFSPEALNLSTTQSSIYHNVPILQRISPMIPKQNSIKRSKVPPNANGEFECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDCKQGFMSQISYQEHRKSQCP----------KLYGTNAFE-------------------SNGXXXXXXXXXXXXXXXXXXXXXXXXXXXCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCMKCTRSFTTYMAFRVHTTKTHGGPNGTRLK-----------NSQITKTXXXXXXXXXXXXXXXXXXXXXXXXXXRHTCQTCKKDFGTAQALGNHKRVC 2882
            ++NP + +N  +   C  C + F S+NS L H     +I + +                    + L I   +S      I+N+ +N+ +  T K I  F  NC  C   FAS K +  HL   H    I+++       + ++ + N ++D                KCD C  ++ +   L +H++    L  +ES  N       I      +KP   +  + P  K      + LS   P  SP     ++T S               IP   + K++KVPPNA+G FEC ECHK F CRSSLSNH+KSHFN +NKPF C  C QGFMS ++ Q HR+  CP          ++  +N+ E                   SN  +  ++     SL  +S ++ ++RATSCMHCNA FPDRSLLEDHA+KEHSN +GE++C+ C RSFTTYMAFRVH TK+HGGPNGT LK           N+        S   S      S+   +     +RH C  C KDF T+QALGNHKR C
Sbjct:  244 LNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQDGY------------------TALSISKCESVAKLKPILNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLKDDCSGWSSSSGGTGRRVKCDICRKRFRNPLTLDEHRR----LHENESCINSIVEADGIATN---DKPAAGESTTFPRIKT---EEYMLSK--PAASPANNKKASTYS---------------IP---TYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQQLCPNINREENSEQEVNNSNSLELAPQQNIYSSFDGVSQVPGSNYSSVSNTGDSGSSLYTSSTNNLTTRATSCMHCNAMFPDRSLLEDHASKEHSNHAGEVVCIICPRSFTTYMAFRVHMTKSHGGPNGTSLKSHLNAASIHKANTSFEMIQELSSSLSKERPSSSSNPSNGKVFHSRHACPNCDKDFSTSQALGNHKRAC 738          

HSP 2 Score: 80.8777 bits (198), Expect = 3.495e-15
Identity = 79/298 (26.51%), Postives = 119/298 (39.93%), Query Frame = 3
Query: 1149 VWKIKSLDPEDTKISLSKIQLKTDIKATNI--KSAEPFNLATRNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDTKCVVSNPIVGVNCEANNQCIKCCTYFASSNSHLSHCKKVCKIIVA--------NPXXXXXXXXXXXXXTNAQYESQLEIDLGDSDNL---TPMIVNDLINNPAFVTKRINEFNCNLCCCYFASYKSIGHHLEHYHRIEIRSGNT-----------KKTP---------ETENMNVIQDFIHKCDECDSKYASKEALVKHKQQNH 1943
            +W+    +    KI LS++   T+    NI   S        R ++C +C   F +R  + RH+L+HR+ ++F C NC + F R   LKQH+             NC  N        +  S N+  S+ K +  I  A        NP     ++ + +   +     +  I   D+D             +NNPA    + ++  CNLC   F S  SI  HL  +HRI I+ G T           K  P          T     I  FIH C+ C S++ASK+ L +H    H
Sbjct:   71 LWRAAQSNSRGNKIVLSRVYSITNQNELNINGSSNRYGRFRKRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKE-----------NCSPN--------FIKSLNNTESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAEKFLNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQDGYTALSISKCESVAKLKPILNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVH 349          
BLAST of SMED30020202 vs. Planmine SMEST
Match: SMESG000065210.1 (SMESG000065210.1)

HSP 1 Score: 219.935 bits (559), Expect = 8.527e-60
Identity = 170/464 (36.64%), Postives = 230/464 (49.57%), Query Frame = 3
Query: 1671 IVNDLINNPAFVT-KRINEF--NCNLCCCYFASYKSIGHHLEHYH---RIEIR-SGNTKKTPETENMNVIQDFIH-------------KCDECDSKYASKEALVKHKQQNHPLKHSESIPNKNFNPTEIFNRLPIEKPCKIQPQSSPPRKLLTPSSFSLSNLVPMFSPEALNLSTTQSSIYHNVPILQRISPMIPKQNSIKRSKVPPNANGEFECTECHKAFGCRSSLSNHIKSHFNLRNKPFPCEDCKQGFMSQISYQEHRKSQCP----------KLYGTNAFE-------------------SNGXXXXXXXXXXXXXXXXXXXXXXXXXXXCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCMKCTRSFTTYMAFRVHTTKTHGGPNGTRLK-----------NSQITKTXXXXXXXXXXXXXXXXXXXXXXXXXXRHTCQTCKKDFGTAQALGNHKRVC 2882
            I+N+ +N+ +  T K I  F  NC  C   FAS K +  HL   H    I+++       + ++ + N ++D                KCD C  ++ +   L +H++    L  +ES  N       I      +KP   +  + P  K      + LS   P  SP     ++T S               IP   + K++KVPPNA+G FEC ECHK F CRSSLSNH+KSHFN +NKPF C  C QGFMS ++ Q HR+  CP          ++  +N+ E                   SN  +  ++     SL  +S ++ ++RATSCMHCNA FPDRSLLEDHA+KEHSN +GE++C+ C RSFTTYMAFRVH TK+HGGPNGT LK           N+        S   S      S+   +     +RH C  C KDF T+QALGNHKR C
Sbjct:  315 ILNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLKDDCSGWSSSSGGTGRRVKCDICRKRFRNPLTLDEHRR----LHENESCINSIVEADGIATN---DKPAAGESTTFPRIKT---EEYMLSK--PAASPANNKKASTYS---------------IP---TYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQQLCPNINREENSEQEVNNSNSLELAPQQNIYSSFDGVSQVPGSNYSSVSNTGDSGSSLYTSSTNNLTTRATSCMHCNAMFPDRSLLEDHASKEHSNHAGEVVCIICPRSFTTYMAFRVHMTKSHGGPNGTSLKSHLNAASIHKANTSFEMIQELSSSLSKERPSSSSNPSNGKVFHSRHACPNCDKDFSTSQALGNHKRAC 748          

HSP 2 Score: 81.2629 bits (199), Expect = 2.363e-15
Identity = 79/296 (26.69%), Postives = 124/296 (41.89%), Query Frame = 3
Query: 1149 VWKIKSLDPEDTKISLSKIQLKTDIKATNI--KSAEPFNLATRNYMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDTKCVVSNPIVGVNCEANNQCIKCCTYFASSNSH-----LSHCKKVCKI-IVANPXXXXXXXXXXXXXTNAQYE---SQLEIDLGDSDNLTPMIVNDLINNPAFVTKRINEFNCNLCCCYFASYKSIGHHLEHYHRIEIRSGNT-----------KKTP---------ETENMNVIQDFIHKCDECDSKYASKEALVKHKQQNH 1943
            +W+    +    KI LS++   T+    NI   S        R ++C +C   F +R  + RH+L+HR+ ++F C NC + F R   LKQH+   C   N I  +    NN  +   ++ A+ ++      ++  +K  K  +  NP +         +      +   SQ + D     N+        +NNPA    + ++  CNLC   F S  SI  HL  +HRI I+ G T           K  P          T     I  FIH C+ C S++ASK+ L +H    H
Sbjct:   71 LWRAAQSNSRGNKIVLSRVYSITNQNELNINGSSNRYGRFRKRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENC-SPNFIKSL----NNTVLNNNSFIATESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMK--FAEKFLNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQDGYTALSISKCESVAKLKPILNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVH 359          
The following BLAST results are available for this feature:
BLAST of SMED30020202 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZNF2813.937e-830.21zinc finger protein 281 [Source:HGNC Symbol;Acc:HG... [more]
ZNF2813.964e-830.21zinc finger protein 281 [Source:HGNC Symbol;Acc:HG... [more]
ZNF2813.964e-830.21zinc finger protein 281 [Source:HGNC Symbol;Acc:HG... [more]
ZNF559-ZNF1772.571e-626.49ZNF559-ZNF177 readthrough [Source:HGNC Symbol;Acc:... [more]
ZNF1772.571e-626.49zinc finger protein 177 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of SMED30020202 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020202 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG52451.572e-634.62gene:FBgn0038047 transcript:FBtr0082589[more]
back to top
BLAST of SMED30020202 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZNF4233.279e-721.75si:ch211-216l23.1 [Source:NCBI gene;Acc:566696][more]
ZNF4233.446e-721.75si:ch211-216l23.1 [Source:NCBI gene;Acc:566696][more]
si:ch211-216l23.13.687e-721.75si:ch211-216l23.1 [Source:NCBI gene;Acc:566696][more]
ZNF4233.691e-721.75si:ch211-216l23.1 [Source:NCBI gene;Acc:566696][more]
ZNF4233.969e-721.75si:ch211-216l23.1 [Source:NCBI gene;Acc:566696][more]
back to top
BLAST of SMED30020202 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZNF4235.949e-822.16zinc finger protein 423 [Source:NCBI gene;Acc:1004... [more]
ZNF4236.565e-822.16zinc finger protein 423 [Source:NCBI gene;Acc:1004... [more]
ZNF4237.965e-822.16zinc finger protein 423 [Source:NCBI gene;Acc:1004... [more]
ZNF4238.004e-822.16zinc finger protein 423 [Source:NCBI gene;Acc:1004... [more]
ZNF4238.524e-822.16zinc finger protein 423 [Source:NCBI gene;Acc:1004... [more]
back to top
BLAST of SMED30020202 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gm176552.355e-820.42predicted gene, 17655 [Source:MGI Symbol;Acc:MGI:4... [more]
Zfp2818.568e-829.90zinc finger protein 281 [Source:MGI Symbol;Acc:MGI... [more]
Zfp2818.568e-829.90zinc finger protein 281 [Source:MGI Symbol;Acc:MGI... [more]
Zfp7155.451e-736.92zinc finger protein 715 [Source:MGI Symbol;Acc:MGI... [more]
Zfp7155.451e-736.92zinc finger protein 715 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of SMED30020202 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q9Y2X9|ZN281_HUMAN1.903e-730.21Zinc finger protein 281 OS=Homo sapiens OX=9606 GN... [more]
sp|Q99LI5|ZN281_MOUSE5.993e-729.90Zinc finger protein 281 OS=Mus musculus OX=10090 G... [more]
sp|A1L1R6|ZN423_DANRE3.212e-621.75Zinc finger protein 423 OS=Danio rerio OX=7955 GN=... [more]
back to top
BLAST of SMED30020202 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 3
Match NameE-valueIdentityDescription
W5ML205.966e-621.18Zinc finger protein 423 OS=Lepisosteus oculatus OX... [more]
W5ML016.128e-621.18Zinc finger protein 423 OS=Lepisosteus oculatus OX... [more]
A0A1I8Q3D19.758e-622.27Uncharacterized protein OS=Stomoxys calcitrans OX=... [more]
back to top
BLAST of SMED30020202 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
znf740b1.700e-630.93zinc finger protein 740 [Source:NCBI gene;Acc:1030... [more]
hic12.149e-630.39HIC ZBTB transcriptional repressor 1 [Source:NCBI ... [more]
znf1483.596e-627.17zinc finger protein 148 [Source:NCBI gene;Acc:1030... [more]
znf1487.692e-628.89zinc finger protein 148 [Source:NCBI gene;Acc:1030... [more]
ENSAMXT00000054352.18.091e-631.88pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of SMED30020202 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005004.12.666e-629.35pep scaffold:Pmarinus_7.0:GL484587:30140:35096:1 g... [more]
back to top
BLAST of SMED30020202 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020202 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30020202 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000037362.15.536e-737.68gastrula zinc finger protein XlCGF57.1 [Source:NCB... [more]
hic11.390e-630.39HIC ZBTB transcriptional repressor 1 [Source:NCBI ... [more]
znf1486.079e-628.89zinc finger protein 148 [Source:NCBI gene;Acc:1011... [more]
znf1488.081e-628.89zinc finger protein 148 [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000027537.18.440e-625.97pep primary_assembly:ASM223467v1:1:16241673:162455... [more]
back to top
BLAST of SMED30020202 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040789.10.000e+0100.00SMESG000040789.1[more]
SMESG000040789.10.000e+0100.00SMESG000040789.1[more]
SMESG000040789.10.000e+099.44SMESG000040789.1[more]
SMESG000065210.18.133e-6034.07SMESG000065210.1[more]
SMESG000065210.18.527e-6036.64SMESG000065210.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020202 ID=SMED30020202|Name=SMED30020202|organism=Schmidtea mediterranea sexual|type=transcript|length=3217bp
CTATGATCAGCAAAAATGCCTTATTGCACACATGGCAGATACAGAAAGGG
TCAAGAGAATGTTTAACGAATCAGCTCAATGCATTGTTTCGTTGGTAAAA
TTTTATTGAAAACCCTTTGCAAACTTTGTACGATTGGAATTTTAATTATC
TATGTCAAACTAATTTCGAACAGTAAAAAAAAACCCTTAGATCAACATCG
AACGAAACGAGCAAAGAAAGTGAAATGAGTTTTAATGAAGAATATCCGAT
TCAATGTAAAACCGAGAGTTATTTGGAAGTGAAATTGAAAATCGAAGAAT
CTTGTGAAATGGAAGACTCTGATATCTATTGTGTTTTCTGTTCGAAATTT
TTCGATTCAATTGAAAAGGTTGAAAATCATGTCGCTGAATTCCACAACGG
CGATGAATCGACGACAGATAAACCCGAGACAAATGATTTTTTAAATCACA
CGGAAACAGATCTGGAAATCCAGATTCCGTATCAGAAGCTTTCACAGACC
CTGTCAAGAATATCCGATGATAAAACTCATTTGGGATTGTCGGATAAGCT
AACGGTTTATGATTCGAATTTAAATGTTGTATATGTCGATGGGAGAAAAT
TGGATCAAATAAAATTCTGTGTCAGATGCAGTAGACATTTTGATGGCGAA
GACAACTTTCGACAGCATCAATTGAAAGATCACGCAATTCGAAAACGAAA
GCGTTCAAATCATCCGAATGGTGTTGAAGGAATTGTTGTTACAGGAGACG
GCCGATGGAGCTGTGATGTTTGCGGAAGAGAATTTCCGACTTTAAAACAA
GCAAAAGTCCACAAATTCAAGTCACACATTGAACCGATACAAAAACAAGA
AATGCTCTCTCATGAATTTATGATTAGAAACAACTCGGTACAAGAAACTG
GAAACGAACAAGTAGTGGCTAGAAATCCTTATCAAAACACCCAACAAGTC
GTTAATAACCAAGCCGATAATGCAATACCTCTACGAATATCTCCGATTCC
AGAAACCAATGGTAACCATAACAGTCCAATTTCAGATCTAAATAATCAAC
AAACAATCAATGAATCTGAGACTGAAAGTCAATCACATGTTATCGATTTA
AGCCAATCATCCAGTCCTAACAATGCCAATAATCCCGATTGTGAAACGGT
TTGGAAAATTAAAAGCTTAGATCCAGAAGACACAAAAATTTCTTTATCGA
AAATTCAACTGAAAACCGACATTAAGGCAACCAATATCAAATCAGCAGAA
CCATTCAATTTAGCTACCAGAAATTACATGTGCTCACATTGTTCTATGTA
CTTTGGCAGTCGGGCTGTATATAGCAGGCATATTCTCGTTCACAGGCGTG
GTAAAGCGTTTGGTTGTGAAAACTGTGGAATGGCTTTCACTCGAAACCAC
ACCTTGAAACAACATAGAGATACGAAATGCGTTGTCAGTAATCCGATAGT
CGGAGTAAATTGTGAAGCCAATAATCAGTGTATCAAGTGTTGCACATATT
TTGCAAGTAGTAACAGCCATTTGTCTCATTGCAAAAAGGTATGCAAAATC
ATAGTGGCAAATCCCGAGGAAGAATCATCAAAGGAATCTGTGAAATCAGA
AGAAACTAACGCTCAATATGAAAGTCAATTGGAAATTGATCTCGGTGACA
GTGATAATTTGACCCCTATGATAGTCAATGATCTCATAAACAATCCTGCT
TTTGTTACCAAAAGAATAAATGAATTCAACTGCAATTTGTGCTGCTGCTA
TTTTGCCTCATATAAGAGTATTGGTCACCATTTAGAACATTACCATCGAA
TTGAAATCAGATCTGGAAATACAAAGAAGACTCCAGAAACGGAAAATATG
AATGTGATTCAAGATTTCATTCATAAATGCGATGAATGTGATAGTAAATA
TGCATCAAAAGAAGCCCTCGTGAAGCATAAACAACAAAATCATCCATTGA
AACATTCGGAATCTATTCCTAATAAAAATTTTAACCCCACTGAAATATTT
AATAGACTTCCTATTGAAAAGCCTTGTAAAATACAACCACAAAGCAGCCC
ACCTAGAAAACTTTTGACTCCTAGCAGCTTTTCTTTATCTAATTTAGTGC
CAATGTTTAGCCCAGAGGCTCTTAACTTATCCACAACACAGTCCTCTATA
TATCACAATGTCCCTATATTACAAAGAATAAGTCCGATGATTCCAAAACA
GAATTCTATTAAAAGATCTAAAGTTCCTCCAAATGCTAATGGGGAATTCG
AATGCACTGAGTGTCATAAAGCTTTTGGGTGCCGAAGTTCATTAAGTAAT
CATATAAAGTCTCATTTTAATTTACGAAACAAACCTTTTCCATGTGAAGA
TTGTAAACAAGGTTTTATGTCCCAAATAAGTTATCAAGAGCACAGGAAAA
GCCAATGCCCTAAACTTTATGGAACCAATGCCTTTGAAAGCAATGGTGTC
ACCAGCTTTTCTAGTCCTACAGTTTCTTTCAGCCTATCTATAACTAGCCC
ATCATCTGCTTCTAGTCGAGCTACTAGCTGCATGCATTGCAATGCAGCGT
TTCCCGACCGTTCTCTTTTAGAAGATCATGCAGCAAAAGAACATTCAAAT
GAAAGTGGAGAAATTATGTGCATGAAGTGTACACGGTCTTTCACAACATA
CATGGCTTTTAGAGTACACACAACGAAAACTCATGGCGGCCCTAATGGGA
CTCGATTAAAAAATTCTCAAATCACTAAAACTCCTCCACAATCTCCAATC
AGTTCATTCTCAGAATCCCCATTTTCAACATTTCATCTCAGTACTTTCTC
ATCATTGACTCGCCATACTTGCCAAACTTGTAAAAAAGATTTCGGTACCG
CACAAGCTTTAGGAAATCACAAACGGGTATGTGAGTTACCTATATTCAGT
GAAACCAGTGTAAGCAAAGACCAGTTAATCATTTAACGATATTATGCATA
TTTTTCAATCACCTATTTGTACTTTCTTGCATTTATTTTATGGTCTCTAT
AGTCATTTTTATTGTTGAGTTGGATTCTGATGATGATGATGGTGCTGATG
ATATTTACCTACTTGGATTGCATGGGTATCACTGTTATTAATTGTAACAC
TTCCTATATTTCAATTATTTTACTTTTGATGGATGGATTAGAAATATAAA
TTATTTATTATTTATTTCAATTATATTCAACCAATGTATTTATTTATATC
GCCTGGGACTTTCTACG
back to top

protein sequence of SMED30020202-orf-1

>SMED30020202-orf-1 ID=SMED30020202-orf-1|Name=SMED30020202-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=904bp
MSFNEEYPIQCKTESYLEVKLKIEESCEMEDSDIYCVFCSKFFDSIEKVE
NHVAEFHNGDESTTDKPETNDFLNHTETDLEIQIPYQKLSQTLSRISDDK
THLGLSDKLTVYDSNLNVVYVDGRKLDQIKFCVRCSRHFDGEDNFRQHQL
KDHAIRKRKRSNHPNGVEGIVVTGDGRWSCDVCGREFPTLKQAKVHKFKS
HIEPIQKQEMLSHEFMIRNNSVQETGNEQVVARNPYQNTQQVVNNQADNA
IPLRISPIPETNGNHNSPISDLNNQQTINESETESQSHVIDLSQSSSPNN
ANNPDCETVWKIKSLDPEDTKISLSKIQLKTDIKATNIKSAEPFNLATRN
YMCSHCSMYFGSRAVYSRHILVHRRGKAFGCENCGMAFTRNHTLKQHRDT
KCVVSNPIVGVNCEANNQCIKCCTYFASSNSHLSHCKKVCKIIVANPEEE
SSKESVKSEETNAQYESQLEIDLGDSDNLTPMIVNDLINNPAFVTKRINE
FNCNLCCCYFASYKSIGHHLEHYHRIEIRSGNTKKTPETENMNVIQDFIH
KCDECDSKYASKEALVKHKQQNHPLKHSESIPNKNFNPTEIFNRLPIEKP
CKIQPQSSPPRKLLTPSSFSLSNLVPMFSPEALNLSTTQSSIYHNVPILQ
RISPMIPKQNSIKRSKVPPNANGEFECTECHKAFGCRSSLSNHIKSHFNL
RNKPFPCEDCKQGFMSQISYQEHRKSQCPKLYGTNAFESNGVTSFSSPTV
SFSLSITSPSSASSRATSCMHCNAAFPDRSLLEDHAAKEHSNESGEIMCM
KCTRSFTTYMAFRVHTTKTHGGPNGTRLKNSQITKTPPQSPISSFSESPF
STFHLSTFSSLTRHTCQTCKKDFGTAQALGNHKRVCELPIFSETSVSKDQ
LII*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 34..57
e-value: 12.0
score: 12.7
coord: 550..573
e-value: 0.021
score: 24.0
coord: 130..153
e-value: 21.0
score: 10.5
coord: 501..524
e-value: 97.0
score: 4.6
coord: 767..790
e-value: 0.8
score: 18.7
coord: 379..399
e-value: 99.0
score: 4.5
coord: 178..201
e-value: 0.49
score: 19.4
coord: 351..373
e-value: 0.045
score: 22.9
coord: 705..725
e-value: 37.0
score: 8.3
coord: 797..820
e-value: 0.7
score: 18.9
coord: 675..697
e-value: 0.025
score: 23.7
coord: 864..884
e-value: 66.0
score: 6.0
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 180..201
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 503..524
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 132..153
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 353..373
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 552..573
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 36..57
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 769..790
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 799..820
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 677..697
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 550..582
score: 9.432
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 379..407
score: 9.349
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 34..62
score: 8.663
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 675..702
score: 12.424
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 767..795
score: 9.12
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 351..378
score: 9.681
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 797..825
score: 8.891
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 765..840
e-value: 1.9E-7
score: 33.1
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 328..402
e-value: 1.1E-9
score: 40.3
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 670..733
e-value: 1.6E-9
score: 39.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 277..302
NoneNo IPR availablePANTHERPTHR24376FAMILY NOT NAMEDcoord: 417..884
NoneNo IPR availablePANTHERPTHR24376:SF107coord: 417..884
coord: 31..432
NoneNo IPR availablePANTHERPTHR24376FAMILY NOT NAMEDcoord: 31..432
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 675..725
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 349..398