U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein

Overview
NameU4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein
Smed IDSMED30020180
Length (bp)557
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein (SMED30020180) t-SNE clustered cells

Violin plots show distribution of expression levels for U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein (SMED30020180) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein (SMED30020180) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein (SMED30020180) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020180

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30020180SMESG000029048.1 SmedASXL_019392SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30020180SMESG000029048.1 SmedASXL_019392SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
posterior muscle cellSMED30020180SMESG000029048.1 dd_Smed_v4_6062_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30020180SMESG000029048.1 dd_Smed_v4_6062_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. Ensembl Human
Match: SNRNP27 (small nuclear ribonucleoprotein U4/U6.U5 subunit 27 [Source:HGNC Symbol;Acc:HGNC:30240])

HSP 1 Score: 88.9669 bits (219), Expect = 3.468e-22
Identity = 40/65 (61.54%), Postives = 55/65 (84.62%), Query Frame = 1
Query:  319 LYEKSLEGKSPEEIEMLKIMGFGSFNTTKGKHVEGN-DIYVADIQKRRKYRQYMNRRGGFNRPLD 510
            + E+ LEGK+ EEIEM+K+MGF SF++TKGK V+G+ + Y  ++ ++RKYRQYMNR+GGFNRPLD
Sbjct:   88 ITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNRPLD 152          
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. Ensembl Human
Match: SNRNP27 (small nuclear ribonucleoprotein U4/U6.U5 subunit 27 [Source:HGNC Symbol;Acc:HGNC:30240])

HSP 1 Score: 88.9669 bits (219), Expect = 3.468e-22
Identity = 40/65 (61.54%), Postives = 55/65 (84.62%), Query Frame = 1
Query:  319 LYEKSLEGKSPEEIEMLKIMGFGSFNTTKGKHVEGN-DIYVADIQKRRKYRQYMNRRGGFNRPLD 510
            + E+ LEGK+ EEIEM+K+MGF SF++TKGK V+G+ + Y  ++ ++RKYRQYMNR+GGFNRPLD
Sbjct:   88 ITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNRPLD 152          
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. Ensembl Celegans
Match: snrp-27 (Small Nuclear RibonucleoProtein homolog [Source:UniProtKB/TrEMBL;Acc:Q21739])

HSP 1 Score: 66.2402 bits (160), Expect = 5.261e-14
Identity = 33/60 (55.00%), Postives = 42/60 (70.00%), Query Frame = 1
Query:  331 SLEGKSPEEIEMLKIMGFGSFNTTKGKHVEGNDIYVADIQKRRKYRQYMNRRGGFNRPLD 510
            SL+  + +E  M+  MGFG F+TTK K V  N     +I+K R+YRQYMNR+GGFNRPLD
Sbjct:   94 SLQSGADDEA-MMAAMGFGGFDTTKNKQVNDNVDGCVNIKKPRRYRQYMNRKGGFNRPLD 152          
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. Ensembl Fly
Match: ytr (gene:FBgn0021895 transcript:FBtr0072234)

HSP 1 Score: 92.8189 bits (229), Expect = 1.309e-23
Identity = 43/66 (65.15%), Postives = 52/66 (78.79%), Query Frame = 1
Query:  319 LYEKSLEGKSPEEIEMLKIMGFGSFNTTKGKHVEGNDIYVADIQKRRKYRQYMNRRGGFNRPLDRV 516
            + E  LEGKSPEE+EMLK MGF +F+TTK + VEGND+    +  +RKYRQYMNR+GGFNRPLD V
Sbjct:  128 INEADLEGKSPEEVEMLKTMGFCTFDTTKNRKVEGNDVGEVHVILKRKYRQYMNRKGGFNRPLDFV 193          
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. Ensembl Fly
Match: ytr (gene:FBgn0021895 transcript:FBtr0343278)

HSP 1 Score: 92.8189 bits (229), Expect = 1.309e-23
Identity = 43/66 (65.15%), Postives = 52/66 (78.79%), Query Frame = 1
Query:  319 LYEKSLEGKSPEEIEMLKIMGFGSFNTTKGKHVEGNDIYVADIQKRRKYRQYMNRRGGFNRPLDRV 516
            + E  LEGKSPEE+EMLK MGF +F+TTK + VEGND+    +  +RKYRQYMNR+GGFNRPLD V
Sbjct:  128 INEADLEGKSPEEVEMLKTMGFCTFDTTKNRKVEGNDVGEVHVILKRKYRQYMNRKGGFNRPLDFV 193          
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. Ensembl Zebrafish
Match: snrnp27 (small nuclear ribonucleoprotein 27 (U4/U6.U5) [Source:NCBI gene;Acc:436976])

HSP 1 Score: 82.4185 bits (202), Expect = 8.879e-20
Identity = 36/62 (58.06%), Postives = 51/62 (82.26%), Query Frame = 1
Query:  334 LEGKSPEEIEMLKIMGFGSFNTTKGKHVEGN-DIYVADIQKRRKYRQYMNRRGGFNRPLDRV 516
            ++GK+ EEIEM+K+MGFGSF T+KGK  +G+   +  ++ ++RKYRQYMNR+GGFNRPLD +
Sbjct:   96 MQGKTEEEIEMMKLMGFGSFETSKGKKKDGSIKAFAVNVSQKRKYRQYMNRKGGFNRPLDFI 157          
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. Ensembl Xenopus
Match: ptcd1 (pentatricopeptide repeat domain 1 [Source:Xenbase;Acc:XB-GENE-940576])

HSP 1 Score: 68.1662 bits (165), Expect = 2.354e-14
Identity = 38/65 (58.46%), Postives = 54/65 (83.08%), Query Frame = 1
Query:  319 LYEKSLEGKSPEEIEMLKIMGFGSFNTTKGKHVEGN-DIYVADIQKRRKYRQYMNRRGGFNRPLD 510
            +  + LEGK+ EEIEM+K+MGF +F+T+KGK V+G+ + Y  ++ ++RKYRQYMNR+GGFNRPLD
Sbjct:   80 IAAEDLEGKTEEEIEMMKMMGFATFDTSKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNRPLD 144          
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. Ensembl Xenopus
Match: ptcd1 (pentatricopeptide repeat domain 1 [Source:Xenbase;Acc:XB-GENE-940576])

HSP 1 Score: 67.3958 bits (163), Expect = 4.869e-14
Identity = 38/67 (56.72%), Postives = 55/67 (82.09%), Query Frame = 1
Query:  319 LYEKSLEGKSPEEIEMLKIMGFGSFNTTKGKHVEGN-DIYVADIQKRRKYRQYMNRRGGFNRPLDRV 516
            +  + LEGK+ EEIEM+K+MGF +F+T+KGK V+G+ + Y  ++ ++RKYRQYMNR+GGFNRPLD +
Sbjct:   89 IAAEDLEGKTEEEIEMMKMMGFATFDTSKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNRPLDFI 155          
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. Ensembl Mouse
Match: Snrnp27 (small nuclear ribonucleoprotein 27 (U4/U6.U5) [Source:MGI Symbol;Acc:MGI:1913868])

HSP 1 Score: 88.9669 bits (219), Expect = 2.381e-22
Identity = 40/65 (61.54%), Postives = 55/65 (84.62%), Query Frame = 1
Query:  319 LYEKSLEGKSPEEIEMLKIMGFGSFNTTKGKHVEGN-DIYVADIQKRRKYRQYMNRRGGFNRPLD 510
            + E+ LEGK+ EEIEM+K+MGF SF++TKGK V+G+ + Y  ++ ++RKYRQYMNR+GGFNRPLD
Sbjct:   88 ITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNRPLD 152          
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. Ensembl Mouse
Match: Snrnp27 (small nuclear ribonucleoprotein 27 (U4/U6.U5) [Source:MGI Symbol;Acc:MGI:1913868])

HSP 1 Score: 59.6918 bits (143), Expect = 6.019e-11
Identity = 27/51 (52.94%), Postives = 41/51 (80.39%), Query Frame = 1
Query:  319 LYEKSLEGKSPEEIEMLKIMGFGSFNTTKGKHVEGN-DIYVADIQKRRKYR 468
            + E+ LEGK+ EEIEM+K+MGF SF++TKGK V+G+ + Y  ++ ++RKYR
Sbjct:   88 ITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYR 138          
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. UniProt/SwissProt
Match: sp|Q8K194|SNR27_MOUSE (U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein OS=Mus musculus OX=10090 GN=Snrnp27 PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.665e-21
Identity = 40/65 (61.54%), Postives = 55/65 (84.62%), Query Frame = 1
Query:  319 LYEKSLEGKSPEEIEMLKIMGFGSFNTTKGKHVEGN-DIYVADIQKRRKYRQYMNRRGGFNRPLD 510
            + E+ LEGK+ EEIEM+K+MGF SF++TKGK V+G+ + Y  ++ ++RKYRQYMNR+GGFNRPLD
Sbjct:   88 ITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNRPLD 152          
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. UniProt/SwissProt
Match: sp|Q8WVK2|SNR27_HUMAN (U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein OS=Homo sapiens OX=9606 GN=SNRNP27 PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.665e-21
Identity = 40/65 (61.54%), Postives = 55/65 (84.62%), Query Frame = 1
Query:  319 LYEKSLEGKSPEEIEMLKIMGFGSFNTTKGKHVEGN-DIYVADIQKRRKYRQYMNRRGGFNRPLD 510
            + E+ LEGK+ EEIEM+K+MGF SF++TKGK V+G+ + Y  ++ ++RKYRQYMNR+GGFNRPLD
Sbjct:   88 ITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNRPLD 152          
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. UniProt/SwissProt
Match: sp|Q6GLZ8|SNR27_XENLA (U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein OS=Xenopus laevis OX=8355 GN=snrnp27 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.884e-20
Identity = 39/67 (58.21%), Postives = 54/67 (80.60%), Query Frame = 1
Query:  319 LYEKSLEGKSPEEIEMLKIMGFGSFNTTKGKHVEGN-DIYVADIQKRRKYRQYMNRRGGFNRPLDRV 516
            L  + LEGK+ EEIEM+K+MGF SF+++KGK  +G+ + Y  ++ ++RKYRQYMNR+GGFNRPLD V
Sbjct:   91 LAAEDLEGKTEEEIEMMKLMGFASFDSSKGKKTDGSVNAYAINVSQKRKYRQYMNRKGGFNRPLDFV 157          
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. UniProt/SwissProt
Match: sp|Q6DH74|SNR27_DANRE (U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein OS=Danio rerio OX=7955 GN=snrnp27 PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 6.703e-19
Identity = 36/62 (58.06%), Postives = 51/62 (82.26%), Query Frame = 1
Query:  334 LEGKSPEEIEMLKIMGFGSFNTTKGKHVEGN-DIYVADIQKRRKYRQYMNRRGGFNRPLDRV 516
            ++GK+ EEIEM+K+MGFGSF T+KGK  +G+   +  ++ ++RKYRQYMNR+GGFNRPLD +
Sbjct:   96 MQGKTEEEIEMMKLMGFGSFETSKGKKKDGSIKAFAVNVSQKRKYRQYMNRKGGFNRPLDFI 157          
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. UniProt/SwissProt
Match: sp|Q6DDA4|SNR27_XENTR (U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein OS=Xenopus tropicalis OX=8364 GN=snrnp27 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 2.580e-13
Identity = 38/67 (56.72%), Postives = 55/67 (82.09%), Query Frame = 1
Query:  319 LYEKSLEGKSPEEIEMLKIMGFGSFNTTKGKHVEGN-DIYVADIQKRRKYRQYMNRRGGFNRPLDRV 516
            +  + LEGK+ EEIEM+K+MGF +F+T+KGK V+G+ + Y  ++ ++RKYRQYMNR+GGFNRPLD +
Sbjct:   89 IAAEDLEGKTEEEIEMMKMMGFATFDTSKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNRPLDFI 155          
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. TrEMBL
Match: A0A090XEJ7 (Putative nucleic acid binding protein OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 7.533e-22
Identity = 43/66 (65.15%), Postives = 54/66 (81.82%), Query Frame = 1
Query:  319 LYEKSLEGKSPEEIEMLKIMGFGSFNTTKGKHVEGNDIYVADIQKRRKYRQYMNRRGGFNRPLDRV 516
            +  K LEGKS EE EM+KIMGFGSF+++KGKH+ GN++Y   +  +RKYRQYMNR+GGFNRPLD V
Sbjct:  125 ITAKDLEGKSEEEKEMMKIMGFGSFDSSKGKHIPGNNVYAVHVIHKRKYRQYMNRKGGFNRPLDYV 190          
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. TrEMBL
Match: U5EY20 (Putative yantar OS=Corethrella appendiculata OX=1370023 PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 9.533e-22
Identity = 45/66 (68.18%), Postives = 53/66 (80.30%), Query Frame = 1
Query:  319 LYEKSLEGKSPEEIEMLKIMGFGSFNTTKGKHVEGNDIYVADIQKRRKYRQYMNRRGGFNRPLDRV 516
            L E  LEGKSPEEIEM+K+MGF  FNTTKGK V+GN++    +  +RKYRQYMNR+GGFNRPLD V
Sbjct:   85 LSEADLEGKSPEEIEMMKVMGFCDFNTTKGKKVDGNNVGQVHVILKRKYRQYMNRKGGFNRPLDFV 150          
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. TrEMBL
Match: A0A4Y2KRJ4 (SNRNP27 domain-containing protein OS=Araneus ventricosus OX=182803 GN=AVEN_120879_1 PE=4 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.458e-21
Identity = 44/66 (66.67%), Postives = 53/66 (80.30%), Query Frame = 1
Query:  319 LYEKSLEGKSPEEIEMLKIMGFGSFNTTKGKHVEGNDIYVADIQKRRKYRQYMNRRGGFNRPLDRV 516
            + +K LEGK+ EEIEM+K MGFG+F+TTKGKHV GN  Y   +  +RKYRQYMNR+GGFNRPLD V
Sbjct:   58 ITDKDLEGKTEEEIEMMKTMGFGNFDTTKGKHVPGNVAYGVHVIHKRKYRQYMNRKGGFNRPLDFV 123          
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. TrEMBL
Match: A0A0K8R8R4 (Putative u4/u6.u5 tri-snrnp-associated protein OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.546e-21
Identity = 43/66 (65.15%), Postives = 54/66 (81.82%), Query Frame = 1
Query:  319 LYEKSLEGKSPEEIEMLKIMGFGSFNTTKGKHVEGNDIYVADIQKRRKYRQYMNRRGGFNRPLDRV 516
            +  K LEGKS EE EM+KIMGFGSF+++KGKH+ GN++Y   +  +RKYRQYMNR+GGFNRPLD V
Sbjct:  122 ITAKDLEGKSEEEKEMMKIMGFGSFDSSKGKHIPGNNVYAVHVIHKRKYRQYMNRKGGFNRPLDYV 187          
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. TrEMBL
Match: A0A443QV01 (U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein (Fragment) OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_08356 PE=4 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.663e-21
Identity = 42/66 (63.64%), Postives = 54/66 (81.82%), Query Frame = 1
Query:  319 LYEKSLEGKSPEEIEMLKIMGFGSFNTTKGKHVEGNDIYVADIQKRRKYRQYMNRRGGFNRPLDRV 516
            + +K LEGKS EE +M+K+MGF +F+TTKGKHV GND++   +  +RKYRQYMNR+GGFNRPLD V
Sbjct:  130 ITDKDLEGKSEEEQQMMKMMGFATFDTTKGKHVPGNDVHAVHVIHKRKYRQYMNRKGGFNRPLDFV 195          
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. Ensembl Cavefish
Match: snrnp27 (small nuclear ribonucleoprotein U4/U6.U5 subunit 27 [Source:NCBI gene;Acc:103032569])

HSP 1 Score: 87.4261 bits (215), Expect = 8.122e-22
Identity = 38/65 (58.46%), Postives = 55/65 (84.62%), Query Frame = 1
Query:  319 LYEKSLEGKSPEEIEMLKIMGFGSFNTTKGKHVEGN-DIYVADIQKRRKYRQYMNRRGGFNRPLD 510
            +  + ++GK+ EEIEM+K+MGFGSFNTTKG+ V+G+ + +  ++ ++RKYRQYMNR+GGFNRPLD
Sbjct:   89 ISAEDMQGKTEEEIEMMKLMGFGSFNTTKGRKVDGSVNAHAINVTQKRKYRQYMNRKGGFNRPLD 153          
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. Ensembl Cavefish
Match: snrnp27 (small nuclear ribonucleoprotein U4/U6.U5 subunit 27 [Source:NCBI gene;Acc:103032569])

HSP 1 Score: 58.151 bits (139), Expect = 1.041e-10
Identity = 25/46 (54.35%), Postives = 39/46 (84.78%), Query Frame = 1
Query:  334 LEGKSPEEIEMLKIMGFGSFNTTKGKHVEGN-DIYVADIQKRRKYR 468
            ++GK+ EEIEM+K+MGFGSFNTTKG+ V+G+ + +  ++ ++RKYR
Sbjct:   98 MQGKTEEEIEMMKLMGFGSFNTTKGRKVDGSVNAHAINVTQKRKYR 143          
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. Ensembl Nematostella
Match: EDO49298 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH61])

HSP 1 Score: 75.8702 bits (185), Expect = 4.947e-18
Identity = 36/62 (58.06%), Postives = 48/62 (77.42%), Query Frame = 1
Query:  334 LEGKSPEEIEMLKIMGFGSFNTTKGKHVEGN-DIYVADIQKRRKYRQYMNRRGGFNRPLDRV 516
            L+    EE  M+K+MGF +F++TKGKHVEG+ ++    ++K RKYRQYMNR+GGFNRPLD V
Sbjct:   81 LDDTEQEEDAMMKMMGFSNFDSTKGKHVEGSCNLSGISVKKARKYRQYMNRKGGFNRPLDYV 142          
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. Ensembl Medaka
Match: snrnp27 (small nuclear ribonucleoprotein U4/U6.U5 subunit 27 [Source:NCBI gene;Acc:101157373])

HSP 1 Score: 81.2629 bits (199), Expect = 2.073e-19
Identity = 35/60 (58.33%), Postives = 50/60 (83.33%), Query Frame = 1
Query:  334 LEGKSPEEIEMLKIMGFGSFNTTKGKHVEGN-DIYVADIQKRRKYRQYMNRRGGFNRPLD 510
            ++GK+ EEIEM+K+MGF +F++TKGK  +G+ + +  +I  +RKYRQYMNR+GGFNRPLD
Sbjct:  100 MQGKTEEEIEMMKLMGFSTFDSTKGKKTDGSVNAHAVNITLKRKYRQYMNRKGGFNRPLD 159          
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. Planmine SMEST
Match: SMESG000029048.1 (SMESG000029048.1)

HSP 1 Score: 151.369 bits (381), Expect = 5.456e-47
Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 1
Query:  220 LPDGRLKNYVXXXXXXXXXXXXXXXXXXXXXXXLYEKSLEGKSPEEIEMLKIMGFGSFNTTKGKHVEGNDIYVADIQKRRKYRQYMNRRGGFNRPLDRVD 519
            LPDGRLKNYVRRSSSSSSSREKEEKIANEKKNELYEKSLEGKSPEEIEMLKIMGFGSFNTTKGKHVEGNDIYVADIQKRRKYRQYMNRRGGFNRPLDRVD
Sbjct:   57 LPDGRLKNYVRRSSSSSSSREKEEKIANEKKNELYEKSLEGKSPEEIEMLKIMGFGSFNTTKGKHVEGNDIYVADIQKRRKYRQYMNRRGGFNRPLDRVD 156          
The following BLAST results are available for this feature:
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SNRNP273.468e-2261.54small nuclear ribonucleoprotein U4/U6.U5 subunit 2... [more]
SNRNP273.468e-2261.54small nuclear ribonucleoprotein U4/U6.U5 subunit 2... [more]
back to top
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
snrp-275.261e-1455.00Small Nuclear RibonucleoProtein homolog [Source:U... [more]
back to top
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ytr1.309e-2365.15gene:FBgn0021895 transcript:FBtr0072234[more]
ytr1.309e-2365.15gene:FBgn0021895 transcript:FBtr0343278[more]
back to top
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
snrnp278.879e-2058.06small nuclear ribonucleoprotein 27 (U4/U6.U5) [Sou... [more]
back to top
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ptcd12.354e-1458.46pentatricopeptide repeat domain 1 [Source:Xenbase;... [more]
ptcd14.869e-1456.72pentatricopeptide repeat domain 1 [Source:Xenbase;... [more]
back to top
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Snrnp272.381e-2261.54small nuclear ribonucleoprotein 27 (U4/U6.U5) [Sou... [more]
Snrnp276.019e-1152.94small nuclear ribonucleoprotein 27 (U4/U6.U5) [Sou... [more]
back to top
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8K194|SNR27_MOUSE1.665e-2161.54U4/U6.U5 small nuclear ribonucleoprotein 27 kDa pr... [more]
sp|Q8WVK2|SNR27_HUMAN1.665e-2161.54U4/U6.U5 small nuclear ribonucleoprotein 27 kDa pr... [more]
sp|Q6GLZ8|SNR27_XENLA1.884e-2058.21U4/U6.U5 small nuclear ribonucleoprotein 27 kDa pr... [more]
sp|Q6DH74|SNR27_DANRE6.703e-1958.06U4/U6.U5 small nuclear ribonucleoprotein 27 kDa pr... [more]
sp|Q6DDA4|SNR27_XENTR2.580e-1356.72U4/U6.U5 small nuclear ribonucleoprotein 27 kDa pr... [more]
back to top
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A090XEJ77.533e-2265.15Putative nucleic acid binding protein OS=Ixodes ri... [more]
U5EY209.533e-2268.18Putative yantar OS=Corethrella appendiculata OX=13... [more]
A0A4Y2KRJ41.458e-2166.67SNRNP27 domain-containing protein OS=Araneus ventr... [more]
A0A0K8R8R41.546e-2165.15Putative u4/u6.u5 tri-snrnp-associated protein OS=... [more]
A0A443QV011.663e-2163.64U4/U6.U5 small nuclear ribonucleoprotein 27 kDa pr... [more]
back to top
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
snrnp278.122e-2258.46small nuclear ribonucleoprotein U4/U6.U5 subunit 2... [more]
snrnp271.041e-1054.35small nuclear ribonucleoprotein U4/U6.U5 subunit 2... [more]
back to top
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO492984.947e-1858.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
snrnp272.073e-1958.33small nuclear ribonucleoprotein U4/U6.U5 subunit 2... [more]
back to top
BLAST of U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000029048.15.456e-47100.00SMESG000029048.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020180 ID=SMED30020180|Name=U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=557bp
CAATAATTGTTTAAATAATATCAATGTATGTGATTTTAAATTTATTATTT
TATGGGTAGAGATAGATCTAGAAGTGCTAAACGTAGACATTCTCGATCCA
GATCAAGAGATCGGCAAAGGGACAAAAAGCGAGATAGAGATCGTGATAGA
GATAAGCGAAAAGATAGACACAGAAGTAAATCAGCTTCTAGAAGTAGAAG
GAGACGCTCACGTGAGCGCTTACCAGATGGGCGTCTAAAAAATTATGTTC
GACGTTCCTCCTCAAGTTCTTCATCTAGAGAAAAAGAAGAAAAAATAGCG
AATGAAAAAAAGAATGAATTATATGAGAAATCTTTGGAAGGGAAATCTCC
TGAAGAAATAGAAATGTTAAAAATAATGGGATTTGGTTCATTTAATACTA
CAAAAGGCAAGCATGTTGAAGGTAACGATATTTATGTTGCAGATATTCAA
AAGCGTCGGAAATATCGTCAATATATGAATAGAAGAGGAGGTTTCAACCG
GCCACTCGACAGAGTGGATTGAATTGTACATAATAAATATAAAAAGTTGA
GATCGGA
back to top

protein sequence of SMED30020180-orf-1

>SMED30020180-orf-1 ID=SMED30020180-orf-1|Name=SMED30020180-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=157bp
MGRDRSRSAKRRHSRSRSRDRQRDKKRDRDRDRDKRKDRHRSKSASRSRR
RRSRERLPDGRLKNYVRRSSSSSSSREKEEKIANEKKNELYEKSLEGKSP
EEIEMLKIMGFGSFNTTKGKHVEGNDIYVADIQKRRKYRQYMNRRGGFNR
PLDRVD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0008380RNA splicing
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR013957SNRNP27
Vocabulary: cellular component
TermDefinition
GO:0019013viral nucleocapsid
GO:0030529intracellular ribonucleoprotein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013957U4/U6.U5 small nuclear ribonucleoprotein 27kDa proteinPFAMPF08648SNRNP27coord: 101..154
e-value: 6.7E-29
score: 99.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 72..95
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 21..39
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..20
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..95
NoneNo IPR availablePANTHERPTHR31077FAMILY NOT NAMEDcoord: 2..154