c-Jun N-terminal kinases

Overview
Namec-Jun N-terminal kinases (AIP89944.1)
Smed IDSMED30020168
Length (bp)1748
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of c-Jun N-terminal kinases (SMED30020168) t-SNE clustered cells

Violin plots show distribution of expression levels for c-Jun N-terminal kinases (SMED30020168) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of c-Jun N-terminal kinases (SMED30020168) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for c-Jun N-terminal kinases (SMED30020168) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020168

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30020168SMESG000043618.1 Contig6470newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30020168SMESG000043618.1 Contig6470uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
cephalic gangliaSMED30020168SMESG000043618.1 JNKsmed_ncbi_20200123PMID:24922054
Almuedo-Castillo et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30020168SMESG000043618.1 JNKsmed_ncbi_20200123PMID:24922054
Almuedo-Castillo et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
pharynxSMED30020168SMESG000043618.1 dd_Smed_v4_5924_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30020168SMESG000043618.1 dd_Smed_v4_5924_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020168SMESG000043618.1 dd_Smed_v4_5924_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30020168SMESG000043618.1 SMED30034763smed_20140614PMID:27441386
Arnold et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30020168SMESG000043618.1 SMED30034763smed_20140614PMID:27441386
Arnold et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30020168SMESG000043618.1 SMED30034763smed_20140614PMID:27441386
Arnold et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of c-Jun N-terminal kinases vs. Ensembl Human
Match: MAPK10 (mitogen-activated protein kinase 10 [Source:HGNC Symbol;Acc:HGNC:6872])

HSP 1 Score: 536.954 bits (1382), Expect = 0.000e+0
Identity = 253/386 (65.54%), Postives = 305/386 (79.02%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPENM*FRCEHQFSPVSYVQ 1247
            M++   + +F++  +GDS FT+L RY NL+ IGSGAQG V AA D+V  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNII LLN FTPQ+T+  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG SF+MTPYVVTRYYRAPEVILGMGY ENVD+WSVGCI  EM+   ++FPGTDHIDQW K+ + LGTP  EF+ +LQP+VRNYV++RP+  G +F  LFPD  FP  S EH  L A  ARDLL KMLVIDP +RISV +AL+H YINVW++  EV  PPP  YD  +DERE T+++WK+LI+++V   E + +N     + Q SP + VQ
Sbjct:    1 MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDMWSVGCIMGEMIKGAVLFPGTDHIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADS-EHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKN--GVVKGQPSPSAQVQ 383          
BLAST of c-Jun N-terminal kinases vs. Ensembl Human
Match: MAPK10 (mitogen-activated protein kinase 10 [Source:HGNC Symbol;Acc:HGNC:6872])

HSP 1 Score: 536.954 bits (1382), Expect = 0.000e+0
Identity = 253/386 (65.54%), Postives = 305/386 (79.02%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPENM*FRCEHQFSPVSYVQ 1247
            M++   + +F++  +GDS FT+L RY NL+ IGSGAQG V AA D+V  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNII LLN FTPQ+T+  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG SF+MTPYVVTRYYRAPEVILGMGY ENVD+WSVGCI  EM+   ++FPGTDHIDQW K+ + LGTP  EF+ +LQP+VRNYV++RP+  G +F  LFPD  FP  S EH  L A  ARDLL KMLVIDP +RISV +AL+H YINVW++  EV  PPP  YD  +DERE T+++WK+LI+++V   E + +N     + Q SP + VQ
Sbjct:    1 MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDMWSVGCIMGEMIKGAVLFPGTDHIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADS-EHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKN--GVVKGQPSPSAQVQ 383          
BLAST of c-Jun N-terminal kinases vs. Ensembl Human
Match: MAPK10 (mitogen-activated protein kinase 10 [Source:HGNC Symbol;Acc:HGNC:6872])

HSP 1 Score: 536.569 bits (1381), Expect = 0.000e+0
Identity = 248/370 (67.03%), Postives = 298/370 (80.54%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            M++   + +F++  +GDS FT+L RY NL+ IGSGAQG V AA D+V  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNII LLN FTPQ+T+  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG SF+MTPYVVTRYYRAPEVILGMGY ENVD+WSVGCI  EM+   ++FPGTDHIDQW K+ + LGTP  EF+ +LQP+VRNYV++RP+  G +F  LFPD  FP  S EH  L A  ARDLL KMLVIDP +RISV +AL+H YINVW++  EV  PPP  YD  +DERE T+++WK+LI+++V   E + +N
Sbjct:    1 MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDMWSVGCIMGEMIKGAVLFPGTDHIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADS-EHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKN 369          
BLAST of c-Jun N-terminal kinases vs. Ensembl Human
Match: MAPK10 (mitogen-activated protein kinase 10 [Source:HGNC Symbol;Acc:HGNC:6872])

HSP 1 Score: 536.569 bits (1381), Expect = 0.000e+0
Identity = 248/370 (67.03%), Postives = 298/370 (80.54%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            M++   + +F++  +GDS FT+L RY NL+ IGSGAQG V AA D+V  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNII LLN FTPQ+T+  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG SF+MTPYVVTRYYRAPEVILGMGY ENVD+WSVGCI  EM+   ++FPGTDHIDQW K+ + LGTP  EF+ +LQP+VRNYV++RP+  G +F  LFPD  FP  S EH  L A  ARDLL KMLVIDP +RISV +AL+H YINVW++  EV  PPP  YD  +DERE T+++WK+LI+++V   E + +N
Sbjct:    1 MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDMWSVGCIMGEMIKGAVLFPGTDHIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADS-EHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKN 369          
BLAST of c-Jun N-terminal kinases vs. Ensembl Human
Match: MAPK10 (mitogen-activated protein kinase 10 [Source:HGNC Symbol;Acc:HGNC:6872])

HSP 1 Score: 536.184 bits (1380), Expect = 0.000e+0
Identity = 248/370 (67.03%), Postives = 298/370 (80.54%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            M++   + +F++  +GDS FT+L RY NL+ IGSGAQG V AA D+V  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNII LLN FTPQ+T+  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG SF+MTPYVVTRYYRAPEVILGMGY ENVD+WSVGCI  EM+   ++FPGTDHIDQW K+ + LGTP  EF+ +LQP+VRNYV++RP+  G +F  LFPD  FP  S EH  L A  ARDLL KMLVIDP +RISV +AL+H YINVW++  EV  PPP  YD  +DERE T+++WK+LI+++V   E + +N
Sbjct:   39 MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDMWSVGCIMGEMIKGAVLFPGTDHIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADS-EHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKN 407          
BLAST of c-Jun N-terminal kinases vs. Ensembl Celegans
Match: jnk-1 (Stress-activated protein kinase jnk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8WQG9])

HSP 1 Score: 504.982 bits (1299), Expect = 6.697e-177
Identity = 235/357 (65.83%), Postives = 289/357 (80.95%), Query Frame = 3
Query:  111 ERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEY 1181
            E +++  IG+++  +L RY NLR IGSGAQG V +A D+V  +QVAIKKL+RPFQNVTHAKRAYRE  LM LVNHKNIIG+LN FTPQ+ ++ F DLY+VMELMDANLCQVI MDLDHER SYLLYQ+LCG++HLH+AGIIHRDLKPSNIVV+ DCTLKILDFGLAR+A ++F+MTPYVVTRYYRAPEVILGMGY ENVD+WS+GCIF E++  R++FPG DHIDQWT+I + LGTP   FL RLQP+VRNYV++RPR     F+ LF D+ FP  + + + L    ARDLL +MLVIDP +RISV +ALRH Y+NVWF++ EV  PPP  YDH++D  E  VD W++ IFR++ +Y
Sbjct:   10 ENYYSVTIGEAQMVVLKRYQNLRLIGSGAQGIVCSAFDTVRNEQVAIKKLSRPFQNVTHAKRAYRELKLMSLVNHKNIIGILNCFTPQKKLDEFNDLYIVMELMDANLCQVIQMDLDHERLSYLLYQMLCGIRHLHSAGIIHRDLKPSNIVVRSDCTLKILDFGLARTAIEAFMMTPYVVTRYYRAPEVILGMGYKENVDVWSIGCIFGELIRGRVLFPGGDHIDQWTRIIEQLGTPDRSFLERLQPTVRNYVENRPRYQATPFEVLFSDNMFPM-TADSSRLTGAQARDLLSRMLVIDPERRISVDDALRHPYVNVWFDEIEVYAPPPLPYDHNMDV-EQNVDSWREHIFRELTDY 364          
BLAST of c-Jun N-terminal kinases vs. Ensembl Celegans
Match: jnk-1 (Stress-activated protein kinase jnk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8WQG9])

HSP 1 Score: 504.982 bits (1299), Expect = 6.697e-177
Identity = 235/357 (65.83%), Postives = 289/357 (80.95%), Query Frame = 3
Query:  111 ERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEY 1181
            E +++  IG+++  +L RY NLR IGSGAQG V +A D+V  +QVAIKKL+RPFQNVTHAKRAYRE  LM LVNHKNIIG+LN FTPQ+ ++ F DLY+VMELMDANLCQVI MDLDHER SYLLYQ+LCG++HLH+AGIIHRDLKPSNIVV+ DCTLKILDFGLAR+A ++F+MTPYVVTRYYRAPEVILGMGY ENVD+WS+GCIF E++  R++FPG DHIDQWT+I + LGTP   FL RLQP+VRNYV++RPR     F+ LF D+ FP  + + + L    ARDLL +MLVIDP +RISV +ALRH Y+NVWF++ EV  PPP  YDH++D  E  VD W++ IFR++ +Y
Sbjct:   10 ENYYSVTIGEAQMVVLKRYQNLRLIGSGAQGIVCSAFDTVRNEQVAIKKLSRPFQNVTHAKRAYRELKLMSLVNHKNIIGILNCFTPQKKLDEFNDLYIVMELMDANLCQVIQMDLDHERLSYLLYQMLCGIRHLHSAGIIHRDLKPSNIVVRSDCTLKILDFGLARTAIEAFMMTPYVVTRYYRAPEVILGMGYKENVDVWSIGCIFGELIRGRVLFPGGDHIDQWTRIIEQLGTPDRSFLERLQPTVRNYVENRPRYQATPFEVLFSDNMFPM-TADSSRLTGAQARDLLSRMLVIDPERRISVDDALRHPYVNVWFDEIEVYAPPPLPYDHNMDV-EQNVDSWREHIFRELTDY 364          
BLAST of c-Jun N-terminal kinases vs. Ensembl Celegans
Match: jnk-1 (Stress-activated protein kinase jnk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8WQG9])

HSP 1 Score: 504.982 bits (1299), Expect = 1.829e-175
Identity = 235/357 (65.83%), Postives = 289/357 (80.95%), Query Frame = 3
Query:  111 ERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEY 1181
            E +++  IG+++  +L RY NLR IGSGAQG V +A D+V  +QVAIKKL+RPFQNVTHAKRAYRE  LM LVNHKNIIG+LN FTPQ+ ++ F DLY+VMELMDANLCQVI MDLDHER SYLLYQ+LCG++HLH+AGIIHRDLKPSNIVV+ DCTLKILDFGLAR+A ++F+MTPYVVTRYYRAPEVILGMGY ENVD+WS+GCIF E++  R++FPG DHIDQWT+I + LGTP   FL RLQP+VRNYV++RPR     F+ LF D+ FP  + + + L    ARDLL +MLVIDP +RISV +ALRH Y+NVWF++ EV  PPP  YDH++D  E  VD W++ IFR++ +Y
Sbjct:  101 ENYYSVTIGEAQMVVLKRYQNLRLIGSGAQGIVCSAFDTVRNEQVAIKKLSRPFQNVTHAKRAYRELKLMSLVNHKNIIGILNCFTPQKKLDEFNDLYIVMELMDANLCQVIQMDLDHERLSYLLYQMLCGIRHLHSAGIIHRDLKPSNIVVRSDCTLKILDFGLARTAIEAFMMTPYVVTRYYRAPEVILGMGYKENVDVWSIGCIFGELIRGRVLFPGGDHIDQWTRIIEQLGTPDRSFLERLQPTVRNYVENRPRYQATPFEVLFSDNMFPM-TADSSRLTGAQARDLLSRMLVIDPERRISVDDALRHPYVNVWFDEIEVYAPPPLPYDHNMDV-EQNVDSWREHIFRELTDY 455          
BLAST of c-Jun N-terminal kinases vs. Ensembl Celegans
Match: kgb-1 (GLH-binding kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:O44408])

HSP 1 Score: 383.259 bits (983), Expect = 8.350e-129
Identity = 197/369 (53.39%), Postives = 252/369 (68.29%), Query Frame = 3
Query:  114 RFHTEVI------GDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVIN-MDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLAR--SAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCF-PEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPP-GQYDHSVDERELTVDQWKDLIFRKVKEYES 1187
            RFH   I       DS FTI  RY NL  + +GAQG VV A D VT Q+VAIKK+ +PF     AKRAYREFIL+  + H NII LLNAFTP  +++ F+++YLVMELM  NL +VI+ + LDH+  S+ +YQ LC +KHLH +G+IHRDLKPSNIVV   C LK+LDFGLAR  +   S  M+ YVVTRYYRAPEVILG+ Y+E VDIWSVGCIFAEM+   ++FPG D IDQWTKI  +LGTP D F+S+L  S   YV+S PR   ++F ++ PD  F PE       L  + ARDLL  ML I+P +R SV +AL H Y+ +WF+D EVN P    +YD  +D  + T+ +WK+LIF +V+ Y++
Sbjct:   15 RFHQVTIRDPIAGADSTFTIPTRYVNLSFLNAGAQGTVVMADDLVTTQRVAIKKMQQPFVMTMSAKRAYREFILLTTIKHPNIIRLLNAFTPDTSLSTFREVYLVMELMTHNLHEVIHRLRLDHKTLSFFVYQSLCAIKHLHNSGVIHRDLKPSNIVVNDRCVLKVLDFGLARKKNVDTSMRMSDYVVTRYYRAPEVILGLPYSEKVDIWSVGCIFAEMINHTVLFPGKDRIDQWTKIYSVLGTPDDHFISQLGQSAAMYVRSLPRHQARAFSEIVPDTNFLPETENPRVHLTPHVARDLLFNMLKINPEERYSVEDALNHPYVKLWFKDDEVNAPASENRYDQEIDFADKTLIEWKELIFNEVQRYQA 383          
BLAST of c-Jun N-terminal kinases vs. Ensembl Celegans
Match: kgb-2 (Mitogen-activated protein kinase [Source:UniProtKB/TrEMBL;Acc:H2KZI0])

HSP 1 Score: 328.946 bits (842), Expect = 1.584e-108
Identity = 171/325 (52.62%), Postives = 217/325 (66.77%), Query Frame = 3
Query:  111 ERFHTEVIGDS------RFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVIN-MDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCF-PEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINV 1061
             +FH   I D        FTI  RY NL+ +  GAQG VV A D VT Q+VAIKK+ +PF     A+RAYREFIL+  + H NII LLNAFTP  ++++FQ++YLVME M  NL +VI+ + LDHE  S+L+YQ LC +KHLH  G IHRDLKPSNIVV   C LK+LDFGLAR       M+ YV TRYYRAPEVILG+ Y+E VDIWSVGCI AEM+   ++FPG D  DQWT+I+ +L TP D F+++L+P    YV+S P+   ++F+++ PD  F PE       L  + ARDLL  ML I+P +R SV +AL H Y  V
Sbjct:    5 SKFHQVTITDPIAGAGITFTIPTRYVNLKFLNVGAQGIVVMADDLVTTQRVAIKKMQQPFLLTMSARRAYREFILLTTLKHPNIIRLLNAFTPDTSLSSFQEVYLVMEFMTHNLHEVIHRLRLDHETLSFLVYQSLCAIKHLHNLGFIHRDLKPSNIVVNERCVLKVLDFGLARRRNVDMRMSDYVGTRYYRAPEVILGLNYSEKVDIWSVGCILAEMINHTVLFPGKDIRDQWTQISSVLRTPDDHFINQLEPIGAVYVRSLPQHLARAFNEIVPDSNFLPETENPKDHLTLHMARDLLFNMLKINPEERYSVEDALNHPYTMV 329          
BLAST of c-Jun N-terminal kinases vs. Ensembl Fly
Match: bsk (gene:FBgn0000229 transcript:FBtr0300982)

HSP 1 Score: 549.28 bits (1414), Expect = 0.000e+0
Identity = 260/360 (72.22%), Postives = 301/360 (83.61%), Query Frame = 3
Query:  120 HTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            +T  +GD+ FTI +RY NLR IGSGAQG V AA D++T Q VAIKKL+RPFQNVTHAKRAYREF LMKLVNHKNIIGLLNAFTPQ+ +  FQD+YLVMELMDANLCQVI MDLDH+R SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG +F+MTPYVVTRYYRAPEVILGMGYTENVDIWSVGCI  EM+   ++FPGTDHIDQW KI + LGTPS  F+ RLQP+VRNYV++RPR  G SFD LFPD  FP  + +++   A  AR+LL KMLVIDP QRISV EAL+H+YINVW++  EV+ P P  YDHSVDERE TV+QWK+LI+ +V +YE+   N
Sbjct:    9 YTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQMDLDHDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRLQPTVRNYVENRPRYTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKMLVIDPEQRISVDEALKHEYINVWYDAEEVDAPAPEPYDHSVDEREHTVEQWKELIYEEVMDYEAHNTN 368          
BLAST of c-Jun N-terminal kinases vs. Ensembl Fly
Match: bsk (gene:FBgn0000229 transcript:FBtr0302378)

HSP 1 Score: 549.28 bits (1414), Expect = 0.000e+0
Identity = 260/360 (72.22%), Postives = 301/360 (83.61%), Query Frame = 3
Query:  120 HTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            +T  +GD+ FTI +RY NLR IGSGAQG V AA D++T Q VAIKKL+RPFQNVTHAKRAYREF LMKLVNHKNIIGLLNAFTPQ+ +  FQD+YLVMELMDANLCQVI MDLDH+R SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG +F+MTPYVVTRYYRAPEVILGMGYTENVDIWSVGCI  EM+   ++FPGTDHIDQW KI + LGTPS  F+ RLQP+VRNYV++RPR  G SFD LFPD  FP  + +++   A  AR+LL KMLVIDP QRISV EAL+H+YINVW++  EV+ P P  YDHSVDERE TV+QWK+LI+ +V +YE+   N
Sbjct:    9 YTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQMDLDHDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRLQPTVRNYVENRPRYTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKMLVIDPEQRISVDEALKHEYINVWYDAEEVDAPAPEPYDHSVDEREHTVEQWKELIYEEVMDYEAHNTN 368          
BLAST of c-Jun N-terminal kinases vs. Ensembl Fly
Match: bsk (gene:FBgn0000229 transcript:FBtr0080087)

HSP 1 Score: 549.28 bits (1414), Expect = 0.000e+0
Identity = 260/360 (72.22%), Postives = 301/360 (83.61%), Query Frame = 3
Query:  120 HTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            +T  +GD+ FTI +RY NLR IGSGAQG V AA D++T Q VAIKKL+RPFQNVTHAKRAYREF LMKLVNHKNIIGLLNAFTPQ+ +  FQD+YLVMELMDANLCQVI MDLDH+R SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG +F+MTPYVVTRYYRAPEVILGMGYTENVDIWSVGCI  EM+   ++FPGTDHIDQW KI + LGTPS  F+ RLQP+VRNYV++RPR  G SFD LFPD  FP  + +++   A  AR+LL KMLVIDP QRISV EAL+H+YINVW++  EV+ P P  YDHSVDERE TV+QWK+LI+ +V +YE+   N
Sbjct:    9 YTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQMDLDHDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRLQPTVRNYVENRPRYTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKMLVIDPEQRISVDEALKHEYINVWYDAEEVDAPAPEPYDHSVDEREHTVEQWKELIYEEVMDYEAHNTN 368          
BLAST of c-Jun N-terminal kinases vs. Ensembl Fly
Match: p38a (gene:FBgn0015765 transcript:FBtr0084580)

HSP 1 Score: 318.931 bits (816), Expect = 5.298e-104
Identity = 171/370 (46.22%), Postives = 237/370 (64.05%), Query Frame = 3
Query:  102 SFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQ---TINNFQDLYLVMELMDANLCQVINMD-LDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILG-MGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQP-SVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQP 1193
            S  ++F+   I  + + I + Y +L+ +GSGA G V  A+   T   VAIKKLARPFQ+  HAKR YRE  L+K ++H+N+IGLL+ F P     ++ NFQ +YLV  LMDA+L  +I M  L  +   +L+YQ+L G+K++H+AG+IHRDLKPSNI V  DC L+ILDFGLAR   +   MT YV TR+YRAPE++L  M Y + VDIWSVGCI AE++  R +FPGTDHI Q   I ++LGTP  EFL ++   S R+Y+QS P   G+SF ++F  +  P             A DLL+KML +D  +RI+  EAL H Y+  + E       PP  YDHS ++ +L VD+WK+LI+++V  ++  P
Sbjct:    4 SITKKFYKLDINRTEWEIPDIYQDLQPVGSGAYGQVSKAVVRGTNMHVAIKKLARPFQSAVHAKRTYRELRLLKHMDHENVIGLLDIFHPHPANGSLENFQQVYLVTHLMDADLNNIIRMQHLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPTENE--MTGYVATRWYRAPEIMLNWMHYDQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIMEMLGTPPAEFLKKISSESARSYIQSLPPMKGRSFKNVF-KNANP------------LAIDLLEKMLELDAEKRITAEEALSHPYLEKYAEPSVEQTSPP--YDHSFEDMDLPVDKWKELIYKEVTNFKPPP 356          
BLAST of c-Jun N-terminal kinases vs. Ensembl Fly
Match: p38a (gene:FBgn0015765 transcript:FBtr0300572)

HSP 1 Score: 318.931 bits (816), Expect = 5.298e-104
Identity = 171/370 (46.22%), Postives = 237/370 (64.05%), Query Frame = 3
Query:  102 SFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQ---TINNFQDLYLVMELMDANLCQVINMD-LDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILG-MGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQP-SVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQP 1193
            S  ++F+   I  + + I + Y +L+ +GSGA G V  A+   T   VAIKKLARPFQ+  HAKR YRE  L+K ++H+N+IGLL+ F P     ++ NFQ +YLV  LMDA+L  +I M  L  +   +L+YQ+L G+K++H+AG+IHRDLKPSNI V  DC L+ILDFGLAR   +   MT YV TR+YRAPE++L  M Y + VDIWSVGCI AE++  R +FPGTDHI Q   I ++LGTP  EFL ++   S R+Y+QS P   G+SF ++F  +  P             A DLL+KML +D  +RI+  EAL H Y+  + E       PP  YDHS ++ +L VD+WK+LI+++V  ++  P
Sbjct:    4 SITKKFYKLDINRTEWEIPDIYQDLQPVGSGAYGQVSKAVVRGTNMHVAIKKLARPFQSAVHAKRTYRELRLLKHMDHENVIGLLDIFHPHPANGSLENFQQVYLVTHLMDADLNNIIRMQHLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPTENE--MTGYVATRWYRAPEIMLNWMHYDQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIMEMLGTPPAEFLKKISSESARSYIQSLPPMKGRSFKNVF-KNANP------------LAIDLLEKMLELDAEKRITAEEALSHPYLEKYAEPSVEQTSPP--YDHSFEDMDLPVDKWKELIYKEVTNFKPPP 356          
BLAST of c-Jun N-terminal kinases vs. Ensembl Zebrafish
Match: mapk10 (mitogen-activated protein kinase 10 [Source:ZFIN;Acc:ZDB-GENE-051120-117])

HSP 1 Score: 535.413 bits (1378), Expect = 0.000e+0
Identity = 253/386 (65.54%), Postives = 306/386 (79.27%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPENM*FRCEHQFSPVSYVQ 1247
            M++   + +F++  +GDS FT+L RY NL+ IGSGAQG V A  D+V  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNII LLN FTPQ+++  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG SF+MTPYVVTRYYRAPEVILGMGY ENVDIWSVGCI  EMV  +I+FPG D+IDQW K+ + LGTPS EF+ +LQP+VRNYV++RP+  G +F  LFPD  FP  S EH  L A  ARDLL KML+IDP +RISV EAL+H YINVW++  EV  PPP  YD  +DERE ++D+WK+LI+++V  +E + +N     + Q SP + VQ
Sbjct:    1 MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAGYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPSPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDCLFPADS-EHNKLKASQARDLLSKMLIIDPAKRISVDEALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHSIDEWKELIYKEVMNFEERTKN--GVVKGQPSPSAQVQ 383          
BLAST of c-Jun N-terminal kinases vs. Ensembl Zebrafish
Match: mapk10 (mitogen-activated protein kinase 10 [Source:ZFIN;Acc:ZDB-GENE-051120-117])

HSP 1 Score: 535.413 bits (1378), Expect = 0.000e+0
Identity = 253/386 (65.54%), Postives = 306/386 (79.27%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPENM*FRCEHQFSPVSYVQ 1247
            M++   + +F++  +GDS FT+L RY NL+ IGSGAQG V A  D+V  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNII LLN FTPQ+++  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG SF+MTPYVVTRYYRAPEVILGMGY ENVDIWSVGCI  EMV  +I+FPG D+IDQW K+ + LGTPS EF+ +LQP+VRNYV++RP+  G +F  LFPD  FP  S EH  L A  ARDLL KML+IDP +RISV EAL+H YINVW++  EV  PPP  YD  +DERE ++D+WK+LI+++V  +E + +N     + Q SP + VQ
Sbjct:    1 MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAGYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPSPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDCLFPADS-EHNKLKASQARDLLSKMLIIDPAKRISVDEALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHSIDEWKELIYKEVMNFEERTKN--GVVKGQPSPSAQVQ 383          
BLAST of c-Jun N-terminal kinases vs. Ensembl Zebrafish
Match: mapk10 (mitogen-activated protein kinase 10 [Source:ZFIN;Acc:ZDB-GENE-051120-117])

HSP 1 Score: 528.094 bits (1359), Expect = 0.000e+0
Identity = 248/378 (65.61%), Postives = 299/378 (79.10%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNG--------PPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            M++   + +F++  +GDS FT+L RY NL+ IGSGAQG V A  D+V  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNII LLN FTPQ+++  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG SF+MTPYVVTRYYRAPEVILGMGY ENVDIWSVGCI  EMV  +I+FPG D+IDQW K+ + LGTPS EF+ +LQP+VRNYV++RP+  G +F  LFPD  FP  S EH  L A  ARDLL KML+IDP +RISV EAL+H YINVW++  EV          PPP  YD  +DERE ++D+WK+LI+++V  +E + +N
Sbjct:   39 MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAGYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPSPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDCLFPADS-EHNKLKASQARDLLSKMLIIDPAKRISVDEALQHPYINVWYDPAEVEAARNQQISMPPPQIYDKQLDEREHSIDEWKELIYKEVMNFEERTKN 415          
BLAST of c-Jun N-terminal kinases vs. Ensembl Zebrafish
Match: mapk10 (mitogen-activated protein kinase 10 [Source:ZFIN;Acc:ZDB-GENE-051120-117])

HSP 1 Score: 527.709 bits (1358), Expect = 0.000e+0
Identity = 253/394 (64.21%), Postives = 306/394 (77.66%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNG--------PPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPENM*FRCEHQFSPVSYVQ 1247
            M++   + +F++  +GDS FT+L RY NL+ IGSGAQG V A  D+V  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNII LLN FTPQ+++  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG SF+MTPYVVTRYYRAPEVILGMGY ENVDIWSVGCI  EMV  +I+FPG D+IDQW K+ + LGTPS EF+ +LQP+VRNYV++RP+  G +F  LFPD  FP  S EH  L A  ARDLL KML+IDP +RISV EAL+H YINVW++  EV          PPP  YD  +DERE ++D+WK+LI+++V  +E + +N     + Q SP + VQ
Sbjct:   39 MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAGYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPSPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDCLFPADS-EHNKLKASQARDLLSKMLIIDPAKRISVDEALQHPYINVWYDPAEVEAARNQQISMPPPQIYDKQLDEREHSIDEWKELIYKEVMNFEERTKNG--VVKGQPSPSAQVQ 429          
BLAST of c-Jun N-terminal kinases vs. Ensembl Zebrafish
Match: mapk10 (mitogen-activated protein kinase 10 [Source:ZFIN;Acc:ZDB-GENE-051120-117])

HSP 1 Score: 527.709 bits (1358), Expect = 0.000e+0
Identity = 253/394 (64.21%), Postives = 306/394 (77.66%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNG--------PPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPENM*FRCEHQFSPVSYVQ 1247
            M++   + +F++  +GDS FT+L RY NL+ IGSGAQG V A  D+V  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNII LLN FTPQ+++  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG SF+MTPYVVTRYYRAPEVILGMGY ENVDIWSVGCI  EMV  +I+FPG D+IDQW K+ + LGTPS EF+ +LQP+VRNYV++RP+  G +F  LFPD  FP  S EH  L A  ARDLL KML+IDP +RISV EAL+H YINVW++  EV          PPP  YD  +DERE ++D+WK+LI+++V  +E + +N     + Q SP + VQ
Sbjct:   42 MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAGYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPSPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDCLFPADS-EHNKLKASQARDLLSKMLIIDPAKRISVDEALQHPYINVWYDPAEVEAARNQQISMPPPQIYDKQLDEREHSIDEWKELIYKEVMNFEERTKNG--VVKGQPSPSAQVQ 432          
BLAST of c-Jun N-terminal kinases vs. Ensembl Xenopus
Match: dpp8 (dipeptidyl-peptidase 8 [Source:Xenbase;Acc:XB-GENE-991409])

HSP 1 Score: 537.724 bits (1384), Expect = 0.000e+0
Identity = 248/370 (67.03%), Postives = 299/370 (80.81%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            M++   + +F++  +GDS FT+L RY NL+ IGSGAQG V AA D+V  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNII LLN FTPQ+++  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG SF+MTPYVVTRYYRAPEVILGMGY ENVD+WSVGCI  EM+   ++FPGTDHIDQW K+ + LGTP  EF+ +LQP+VRNYV++RP+  G +F  LFPD  FP  S EH  L A  ARDLL KMLVIDP +RISV EAL+H YINVW++  EV  PPP  YD  +DERE T+++WK+LI+++V  +E + +N
Sbjct:   39 MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDMWSVGCIMGEMIKGAVLFPGTDHIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADS-EHNKLKASQARDLLSKMLVIDPAKRISVDEALQHPYINVWYDPSEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNFEEKTKN 407          
BLAST of c-Jun N-terminal kinases vs. Ensembl Xenopus
Match: dpp8 (dipeptidyl-peptidase 8 [Source:Xenbase;Acc:XB-GENE-991409])

HSP 1 Score: 536.954 bits (1382), Expect = 0.000e+0
Identity = 249/370 (67.30%), Postives = 299/370 (80.81%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            M++   + +F++  +GDS FT+L RY NL+ IGSGAQG V AA D+V  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNII LLN FTPQ+++  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG SF+MTPYVVTRYYRAPEVILGMGY ENVDIWSVGCI  EMV  +I+FPG D+IDQW K+ + LGTP  EF+ +LQP+VRNYV++RP+  G +F  LFPD  FP  S EH  L A  ARDLL KMLVIDP +RISV EAL+H YINVW++  EV  PPP  YD  +DERE T+++WK+LI+++V  +E + +N
Sbjct:   39 MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADS-EHNKLKASQARDLLSKMLVIDPAKRISVDEALQHPYINVWYDPSEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNFEEKTKN 407          
BLAST of c-Jun N-terminal kinases vs. Ensembl Xenopus
Match: dpp8 (dipeptidyl-peptidase 8 [Source:Xenbase;Acc:XB-GENE-991409])

HSP 1 Score: 536.954 bits (1382), Expect = 0.000e+0
Identity = 249/370 (67.30%), Postives = 299/370 (80.81%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            M++   + +F++  +GDS FT+L RY NL+ IGSGAQG V AA D+V  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNII LLN FTPQ+++  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG SF+MTPYVVTRYYRAPEVILGMGY ENVDIWSVGCI  EMV  +I+FPG D+IDQW K+ + LGTP  EF+ +LQP+VRNYV++RP+  G +F  LFPD  FP  S EH  L A  ARDLL KMLVIDP +RISV EAL+H YINVW++  EV  PPP  YD  +DERE T+++WK+LI+++V  +E + +N
Sbjct:   39 MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADS-EHNKLKASQARDLLSKMLVIDPAKRISVDEALQHPYINVWYDPSEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNFEEKTKN 407          
BLAST of c-Jun N-terminal kinases vs. Ensembl Xenopus
Match: dpp8 (dipeptidyl-peptidase 8 [Source:Xenbase;Acc:XB-GENE-991409])

HSP 1 Score: 536.954 bits (1382), Expect = 0.000e+0
Identity = 249/370 (67.30%), Postives = 299/370 (80.81%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            M++   + +F++  +GDS FT+L RY NL+ IGSGAQG V AA D+V  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNII LLN FTPQ+++  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG SF+MTPYVVTRYYRAPEVILGMGY ENVDIWSVGCI  EMV  +I+FPG D+IDQW K+ + LGTP  EF+ +LQP+VRNYV++RP+  G +F  LFPD  FP  S EH  L A  ARDLL KMLVIDP +RISV EAL+H YINVW++  EV  PPP  YD  +DERE T+++WK+LI+++V  +E + +N
Sbjct:   39 MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADS-EHNKLKASQARDLLSKMLVIDPAKRISVDEALQHPYINVWYDPSEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNFEEKTKN 407          
BLAST of c-Jun N-terminal kinases vs. Ensembl Xenopus
Match: dpp8 (dipeptidyl-peptidase 8 [Source:Xenbase;Acc:XB-GENE-991409])

HSP 1 Score: 536.184 bits (1380), Expect = 0.000e+0
Identity = 249/370 (67.30%), Postives = 299/370 (80.81%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            M++   + +F++  +GDS FT+L RY NL+ IGSGAQG V AA D+V  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNII LLN FTPQ+++  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG SF+MTPYVVTRYYRAPEVILGMGY ENVDIWSVGCI  EMV  +I+FPG D+IDQW K+ + LGTP  EF+ +LQP+VRNYV++RP+  G +F  LFPD  FP  S EH  L A  ARDLL KMLVIDP +RISV EAL+H YINVW++  EV  PPP  YD  +DERE T+++WK+LI+++V  +E + +N
Sbjct:   39 MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADS-EHNKLKASQARDLLSKMLVIDPAKRISVDEALQHPYINVWYDPSEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNFEEKTKN 407          
BLAST of c-Jun N-terminal kinases vs. Ensembl Mouse
Match: Mapk10 (mitogen-activated protein kinase 10 [Source:MGI Symbol;Acc:MGI:1346863])

HSP 1 Score: 536.569 bits (1381), Expect = 0.000e+0
Identity = 249/370 (67.30%), Postives = 298/370 (80.54%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            M++   + +F++  +GDS FT+L RY NL+ IGSGAQG V AA D+V  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNII LLN FTPQ+T+  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG SF+MTPYVVTRYYRAPEVILGMGY ENVD+WSVGCI  EMV   ++FPGTDHIDQW K+ + LGTP  EF+ +LQP+VRNYV++RP+  G +F  LFPD  FP  S EH  L A  ARDLL KMLVIDP +RISV +AL+H YINVW++  EV  PPP  YD  +DERE T+++WK+LI+++V   E + +N
Sbjct:   39 MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVKGTVLFPGTDHIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADS-EHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKN 407          
BLAST of c-Jun N-terminal kinases vs. Ensembl Mouse
Match: Mapk10 (mitogen-activated protein kinase 10 [Source:MGI Symbol;Acc:MGI:1346863])

HSP 1 Score: 535.413 bits (1378), Expect = 0.000e+0
Identity = 249/370 (67.30%), Postives = 298/370 (80.54%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            M++   + +F++  +GDS FT+L RY NL+ IGSGAQG V AA D+V  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNII LLN FTPQ+T+  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG SF+MTPYVVTRYYRAPEVILGMGY ENVDIWSVGCI  EMV  +I+FPG D+IDQW K+ + LGTP  EF+ +LQP+VRNYV++RP+  G +F  LFPD  FP  S EH  L A  ARDLL KMLVIDP +RISV +AL+H YINVW++  EV  PPP  YD  +DERE T+++WK+LI+++V   E + +N
Sbjct:   39 MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADS-EHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKN 407          
BLAST of c-Jun N-terminal kinases vs. Ensembl Mouse
Match: Mapk10 (mitogen-activated protein kinase 10 [Source:MGI Symbol;Acc:MGI:1346863])

HSP 1 Score: 535.413 bits (1378), Expect = 0.000e+0
Identity = 249/370 (67.30%), Postives = 298/370 (80.54%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            M++   + +F++  +GDS FT+L RY NL+ IGSGAQG V AA D+V  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNII LLN FTPQ+T+  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG SF+MTPYVVTRYYRAPEVILGMGY ENVDIWSVGCI  EMV  +I+FPG D+IDQW K+ + LGTP  EF+ +LQP+VRNYV++RP+  G +F  LFPD  FP  S EH  L A  ARDLL KMLVIDP +RISV +AL+H YINVW++  EV  PPP  YD  +DERE T+++WK+LI+++V   E + +N
Sbjct:   39 MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADS-EHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKN 407          
BLAST of c-Jun N-terminal kinases vs. Ensembl Mouse
Match: Mapk10 (mitogen-activated protein kinase 10 [Source:MGI Symbol;Acc:MGI:1346863])

HSP 1 Score: 535.413 bits (1378), Expect = 0.000e+0
Identity = 249/370 (67.30%), Postives = 298/370 (80.54%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            M++   + +F++  +GDS FT+L RY NL+ IGSGAQG V AA D+V  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNII LLN FTPQ+T+  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG SF+MTPYVVTRYYRAPEVILGMGY ENVDIWSVGCI  EMV  +I+FPG D+IDQW K+ + LGTP  EF+ +LQP+VRNYV++RP+  G +F  LFPD  FP  S EH  L A  ARDLL KMLVIDP +RISV +AL+H YINVW++  EV  PPP  YD  +DERE T+++WK+LI+++V   E + +N
Sbjct:   69 MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADS-EHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKN 437          
BLAST of c-Jun N-terminal kinases vs. Ensembl Mouse
Match: Mapk10 (mitogen-activated protein kinase 10 [Source:MGI Symbol;Acc:MGI:1346863])

HSP 1 Score: 534.643 bits (1376), Expect = 0.000e+0
Identity = 249/370 (67.30%), Postives = 298/370 (80.54%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            M++   + +F++  +GDS FT+L RY NL+ IGSGAQG V AA D+V  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNII LLN FTPQ+T+  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG SF+MTPYVVTRYYRAPEVILGMGY ENVDIWSVGCI  EMV  +I+FPG D+IDQW K+ + LGTP  EF+ +LQP+VRNYV++RP+  G +F  LFPD  FP  S EH  L A  ARDLL KMLVIDP +RISV +AL+H YINVW++  EV  PPP  YD  +DERE T+++WK+LI+++V   E + +N
Sbjct:   39 MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADS-EHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKN 407          
BLAST of c-Jun N-terminal kinases vs. UniProt/SwissProt
Match: sp|P92208|JNK_DROME (Stress-activated protein kinase JNK OS=Drosophila melanogaster OX=7227 GN=bsk PE=1 SV=1)

HSP 1 Score: 549.28 bits (1414), Expect = 0.000e+0
Identity = 260/360 (72.22%), Postives = 301/360 (83.61%), Query Frame = 3
Query:  120 HTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            +T  +GD+ FTI +RY NLR IGSGAQG V AA D++T Q VAIKKL+RPFQNVTHAKRAYREF LMKLVNHKNIIGLLNAFTPQ+ +  FQD+YLVMELMDANLCQVI MDLDH+R SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG +F+MTPYVVTRYYRAPEVILGMGYTENVDIWSVGCI  EM+   ++FPGTDHIDQW KI + LGTPS  F+ RLQP+VRNYV++RPR  G SFD LFPD  FP  + +++   A  AR+LL KMLVIDP QRISV EAL+H+YINVW++  EV+ P P  YDHSVDERE TV+QWK+LI+ +V +YE+   N
Sbjct:    9 YTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQMDLDHDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRLQPTVRNYVENRPRYTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKMLVIDPEQRISVDEALKHEYINVWYDAEEVDAPAPEPYDHSVDEREHTVEQWKELIYEEVMDYEAHNTN 368          
BLAST of c-Jun N-terminal kinases vs. UniProt/SwissProt
Match: sp|P49187|MK10_RAT (Mitogen-activated protein kinase 10 OS=Rattus norvegicus OX=10116 GN=Mapk10 PE=1 SV=3)

HSP 1 Score: 535.028 bits (1377), Expect = 0.000e+0
Identity = 249/370 (67.30%), Postives = 298/370 (80.54%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            M++   + +F++  +GDS FT+L RY NL+ IGSGAQG V AA D+V  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNII LLN FTPQ+T+  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG SF+MTPYVVTRYYRAPEVILGMGY ENVDIWSVGCI  EMV  +I+FPG D+IDQW K+ + LGTP  EF+ +LQP+VRNYV++RP+  G +F  LFPD  FP  S EH  L A  ARDLL KMLVIDP +RISV +AL+H YINVW++  EV  PPP  YD  +DERE T+++WK+LI+++V   E + +N
Sbjct:   39 MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADS-EHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKN 407          
BLAST of c-Jun N-terminal kinases vs. UniProt/SwissProt
Match: sp|P53779|MK10_HUMAN (Mitogen-activated protein kinase 10 OS=Homo sapiens OX=9606 GN=MAPK10 PE=1 SV=2)

HSP 1 Score: 535.028 bits (1377), Expect = 0.000e+0
Identity = 249/370 (67.30%), Postives = 298/370 (80.54%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            M++   + +F++  +GDS FT+L RY NL+ IGSGAQG V AA D+V  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNII LLN FTPQ+T+  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG SF+MTPYVVTRYYRAPEVILGMGY ENVDIWSVGCI  EMV  +I+FPG D+IDQW K+ + LGTP  EF+ +LQP+VRNYV++RP+  G +F  LFPD  FP  S EH  L A  ARDLL KMLVIDP +RISV +AL+H YINVW++  EV  PPP  YD  +DERE T+++WK+LI+++V   E + +N
Sbjct:   39 MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADS-EHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKN 407          
BLAST of c-Jun N-terminal kinases vs. UniProt/SwissProt
Match: sp|Q61831|MK10_MOUSE (Mitogen-activated protein kinase 10 OS=Mus musculus OX=10090 GN=Mapk10 PE=1 SV=2)

HSP 1 Score: 534.258 bits (1375), Expect = 0.000e+0
Identity = 248/370 (67.03%), Postives = 298/370 (80.54%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            M++   + +F++  +GDS FT+L RY NL+ IGSGAQG V AA D+V  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNII LLN FTPQ+T+  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG SF+MTPYVVTRYYRAPEVILGMGY ENVDIWSVGCI  EMV  +I+FPG  +IDQW K+ + LGTP  EF+ +LQP+VRNYV++RP+  G +F  LFPD  FP  S EH  L A  ARDLL KMLVIDP++RISV +AL+H YINVW++  EV  PPP  YD  +DERE T+++WK+LI+++V   E + +N
Sbjct:   39 MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRSYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADS-EHNKLKASQARDLLSKMLVIDPVKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKN 407          
BLAST of c-Jun N-terminal kinases vs. UniProt/SwissProt
Match: sp|Q91Y86|MK08_MOUSE (Mitogen-activated protein kinase 8 OS=Mus musculus OX=10090 GN=Mapk8 PE=1 SV=1)

HSP 1 Score: 531.946 bits (1369), Expect = 0.000e+0
Identity = 252/386 (65.28%), Postives = 305/386 (79.02%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPENM*FRCEHQFSPVSYVQ 1247
            M++   +  F++  IGDS FT+L RY NL+ IGSGAQG V AA D++  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNIIGLLN FTPQ+++  FQD+Y+VMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG SF+MTPYVVTRYYRAPEVILGMGY ENVD+WSVGCI  EMVC +I+FPG D+IDQW K+ + LGTP  EF+ +LQP+VR YV++RP+  G SF+ LFPD  FP  S EH  L A  ARDLL KMLVID  +RISV EAL+H YINVW++  E   PPP   D  +DERE T+++WK+LI+++V + E + +N   R   Q SP++ VQ
Sbjct:    1 MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADS-EHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEVMDLEERTKNGVIR--GQPSPLAQVQ 383          
BLAST of c-Jun N-terminal kinases vs. TrEMBL
Match: A0A089FZ03 (Mitogen-activated protein kinase OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 780.015 bits (2013), Expect = 0.000e+0
Identity = 371/371 (100.00%), Postives = 371/371 (100.00%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPENM 1202
            MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPENM
Sbjct:    1 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPENM 371          
BLAST of c-Jun N-terminal kinases vs. TrEMBL
Match: A0A067Z8F7 (Mitogen-activated protein kinase OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 773.467 bits (1996), Expect = 0.000e+0
Identity = 371/378 (98.15%), Postives = 371/378 (98.15%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVV-------AALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPENM 1202
            MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVV       AALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPENM
Sbjct:    1 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVILPISYRAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPENM 378          
BLAST of c-Jun N-terminal kinases vs. TrEMBL
Match: A0A3Q0KT26 (Mitogen-activated protein kinase OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 280/358 (78.21%), Postives = 314/358 (87.71%), Query Frame = 3
Query:  117 FHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQ 1190
            +H EV+GD+RF +  RYSNL+ IGSGAQG+VVAA DSV  Q VAIKKLARPFQNVTHAKRAYREF+LMKLVNHKNII LLNAFTPQQT+ +FQD+YLVME MDANLCQVIN+DLDHERTSYLLYQ+LCGVKHLHAAGIIHRDLKPSNIVVKHDC+LKILDFGLAR+AGDSFLMTPYVVTRYYRAPEVILGMGY+ENVDIWSVGCIFAEMV ERI+FPG DHIDQWTKIT+ LGTP  EF++RL+ +VRNYV SRP+   +SF +LFPDD FP PS EH TLNA  ARDLL +MLVIDPLQRISV +AL H YI+VW+ED EVN PPP  YD S  ER L+V++WK  IF +VKE+E+Q
Sbjct:    9 YHVEVVGDARFVVPFRYSNLKPIGSGAQGFVVAAYDSVLKQDVAIKKLARPFQNVTHAKRAYREFVLMKLVNHKNIISLLNAFTPQQTLQDFQDVYLVMEFMDANLCQVINLDLDHERTSYLLYQVLCGVKHLHAAGIIHRDLKPSNIVVKHDCSLKILDFGLARTAGDSFLMTPYVVTRYYRAPEVILGMGYSENVDIWSVGCIFAEMVLERILFPGYDHIDQWTKITEELGTPGPEFMNRLEYAVRNYVMSRPKNEPRSFTELFPDDRFPPPSTEHETLNAEQARDLLSRMLVIDPLQRISVDDALHHPYIHVWYEDSEVNAPPPAPYDDSFGERNLSVEEWKARIFHEVKEFEAQ 366          
BLAST of c-Jun N-terminal kinases vs. TrEMBL
Match: G4VLN2 (Mitogen-activated protein kinase OS=Schistosoma mansoni OX=6183 GN=Smp_172240 PE=4 SV=1)

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 280/358 (78.21%), Postives = 314/358 (87.71%), Query Frame = 3
Query:  117 FHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQ 1190
            +H EV+GD+RF +  RYSNL+ IGSGAQG+VVAA DSV  Q VAIKKLARPFQNVTHAKRAYREF+LMKLVNHKNII LLNAFTPQQT+ +FQD+YLVME MDANLCQVIN+DLDHERTSYLLYQ+LCGVKHLHAAGIIHRDLKPSNIVVKHDC+LKILDFGLAR+AGDSFLMTPYVVTRYYRAPEVILGMGY+ENVDIWSVGCIFAEMV ERI+FPG DHIDQWTKIT+ LGTP  EF++RL+ +VRNYV SRP+   +SF +LFPDD FP PS EH TLNA  ARDLL +MLVIDPLQRISV +AL H YI+VW+ED EVN PPP  YD S  ER L+V++WK  IF +VKE+E+Q
Sbjct:   15 YHVEVVGDARFVVPFRYSNLKPIGSGAQGFVVAAYDSVLKQDVAIKKLARPFQNVTHAKRAYREFVLMKLVNHKNIISLLNAFTPQQTLQDFQDVYLVMEFMDANLCQVINLDLDHERTSYLLYQVLCGVKHLHAAGIIHRDLKPSNIVVKHDCSLKILDFGLARTAGDSFLMTPYVVTRYYRAPEVILGMGYSENVDIWSVGCIFAEMVLERILFPGYDHIDQWTKITEELGTPGPEFMNRLEYAVRNYVMSRPKNEPRSFTELFPDDRFPPPSTEHETLNAEQARDLLSRMLVIDPLQRISVDDALHHPYIHVWYEDSEVNAPPPAPYDDSFGERNLSVEEWKARIFHEVKEFEAQ 372          
BLAST of c-Jun N-terminal kinases vs. TrEMBL
Match: A0A430Q2V6 (Mitogen-activated protein kinase (Fragment) OS=Schistosoma bovis OX=6184 GN=DC041_0005249 PE=4 SV=1)

HSP 1 Score: 593.964 bits (1530), Expect = 0.000e+0
Identity = 278/358 (77.65%), Postives = 315/358 (87.99%), Query Frame = 3
Query:  117 FHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQ 1190
            +H EV+GD+RF +  RYSNL+ IGSGAQG+VVAA DSV  Q VAIKKLARPFQNVTHAKRAYREF+LMKLVNHKNII LLNAFTPQQT+ +FQD+YLVME MDANLCQVIN+DLDHERTSYLLYQ+LCGVKHLHAAGIIHRDLKPSNIVVKHDC+LKILDFGLAR+AGDSFLMTPYVVTRYYRAPEVILGMGY+ENVDIWSVGCIFAEMV ERI+FPG DHIDQWTKIT+ LGTP  EF++RL+ +VRNYV SRP+   +SF +LFPDD FP PS +H TLNA  ARDLL +MLVIDPLQRISV +AL H YI+VW+ED EVN PPP  YD S+ ER L+V++WK  IF +VKE+E++
Sbjct:   18 YHVEVVGDARFVVPLRYSNLKPIGSGAQGFVVAAYDSVLKQDVAIKKLARPFQNVTHAKRAYREFVLMKLVNHKNIISLLNAFTPQQTLQDFQDVYLVMEFMDANLCQVINLDLDHERTSYLLYQVLCGVKHLHAAGIIHRDLKPSNIVVKHDCSLKILDFGLARTAGDSFLMTPYVVTRYYRAPEVILGMGYSENVDIWSVGCIFAEMVLERILFPGYDHIDQWTKITEELGTPGPEFMNRLEYAVRNYVMSRPKNEPRSFTELFPDDRFPPPSTDHETLNADQARDLLSRMLVIDPLQRISVDDALHHPYIHVWYEDSEVNAPPPAPYDDSLSERNLSVEEWKARIFHEVKEFEAK 375          
BLAST of c-Jun N-terminal kinases vs. Ensembl Cavefish
Match: mapk8b (mitogen-activated protein kinase 8 [Source:NCBI gene;Acc:103040580])

HSP 1 Score: 517.694 bits (1332), Expect = 0.000e+0
Identity = 246/370 (66.49%), Postives = 292/370 (78.92%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            M +    + +++  +GDS FT+L RY NLR IGSGAQG V +A D +  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNIIGLLN FTPQ+T+  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLHAAGIIHRDLKPSNIVVK DCTLKILDFGLAR+A    LMTPYVVTRYYRAPEVILGMGY  NVD+WS+GCI AEMV   ++FPGTDHIDQW K+ + LGTPS EF+ +L  SVR YV++RPR  G SF+ LFPD  FP  S +H  L A  ARDLL KMLVID  +RISV EAL+H YINVW++  EV  PPP   D  +DERE TV++WK+LI+++V ++E + +N
Sbjct:    1 MNRNKREKEYYSIDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDHILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERLSYLLYQMLCGIKHLHAAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGLLMTPYVVTRYYRAPEVILGMGYQANVDVWSIGCIMAEMVRGSVLFPGTDHIDQWNKVIEQLGTPSQEFMLKLNHSVRTYVENRPRYAGYSFEKLFPDVLFPADS-DHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPTEVEAPPPLITDKQLDEREHTVEEWKELIYKEVLDWEERSKN 369          
BLAST of c-Jun N-terminal kinases vs. Ensembl Cavefish
Match: mapk8b (mitogen-activated protein kinase 8 [Source:NCBI gene;Acc:103040580])

HSP 1 Score: 515.383 bits (1326), Expect = 1.404e-180
Identity = 246/370 (66.49%), Postives = 292/370 (78.92%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            M +    + +++  +GDS FT+L RY NLR IGSGAQG V +A D +  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNIIGLLN FTPQ+T+  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLHAAGIIHRDLKPSNIVVK DCTLKILDFGLAR+A    LMTPYVVTRYYRAPEVILGMGY  NVDIW+VGCI AEMV  +I+FPG D+IDQW K+ + LGTPS EF+ +L  SVR YV++RPR  G SF+ LFPD  FP  S +H  L A  ARDLL KMLVID  +RISV EAL+H YINVW++  EV  PPP   D  +DERE TV++WK+LI+++V ++E + +N
Sbjct:    1 MNRNKREKEYYSIDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDHILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERLSYLLYQMLCGIKHLHAAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGLLMTPYVVTRYYRAPEVILGMGYQANVDIWAVGCIMAEMVRHKILFPGRDYIDQWNKVIEQLGTPSQEFMLKLNHSVRTYVENRPRYAGYSFEKLFPDVLFPADS-DHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPTEVEAPPPLITDKQLDEREHTVEEWKELIYKEVLDWEERSKN 369          
BLAST of c-Jun N-terminal kinases vs. Ensembl Cavefish
Match: mapk8a (mitogen-activated protein kinase 8B [Source:NCBI gene;Acc:103034138])

HSP 1 Score: 517.309 bits (1331), Expect = 1.484e-180
Identity = 248/370 (67.03%), Postives = 291/370 (78.65%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            M +    + F++  +GDS FT+L RY NLR +GSGAQG V +A D    + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNIIGLLN FTPQ+T+  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLHAAGIIHRDLKPSNIVVK DCTLKILDFGLAR+A    LMTPYVVTRYYRAPEVILGMGY  NVD+WSVGCI AEMV   ++FPGTDHIDQW K+ + LGTP+ EFL +L  SVR YV++RPR  G SF+ LFPD  FP  S EH  L A  ARDLL KMLVID  +RISV EAL+H YINVW++  EV  PPP   D  ++ERE TV++WKDLI+++V ++E + +N
Sbjct:   13 MNKNKREKEFYSIDVGDSTFTVLKRYQNLRPVGSGAQGIVCSAYDHHLERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERLSYLLYQMLCGIKHLHAAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGLLMTPYVVTRYYRAPEVILGMGYQANVDVWSVGCIMAEMVRGSVLFPGTDHIDQWNKVIEQLGTPTQEFLMKLNQSVRTYVENRPRYAGYSFEKLFPDVLFPADS-EHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPAEVEAPPPVFTDKQLEEREHTVEEWKDLIYKEVLDWEDRMKN 381          
BLAST of c-Jun N-terminal kinases vs. Ensembl Cavefish
Match: mapk8a (mitogen-activated protein kinase 8B [Source:NCBI gene;Acc:103034138])

HSP 1 Score: 515.768 bits (1327), Expect = 6.391e-180
Identity = 248/370 (67.03%), Postives = 291/370 (78.65%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            M +    + F++  +GDS FT+L RY NLR +GSGAQG V +A D    + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNIIGLLN FTPQ+T+  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLHAAGIIHRDLKPSNIVVK DCTLKILDFGLAR+A    LMTPYVVTRYYRAPEVILGMGY  NVDIWSVGCI AEMV  +I+FPG D+IDQW K+ + LGTP+ EFL +L  SVR YV++RPR  G SF+ LFPD  FP  S EH  L A  ARDLL KMLVID  +RISV EAL+H YINVW++  EV  PPP   D  ++ERE TV++WKDLI+++V ++E + +N
Sbjct:   13 MNKNKREKEFYSIDVGDSTFTVLKRYQNLRPVGSGAQGIVCSAYDHHLERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERLSYLLYQMLCGIKHLHAAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGLLMTPYVVTRYYRAPEVILGMGYQANVDIWSVGCILAEMVRHKILFPGRDYIDQWNKVIEQLGTPTQEFLMKLNQSVRTYVENRPRYAGYSFEKLFPDVLFPADS-EHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPAEVEAPPPVFTDKQLEEREHTVEEWKDLIYKEVLDWEDRMKN 381          
BLAST of c-Jun N-terminal kinases vs. Ensembl Cavefish
Match: mapk9 (mitogen-activated protein kinase 9 [Source:NCBI gene;Acc:103035319])

HSP 1 Score: 505.753 bits (1301), Expect = 2.693e-176
Identity = 239/361 (66.20%), Postives = 291/361 (80.61%), Query Frame = 3
Query:  117 FHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            F++  +GDS FT+L RY  LRAIGSGAQG V +ALD+V G  VA+KKL+RPFQN THAKRAYRE +L+K VNHKNII LLN FTPQ+++  FQDLYLVMELMDA+LCQVI+MDLDHER SYLLYQ+LCG++HLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+A  +F+MTPYVVTRYYRAPEVILGM Y ENVDIWSVGCI  EMV   ++F GTDHIDQW K+ ++LGTPS EF++RL  +VRNYV ++P+  G SF +LFPD  FP  + EH  L    ARDLL KMLVIDP  RISV EAL H YI+VW++  E + PPP   D  ++ERE +++QWK+LI+++V ++E + +N
Sbjct:    8 FYSVQVGDSTFTVLRRYQQLRAIGSGAQGIVCSALDTVLGIPVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIIHLLNVFTPQKSLEEFQDLYLVMELMDASLCQVIHMDLDHERMSYLLYQILCGIRHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMMTPYVVTRYYRAPEVILGMKYKENVDIWSVGCIMGEMVKGSVIFQGTDHIDQWNKVIEVLGTPSLEFMNRLMETVRNYVMNKPQFPGVSFSELFPDWAFPSET-EHDKLKTSQARDLLSKMLVIDPECRISVQEALNHPYIHVWYDPAEADAPPPQISDKQLEEREHSIEQWKELIYKEVMDWEERNKN 367          
BLAST of c-Jun N-terminal kinases vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000729.1 (pep scaffold:Pmarinus_7.0:GL477416:20288:37329:-1 gene:ENSPMAG00000000656.1 transcript:ENSPMAT00000000729.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 526.554 bits (1355), Expect = 0.000e+0
Identity = 244/370 (65.95%), Postives = 298/370 (80.54%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            M++     +F++  +GDS FT+L RY NL+ IGSGAQG V AA D +  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNII L N FTPQ+++  FQD+YLVMELMDANLCQVI M+LDHER SYL+YQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG+SF+MTPYVVTRYYRAPEVILGMGYTENVDIWSVGC+  EM+  RI+FPG D+IDQW KI + LGTP  EF+ +LQP+VRNYV++RP+  G SF+ LFPD  FP  S E+  L A  ARDLL KMLVIDP +RI+V +AL H YIN+W++  EV  PPP  YD  +DERE ++D+WK+LI+++V ++E +  N
Sbjct:    1 MSKCKLETQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDIMQNRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIICLFNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLIYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGNSFMMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCVLGEMIRHRILFPGKDYIDQWNKIIEQLGTPMAEFMKKLQPTVRNYVENRPKYAGYSFEKLFPDVLFPADS-ENNRLKASQARDLLSKMLVIDPAKRINVDQALAHPYINIWYDPSEVEAPPPKIYDKQLDEREHSIDEWKELIYKEVLDWEERNRN 369          
BLAST of c-Jun N-terminal kinases vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004133.1 (pep scaffold:Pmarinus_7.0:GL479498:22366:34653:-1 gene:ENSPMAG00000003756.1 transcript:ENSPMAT00000004133.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 462.996 bits (1190), Expect = 4.419e-161
Identity = 223/348 (64.08%), Postives = 268/348 (77.01%), Query Frame = 3
Query:  213 AALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWF-------------------EDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            AA D++  + VAIKKL+RPFQN THAKRA+RE +LMK VNHKNII LLN F+PQ++  +FQD+YLVM+LMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DC+LKILDFGLAR+A  SF+MTPYVVTRYYRAPEVILGMGYTENVDIWSVGCI  EMV  +I+FPG D+IDQW K+ + LGTP  EF+ RLQP+VRNYV++RPR  G SF+ LFPD  FP  S EH+ L A  ARDLL +MLVIDPL+RI+V EAL+H YI+VW                           P P   D  +DERE TVD+WK+LI+++V ++E + +N
Sbjct:    1 AAYDTIIDRNVAIKKLSRPFQNQTHAKRAFRELVLMKCVNHKNIIKLLNVFSPQKSQEDFQDVYLVMDLMDANLCQVIRMELDHERISYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCSLKILDFGLARTAATSFMMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPVSEFMKRLQPTVRNYVETRPRYPGYSFEKLFPDALFPADS-EHSKLKASQARDLLSRMLVIDPLKRITVDEALQHPYIHVWVRPGRGERGKRQRRCNSLFRRTRAAAQPSPQISDRRLDEREHTVDEWKELIYKEVLDWEDRGKN 347          
BLAST of c-Jun N-terminal kinases vs. Ensembl Sea Lamprey
Match: mapk14a (mitogen-activated protein kinase 14a [Source:NCBI gene;Acc:65237])

HSP 1 Score: 308.916 bits (790), Expect = 8.651e-101
Identity = 169/364 (46.43%), Postives = 230/364 (63.19%), Query Frame = 3
Query:  108 NERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVIN-MDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILG-MGYTENVDIWSVGCIFAEMVCERIMFPGTDH----IDQWTKITQLLGTPSDEFLSRLQP-SVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAY-WARDLLKKMLVIDPLQRISVGEALRHQYINVWFE-DYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKV 1172
             E F  + +  + + +  RY NL ++GSGA G V ++LD+ TG +VA+KKL+RPFQ+V HAKR YRE  L+K + H+N+IGL++ FTP  ++  F DLYLV +LM A+L  ++    L  +   +L+YQ+L G+K++H+AGIIHRDLKPSN+ V  DC LKILDFGLAR A D   MT YV TR+YRAPE++L  M Y + VDIWSVGCI AE++  R +FPGTD     I+Q  KI QL GTP    + R+Q    RNY+QS P T  + F D+F              L A     DLL++MLV+D  QRI+  EAL HQY   + + D E    P   YD S + +E  V++W+ L + +V
Sbjct:    6 KEGFCRQELNKTVWEVPRRYVNLTSVGSGAYGSVCSSLDTKTGMKVAVKKLSRPFQSVIHAKRTYRELRLLKHMKHENVIGLMDVFTPNSSLEEFDDLYLVTDLMGADLNNIVKCQKLTDDHVQFLVYQILRGLKYIHSAGIIHRDLKPSNLAVNEDCELKILDFGLARHADDE--MTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDRILSDINQLVKILQLTGTPPQYLIDRMQSKEARNYIQSLPYTQKRDFKDVF--------------LGANPLVVDLLERMLVLDTDQRITAAEALVHQYFAQYHDPDDEPEAEP---YDQSFENQEFPVEEWRRLTYEEV 350          
BLAST of c-Jun N-terminal kinases vs. Ensembl Sea Lamprey
Match: mapk12a (mitogen-activated protein kinase 12a [Source:NCBI gene;Acc:30681])

HSP 1 Score: 295.819 bits (756), Expect = 1.027e-95
Identity = 160/358 (44.69%), Postives = 219/358 (61.17%), Query Frame = 3
Query:   87 RMAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINM-DLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILG-MGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRL-QPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWK 1151
             MA  S  + F+   I    + +  RYS L A+GSGA G V +++D VTG +VA+KKL RPFQ+   AKRAYRE  L+K + H+N+IGL++ FTP  T++ FQD YLVM  M  +L +++       ++  YL+YQ+L G+K++H++GIIHRDLKP N+ V  DC LKILDFGLAR A     MT YVVTR+YRAPEVIL  M YT+ VDIWSVGCI AEM+  + +FPG DH+DQ   I +L GTP    + R+ +     Y+++ P+   +    +FP+             N   A DLL+KML +DP QR +  EAL+H + +   E  E     P  YD + +  EL   +WK
Sbjct:    1 EMAHASSRKGFYRIEINKMVWEVPKRYSQLFAVGSGAYGTVCSSMDLVTGSKVAVKKLYRPFQSRVFAKRAYRELRLLKHMKHENVIGLVDVFTPNDTLDQFQDFYLVMPFMGTDLSKIMKHGKQSDDKVQYLIYQILKGLKYIHSSGIIHRDLKPGNLAVNEDCELKILDFGLARHADQE--MTGYVVTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMITGKPLFPGNDHMDQLMLILKLTGTPPQYLVDRMDENEAAKYIKTLPKMEKRRISTVFPN------------ANPI-AIDLLEKMLALDPEQRPTASEALQHPFFSETREPLEETEAEP--YDQTFEGVELETSEWK 341          
BLAST of c-Jun N-terminal kinases vs. Ensembl Sea Lamprey
Match: mapk1 (mitogen-activated protein kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030722-2])

HSP 1 Score: 241.121 bits (614), Expect = 1.397e-74
Identity = 143/374 (38.24%), Postives = 219/374 (58.56%), Query Frame = 3
Query:   87 RMAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVIN-MDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGD----SFLMTPYVVTRYYRAPEVIL-GMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSR-LQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDY-EVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYE 1184
            +MA  +       EV+    F +  RY++L  IG GA G V AA D+V   +VAIKK++ PF++ T+ +R  RE  ++    H+NIIG+ N      TI+  +D+Y+V +LM+ +L +++    L ++   Y LYQ+L G+K++H+A ++HRDLKPSN+++   C LKI DFGLAR A      +  +T YV TR+YRAPE++L   GYT+++DIWSVGCI AEM+  R +FPG  ++DQ   I  +LG+PS E L   +    RNY+QS P      ++ LFP                  A DLL KML  +P +RI+V EAL H Y+  +++   E     P ++D  +D  +L  ++ K++IF +   ++
Sbjct:   10 KMATPTQGAAQQPEVVKGQVFDVGPRYTSLSYIGEGAYGMVCAAFDNVKLVRVAIKKIS-PFEHQTYCQRTLREIKILLRFKHENIIGI-NDILRASTIDQMKDVYIVQDLMETDLYKLLKGQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPLFPGKHYLDQLNHILGILGSPSQEDLDCIINMKARNYLQSLPPKAKVPWNRLFPK-------------ADSKALDLLDKMLTFNPHRRITVEEALAHPYLEQYYDPSDEPVAEEPFRFDMELD--DLPKERLKEMIFEETARFQ 366          
BLAST of c-Jun N-terminal kinases vs. Ensembl Yeast
Match: HOG1 (Mitogen-activated protein kinase involved in osmoregulation; controls global reallocation of RNAPII during osmotic shock; mediates recruitment/activation of RNAPII at Hot1p-dependent promoters; binds calmodulin; stimulates antisense transcription to activate CDC28; defines novel S-phase checkpoint with Mrc1p that prevent replication/transcription conflicts; nuclear form represses pseudohyphal growth; autophosphorylates; protein abundance increases under DNA replication stress [Source:SGD;Acc:S000004103])

HSP 1 Score: 248.44 bits (633), Expect = 7.792e-77
Identity = 143/365 (39.18%), Postives = 212/365 (58.08%), Query Frame = 3
Query:  108 NERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINM-DLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILG-MGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRL-QPSVRNYVQSRPR----TFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEY 1181
            NE F    I  + F I NRY++L  +G GA G V +A D++T Q VAIKK+ +PF     AKR YRE  L+K + H+N+I L + F     ++  +D+Y V EL   +L +++    L+ +   Y LYQ+L G+K++H+AG+IHRDLKPSNI++  +C LKI DFGLAR       MT YV TRYYRAPE++L    Y   VDIWS GCIFAEM+  + +FPG DH+ Q++ IT LLG+P  + ++ +   +   +V S P      F + F  + PD                 A DLL+KMLV DP +RI+  +AL H Y +  + D         ++D   ++ +L VD W+ +++ ++ ++
Sbjct:    4 NEEFIRTQIFGTVFEITNRYNDLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTAVLAKRTYRELKLLKHLRHENLICLQDIF-----LSPLEDIYFVTELQGTDLHRLLQTRPLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDPQ--MTGYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVINTICSENTLKFVTSLPHRDPIPFSERFKTVEPD-----------------AVDLLEKMLVFDPKKRITAADALAHPY-SAPYHDPTDEPVADAKFDWHFNDADLPVDTWRVMMYSEILDF 343          
BLAST of c-Jun N-terminal kinases vs. Ensembl Yeast
Match: SLT2 (Serine/threonine MAP kinase; coordinates expression of all 19S regulatory particle assembly-chaperones (RACs) to control proteasome abundance; involved in regulating maintenance of cell wall integrity, cell cycle progression, nuclear mRNA retention in heat shock, septum assembly; required for mitophagy, pexophagy; affects recruitment of mitochondria to phagophore assembly site; plays role in adaptive response of cells to cold; regulated by the PKC1-mediated signaling pathway [Source:SGD;Acc:S000001072])

HSP 1 Score: 213.772 bits (543), Expect = 3.528e-63
Identity = 126/330 (38.18%), Postives = 186/330 (56.36%), Query Frame = 3
Query:  120 HTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAA--LDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMK-LVNHKNIIGLLN---AFTPQQTINNFQDLYLVMELMDANLCQVIN--MDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGD-----SFLMTPYVVTRYYRAPEVILG-MGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRL-QPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVW 1064
            HT  + +  F++  R+  ++ IG GA G V +A   ++     VAIKK+   F      KR+ RE  L++    HKNI  L +    F P  +IN    LYL  ELM+ ++ Q+I     L         YQ+LCG+K++H+A ++HRDLKP N++V  DC LKI DFGLAR   +     S  +T YV TR+YRAPE++L   GYT+ +D+WS GCI AE +  + +F G D+++Q  +I Q+LGTP DE L R+   +V++Y+          F +L+P+                 A DLL++ML  DP +RI+V EAL H Y+++W
Sbjct:    8 HTFKVFNQDFSVDKRFQLIKEIGHGAYGIVCSARFAEAAEDTTVAIKKVTNVFSKTLLCKRSLRELKLLRHFRGHKNITCLYDMDIVFYPDGSING---LYLYEELMECDMHQIIKSGQPLTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENSQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGKPIFKGKDYVNQLNQILQVLGTPPDETLRRIGSKNVQDYIHQLGFIPKVPFVNLYPN-------------ANSQALDLLEQMLAFDPQKRITVDEALEHPYLSIW 321          
BLAST of c-Jun N-terminal kinases vs. Ensembl Yeast
Match: FUS3 (Mitogen-activated serine/threonine protein kinase involved in mating; phosphoactivated by Ste7p; substrates include Ste12p, Far1p, Bni1p, Sst2p; inhibits invasive growth during mating by phosphorylating Tec1p, promoting its; inhibits recruitment of Ste5p, Cdc42p-mediated asymmetry and mating morphogenesis [Source:SGD;Acc:S000000112])

HSP 1 Score: 206.068 bits (523), Expect = 9.866e-62
Identity = 131/348 (37.64%), Postives = 188/348 (54.02%), Query Frame = 3
Query:  183 IGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMD-LDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLAR----SAGDSFL-------MTPYVVTRYYRAPEVIL-GMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTP-SDEFLSRLQ-PSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWF---EDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKV 1172
            +G GA G V +A    TG+ VAIKK+  PF     A R  RE  ++K   H+NII + N   P  +  NF ++Y++ ELM  +L +VI+   L  +   Y +YQ L  VK LH + +IHRDLKPSN+++  +C LK+ DFGLAR    SA D+         MT YV TR+YRAPEV+L    Y+  +D+WS GCI AE+   R +FPG D+  Q   I  ++GTP SD  L  ++ P  R Y++S P       + +FP             +N     DLL++MLV DP +RI+  EAL H Y+  +    ++ E    PP  ++    +  LT    K LI+ ++
Sbjct:   19 LGEGAYGVVCSATHKPTGEIVAIKKI-EPFDKPLFALRTLREIKILKHFKHENIITIFNIQRPD-SFENFNEVYIIQELMQTDLHRVISTQMLSDDHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLINSNCDLKVCDFGLARIIDESAADNSEPTGQQSGMTEYVATRWYRAPEVMLTSAKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGIIGTPHSDNDLRCIESPRAREYIKSLPMYPAAPLEKMFP------------RVNPK-GIDLLQRMLVFDPAKRITAKEALEHPYLQTYHDPNDEPEGEPIPPSFFEFDHYKEALTTKDLKKLIWNEI 351          
BLAST of c-Jun N-terminal kinases vs. Ensembl Yeast
Match: KSS1 (Mitogen-activated protein kinase (MAPK); involved in signal transduction pathways that control filamentous growth and pheromone response; regulates septum assembly, and may directly phosphorylate Bni4p; the KSS1 gene is nonfunctional in S288C strains and functional in W303 strains [Source:SGD;Acc:S000003272])

HSP 1 Score: 198.364 bits (503), Expect = 1.507e-58
Identity = 129/346 (37.28%), Postives = 189/346 (54.62%), Query Frame = 3
Query:  147 FTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVN-HKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVIN------MDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLAR---SAGDSF-----LMTPYVVTRYYRAPEVILGMG-YTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPS-VRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWAR--------DLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYD 1109
            F I ++Y  +  IG GA G V +A+   +G +VAIKK+ +PF       R  RE  L++  + H+NII +L+   P  +I+    +YLV ELM+ +L +VIN        L  +   Y  YQ+L  +K +H+A +IHRD+KPSN+++  +C LK+ DFGLAR   S+ DS       MT YV TR+YRAPE++L    YT  +DIWS GCI AEMV  + +FPG D+  Q   I ++LGTPS E  ++++    + Y+ + P                  P L   T+   W++        DLL KML  +P +RIS  EALRH Y+ ++ +  +    PP   D
Sbjct:    7 FDIPSQYKLVDLIGEGAYGTVCSAIHKPSGIKVAIKKI-QPFSKKLFVTRTIREIKLLRYFHEHENIISILDKVRPV-SIDKLNAVYLVEELMETDLQKVINNQNSGFSTLSDDHVQYFTYQILRALKSIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDSRETLVGFMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILEVLGTPSFEDFNQIKSKRAKEYIANLPM----------------RPPLPWETV---WSKTDLNPDMIDLLDKMLQFNPDKRISAAEALRHPYLAMYHDPSDEPEYPPLNLD 331          
BLAST of c-Jun N-terminal kinases vs. Ensembl Yeast
Match: KDX1 (Protein kinase; implicated in Slt2p mitogen-activated (MAP) kinase signaling pathway; interacts with numerous components in the mating pheromone and CWI MAPK pathways; associates with Rlm1p; KDX1 has a paralog, SLT2, that arose from the whole genome duplication [Source:SGD;Acc:S000001644])

HSP 1 Score: 189.119 bits (479), Expect = 1.915e-54
Identity = 123/360 (34.17%), Postives = 196/360 (54.44%), Query Frame = 3
Query:  153 ILNRYSNLRA-IGSGAQGYVVAALDSVTGQQ--VAIKKLARPFQNVTHAKRAYREFILMK-LVNHKNIIGLLNA---FTPQQTINNFQDLYLVMELMDANLCQVINMD--LDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSF-----LMTPYVVTRYYRAPEVILG-MGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRL-QPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWF---EDYEVNGPPPGQYDHSVDERELTVDQWKDLI-FRKV 1172
            ILN++ +L   IG G+   + ++  + + ++  VAI+K+   F N    KR  RE  L++ L  H NI+ L +    F P   +N    +YL  ELM+ +L Q+I  +  L+       +YQ+LC +K++H+A ++H DLKP N++V  DC LKI +FGL+ S  ++       +  Y+ + +Y+APE++L     T+ VDIWS GCI AE++  + MF G D++D    I Q+LGTP +E L  +    V NY+       G+SF+ + P    PE            A +LLKKML  DP +RI+V +AL H Y+++W    E++        +++H     EL  +  K++  FRKV
Sbjct:   18 ILNKHFHLTGKIGRGSHSLICSSTYTESNEETHVAIRKIPNAFGNKLSCKRTLRELKLLRHLRGHPNIVWLFDTDIVFYPNGALNG---VYLYEELMECDLSQIIRSEQRLEDAHFQSFIYQILCALKYIHSANVLHCDLKPKNLLVNSDCQLKICNFGLSCSYSENHKVNDGFIKGYITSIWYKAPEILLNYQECTKAVDIWSTGCILAELLGRKPMFEGKDYVDHLNHILQILGTPPEETLQEIASQKVYNYIFQFGNIPGRSFESILP-GANPE------------ALELLKKMLEFDPKKRITVEDALEHPYLSMWHDIDEEFSCQKTFRFEFEHIESMAELGNEVIKEVFDFRKV 361          
BLAST of c-Jun N-terminal kinases vs. Ensembl Nematostella
Match: EDO45525 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSV5])

HSP 1 Score: 454.136 bits (1167), Expect = 1.258e-157
Identity = 221/353 (62.61%), Postives = 269/353 (76.20%), Query Frame = 3
Query:  117 FHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPP--------GQYDHSVDERELTVDQWK 1151
            F+T  +GD+ F +L RY NL+ IGSGAQG V AA+D+VTG++VAIKKL+RPFQNVTHAKRA+RE +LM++VNHKNIIGLLN FTP +T+  F DLYLVMELMDA+LCQVI+MDLDHER SYLLYQ+LCGVKHLH A IIHRDLKPSNIVVK DC+LKILDFGLAR+AG +F+MTPYVVTRYYRAPEVILGMGY +NVD+WS+GCI AEM+   +MFPGTDHIDQW K+T+ LGTPS+ FL++LQPSVR Y   RP+  G SF+ LFPDD FP  +     L A     L+K M V   + +  +        IN  +  Y+ N P           +YDHS+DE+E +V++WK
Sbjct:    2 FYTAQVGDTIFIVLKRYQNLQPIGSGAQGMVCAAIDTVTGEKVAIKKLSRPFQNVTHAKRAFRELVLMRMVNHKNIIGLLNVFTPDRTLEQFNDLYLVMELMDASLCQVIHMDLDHERLSYLLYQMLCGVKHLHDADIIHRDLKPSNIVVKSDCSLKILDFGLARTAGSAFMMTPYVVTRYYRAPEVILGMGYCDNVDVWSIGCILAEMIRGHVMFPGTDHIDQWNKVTEQLGTPSESFLNQLQPSVRMYCTRRPKQPGFSFEALFPDDLFPPEN----KLKANPTYTLIKPMYVTTQISQPYLS-------INQTYVRYDPNKPARPKHLSNLCTKYDHSIDEQEHSVEEWK 343          
BLAST of c-Jun N-terminal kinases vs. Ensembl Nematostella
Match: EDO33790 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR80])

HSP 1 Score: 311.227 bits (796), Expect = 2.285e-102
Identity = 172/323 (53.25%), Postives = 208/323 (64.40%), Query Frame = 3
Query:  117 FHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVN 1085
            F+T  +GD+ F +L RY NL+ IGSGAQG V AA+D+VTG++VAIKKL+RPFQNVTHAKRA+RE +LM++VNHKNIIGLLN FTP +T+  F DLYLVMELMDA+LCQVI+MDLDHER SYLLYQ+LCGVKHLH A IIHRDLKPSNIVVK DC+LK +   +    G     T     R++  PE  L M   E  D+     I  +   ER   P                         ++  VR Y   RP+  G SF+ LFPDD FP  +     L A   RDLL KMLVIDP +RISV EAL H Y++VW++  EV 
Sbjct:    2 FYTAQVGDTIFIVLKRYQNLQPIGSGAQGMVCAAIDTVTGEKVAIKKLSRPFQNVTHAKRAFRELVLMRMVNHKNIIGLLNVFTPDRTLEQFNDLYLVMELMDASLCQVIHMDLDHERLSYLLYQMLCGVKHLHDADIIHRDLKPSNIVVKSDCSLKCV--SIVTKDG----TTGQRPQRFFYVPEYRLMMC-DEKRDLRLNVLIRED---ERFTVPN------------------------VESQVRMYCTRRPKQPGFSFEALFPDDLFPPEN----KLKASQCRDLLSKMLVIDPAKRISVMEALHHPYVHVWYDANEVE 286          
BLAST of c-Jun N-terminal kinases vs. Ensembl Nematostella
Match: EDO46881 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNM4])

HSP 1 Score: 286.189 bits (731), Expect = 1.255e-91
Identity = 155/368 (42.12%), Postives = 226/368 (61.41%), Query Frame = 3
Query:  117 FHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAAL-------DSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMD-LDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILG-MGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRL-QPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQ 1190
            + TE++ ++ + +  +Y  L  IG+GA G V ++        +      VAIKKL+RPFQ+  HAKR YRE  L++ + H+N+I LL+ FT      +FQD+Y+V ELM ++L  ++    L  E   +L+YQ+L G+K++H+AG+IHRDLKPSNI V  DC LKILDFGLAR       MT YV TR+YRAPE++L  M Y + VDIWSVGCI AE++  + +FPG DHIDQ TKI QL+G PSD+FL ++   S RNY+   P      FD+ F       P           A DLL+KML +D   RI+  EAL H Y+  + +    + P    +D S DE+EL+++ W+ L+++++ +++ +
Sbjct:    9 YRTELV-NTVYEVPRKYQELSPIGTGAYGQVCSSTITEPDPTNPDGPNTVAIKKLSRPFQSTMHAKRTYRELKLLRHMRHENVISLLDVFTTASAFEHFQDVYMVTELMGSDLNGILRFQKLSDEHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELKILDFGLARMTDAE--MTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTSKTLFPGNDHIDQLTKIMQLVGKPSDDFLQKIDSESARNYIAQMPDYRKTPFDEYF---VGANP----------LAVDLLEKMLNLDTDHRITAVEALSHPYLASYAD--PNDEPTCSTFDDSFDEKELSIEGWRALVYQEILDFQQK 358          
BLAST of c-Jun N-terminal kinases vs. Ensembl Nematostella
Match: EDO40573 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6R5])

HSP 1 Score: 243.817 bits (621), Expect = 4.552e-75
Identity = 134/361 (37.12%), Postives = 214/361 (59.28%), Query Frame = 3
Query:  144 RFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMD--LDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFL-----MTPYVVTRYYRAPEVILGMG-YTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPS-VRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQY---DHSVDERELTVDQWKDLIFRKVKEYESQ 1190
            +F +  RY  +  IG+GA G V +A+D+ TG +VA+KK++R F  +T A+R +RE  +++   H NII + +   P   ++ F D+Y+V++LM+++L ++I+ D  L  E   Y LYQ+L G+K++H+A ++HRDLKPSN++V  +  LKI DFG+AR    S L     MT YV TR+YRAPE++L +  Y+E +D+WSVGCI AEM+  R +FPG ++++Q   I  + GTPS  F+ R+    V+ Y+   P      F+  FP    PE            A +LL +ML +DP +RI+V  AL+H ++    ++Y      P  Y   D   D   +T +  K+ I  ++K+++ +
Sbjct:   16 KFVVDARYKLIETIGNGAYGVVCSAMDTRTGAKVAVKKISRAFDVLTTARRTHRELKILRHFKHDNIICIRDILKPPVNLDEFDDVYVVLDLMESDLHRIIHTDQPLTTEHVRYFLYQILRGLKYIHSAKVLHRDLKPSNLLVNENAELKIGDFGMARGLCSSPLEQKRFMTEYVATRWYRAPELMLSLNEYSEAIDMWSVGCILAEMIGRRPLFPGANYLNQLQMILSVTGTPSQNFIERMGAERVKTYLNQLPHKDPVPFEKFFP-KAHPE------------AINLLSQMLQLDPKERITVENALQHPFL----KEYHSEEDEPTCYSPLDFKFDTVLMTKEALKEAIVNEIKDFQKK 359          
BLAST of c-Jun N-terminal kinases vs. Ensembl Nematostella
Match: EDO37435 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFQ0])

HSP 1 Score: 230.72 bits (587), Expect = 1.373e-70
Identity = 125/322 (38.82%), Postives = 196/322 (60.87%), Query Frame = 3
Query:  126 EVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMD-LDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGD----SFLMTPYVVTRYYRAPEVIL-GMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTP-SDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFE 1070
            EV+    F +  RY+NL  IG GA G VVA +D+ TG+++AIKK++ PF++ T+ +R  RE  ++    H+NIIG+L+     +   + +D+Y+V  LM+ ++ +++    L ++   Y LYQ+L G+K++H+A ++HRDLKPSN+++   C LKI DFGLAR A      +  +T YV TR+YRAPE++L   GY++ +DIWSVGCI AEM+  R +FPG  ++DQ   I  +LG+P +D+ L       R+Y+QS P      F  LF +                 A DL++ +L  +P +RI+V EAL H Y+  +++
Sbjct:    8 EVVRGQVFDVAPRYTNLNYIGEGAYGMVVAGVDNTTGERIAIKKIS-PFEHQTYCQRTLREIKILSRFKHENIIGILDIIRAPRA-EDMKDIYIVQPLMETDMYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARIADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYSKAIDIWSVGCILAEMLANRPLFPGKHYLDQLNLILNVLGSPIADDLLCIKNEKARSYLQSLPYKPKTPFIKLFSN-------------ADAKALDLIENLLAFNPNKRITVEEALAHPYLEQYYD 314          
BLAST of c-Jun N-terminal kinases vs. Ensembl Medaka
Match: mapk10 (mitogen-activated protein kinase 10 [Source:NCBI gene;Acc:101168799])

HSP 1 Score: 534.258 bits (1375), Expect = 0.000e+0
Identity = 247/370 (66.76%), Postives = 299/370 (80.81%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            M++   + +F++  +GDS FT+L RY NL+ IGSGAQG V A  D+V  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNII LLN FTPQ+++  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG SF+MTPYVVTRYYRAPEVILGMGY ENVDIWSVGCI  EMV  +I+FPG D+IDQW K+ + LGTPS EF+ +LQP+VRNYV++RP+  G +F  LFPD  FP  S EH  L A  ARDLL KML+IDP +RISV EAL+H YINVW++  EV  PPP  YD  +DERE ++++WK+LI+++V  +E + +N
Sbjct:    1 MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAGYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPSPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDCLFPADS-EHNKLKASQARDLLSKMLIIDPAKRISVDEALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHSIEEWKELIYKEVMNFEERTKN 369          
BLAST of c-Jun N-terminal kinases vs. Ensembl Medaka
Match: mapk10 (mitogen-activated protein kinase 10 [Source:NCBI gene;Acc:101168799])

HSP 1 Score: 530.791 bits (1366), Expect = 0.000e+0
Identity = 245/370 (66.22%), Postives = 299/370 (80.81%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            M++   + +F++  +GDS FT+L RY NL+ IGSGAQG V A  D+V  + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNII LLN FTPQ+++  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+AG SF+MTPYVVTRYYRAPEVILGMGY ENVD+WSVGCIF E++   ++F GTDHIDQW K+ + LGTPS EF+ +LQP+VRNYV++RP+  G +F  LFPD  FP  S EH  L A  ARDLL KML+IDP +RISV EAL+H YINVW++  EV  PPP  YD  +DERE ++++WK+LI+++V  +E + +N
Sbjct:    1 MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAGYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDMWSVGCIFGEVIRGTVLFLGTDHIDQWNKVIEQLGTPSPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDCLFPADS-EHNKLKASQARDLLSKMLIIDPAKRISVDEALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHSIEEWKELIYKEVMNFEERTKN 369          
BLAST of c-Jun N-terminal kinases vs. Ensembl Medaka
Match: mapk8b (mitogen-activated protein kinase 8 [Source:NCBI gene;Acc:101158978])

HSP 1 Score: 516.924 bits (1330), Expect = 0.000e+0
Identity = 248/370 (67.03%), Postives = 291/370 (78.65%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            M +    + +++  +GDS F +L RY NLR IGSGAQG V +A D    + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNIIGLLN FTPQ+T+ +FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+A     MTPYVVTRYYRAPEVILGMGY  NVD+WSVGCI AEMV   ++FPGTDHIDQW K+ + LGTPS EFL +L  SVRNYV++RPR  G SF+ LFPD  FP  S EH  L A  ARDLL KMLVID  +RISV EAL+H YINVW++  EV  PPPG  D  +DERE TV++WK+LI+++V  +E + +N
Sbjct:    1 MNRNKREKEYYSIDVGDSTFMVLKRYQNLRPIGSGAQGIVCSAYDHNLEKNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKTLEDFQDVYLVMELMDANLCQVIQMELDHERLSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGLHMTPYVVTRYYRAPEVILGMGYQANVDVWSVGCIMAEMVRGSVLFPGTDHIDQWNKVIEQLGTPSQEFLMKLNQSVRNYVENRPRYAGFSFEKLFPDVLFPADS-EHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEVEAPPPGITDKQLDEREHTVEEWKELIYKEVLNWEEKTKN 369          
BLAST of c-Jun N-terminal kinases vs. Ensembl Medaka
Match: MAPK8 (mitogen-activated protein kinase 8 [Source:NCBI gene;Acc:101164997])

HSP 1 Score: 516.153 bits (1328), Expect = 0.000e+0
Identity = 245/370 (66.22%), Postives = 291/370 (78.65%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            M +   ++ F++  +GDS FT+L RY NLR IGSGAQG V +A D    + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNIIGLLN F+PQ+++  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+A    LMTPYVVTRYYRAPEVILGMGY  NVD+WSVGCI AEM+   ++FPGTDHIDQW K+ + LGTPS +FL +L  SVR YV++RPR  G +F+ LFPD  FP  S +H  L A  ARDLL KMLVID  +RISV EAL+H YINVW++  EV  PPP   D  +DERE TV++WKDLI+++V E+E   +N
Sbjct:    1 MNKNKKDKEFYSVDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDQTLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKYVNHKNIIGLLNVFSPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERLSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGLLMTPYVVTRYYRAPEVILGMGYQANVDVWSVGCIVAEMIRGSVLFPGTDHIDQWNKVIEQLGTPSQDFLMKLNQSVRTYVENRPRYAGYTFEKLFPDVLFPADS-DHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPAEVEAPPPKIPDKHLDEREHTVEEWKDLIYKEVTEWEEWTKN 369          
BLAST of c-Jun N-terminal kinases vs. Ensembl Medaka
Match: MAPK8 (mitogen-activated protein kinase 8 [Source:NCBI gene;Acc:101164997])

HSP 1 Score: 515.383 bits (1326), Expect = 1.172e-180
Identity = 246/370 (66.49%), Postives = 291/370 (78.65%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPEN 1199
            M +   ++ F++  +GDS FT+L RY NLR IGSGAQG V +A D    + VAIKKL+RPFQN THAKRAYRE +LMK VNHKNIIGLLN F+PQ+++  FQD+YLVMELMDANLCQVI M+LDHER SYLLYQ+LCG+KHLH+AGIIHRDLKPSNIVVK DCTLKILDFGLAR+A    LMTPYVVTRYYRAPEVILGMGY  NVDIWSVGCI AEMV  +I+FPG D+IDQW K+ + LGTPS +FL +L  SVR YV++RPR  G +F+ LFPD  FP  S +H  L A  ARDLL KMLVID  +RISV EAL+H YINVW++  EV  PPP   D  +DERE TV++WKDLI+++V E+E   +N
Sbjct:    1 MNKNKKDKEFYSVDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDQTLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKYVNHKNIIGLLNVFSPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERLSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGLLMTPYVVTRYYRAPEVILGMGYQANVDIWSVGCILAEMVRHKILFPGRDYIDQWNKVIEQLGTPSQDFLMKLNQSVRTYVENRPRYAGYTFEKLFPDVLFPADS-DHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPAEVEAPPPKIPDKHLDEREHTVEEWKDLIYKEVTEWEEWTKN 369          
BLAST of c-Jun N-terminal kinases vs. Planmine SMEST
Match: SMESG000043618.1 (SMESG000043618.1)

HSP 1 Score: 780.015 bits (2013), Expect = 0.000e+0
Identity = 371/371 (100.00%), Postives = 371/371 (100.00%), Query Frame = 3
Query:   90 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPENM 1202
            MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPENM
Sbjct:    1 MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPENM 371          
BLAST of c-Jun N-terminal kinases vs. Planmine SMEST
Match: SMESG000075533.1 (SMESG000075533.1)

HSP 1 Score: 281.952 bits (720), Expect = 6.933e-90
Identity = 155/362 (42.82%), Postives = 223/362 (61.60%), Query Frame = 3
Query:  117 FHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVI-NMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILG-MGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRL-----QPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEY 1181
            F    I  S +T+  RY NL  IG GA G V AA D    +QVAIKKLARPF +  +AKR YRE  ++  ++H+NI+ L++A+TPQ T  +F D+YL+  LM A+L  +I   +L +E   +L+YQ+L G+K++H++ IIHRDLKPSNI V  DC LKILDFGLAR   +   MT YV TR+YRAPE++L  M YT  VDIWSVGCI AE+   + +FPG DHIDQ  KI +L GTP  EF++++     +  +R  +Q+ PR   K F+  F      E ++           DLL +MLV+DP +RIS  +AL H Y+  + ++++     P   D    + ++ ++ WKD ++  ++ +
Sbjct:    5 FQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEE--MTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPR---KDFNSFFWQYTKDENAI-----------DLLDRMLVLDPDRRISAKDALAHPYLADYHDEHD-EPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNF 349          
BLAST of c-Jun N-terminal kinases vs. Planmine SMEST
Match: SMESG000075533.1 (SMESG000075533.1)

HSP 1 Score: 281.567 bits (719), Expect = 2.456e-89
Identity = 155/362 (42.82%), Postives = 223/362 (61.60%), Query Frame = 3
Query:  117 FHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVI-NMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILG-MGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRL-----QPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEY 1181
            F    I  S +T+  RY NL  IG GA G V AA D    +QVAIKKLARPF +  +AKR YRE  ++  ++H+NI+ L++A+TPQ T  +F D+YL+  LM A+L  +I   +L +E   +L+YQ+L G+K++H++ IIHRDLKPSNI V  DC LKILDFGLAR   +   MT YV TR+YRAPE++L  M YT  VDIWSVGCI AE+   + +FPG DHIDQ  KI +L GTP  EF++++     +  +R  +Q+ PR   K F+  F      E ++           DLL +MLV+DP +RIS  +AL H Y+  + ++++     P   D    + ++ ++ WKD ++  ++ +
Sbjct:   29 FQLHNIAHSDWTVPTRYENLNPIGHGAYGSVCAAFDHKLQRQVAIKKLARPFHSPEYAKRTYRELKIIHHMDHENIVCLIDAYTPQSTRESFSDVYLITPLMGADLNAIIRTQELLNEHVQFLVYQILRGLKYMHSSEIIHRDLKPSNIAVNEDCELKILDFGLARQTDEE--MTGYVATRWYRAPEIMLSWMHYTNRVDIWSVGCIMAELFTRKPLFPGNDHIDQLKKIMELAGTPDKEFMNKIVSEDARAFIREKIQTSPR---KDFNSFFWQYTKDENAI-----------DLLDRMLVLDPDRRISAKDALAHPYLADYHDEHD-EPTAPLFVDVMEGKTDVDLETWKDTVWDFIQNF 373          
BLAST of c-Jun N-terminal kinases vs. Planmine SMEST
Match: SMESG000075539.1 (SMESG000075539.1)

HSP 1 Score: 239.195 bits (609), Expect = 1.903e-73
Identity = 144/372 (38.71%), Postives = 209/372 (56.18%), Query Frame = 3
Query:  114 RFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVINMD-LDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVIL-GMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRL-QPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYW----ARDLLKKMLVIDPLQRISVGEALRHQYINVWFE--DYEVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEYESQPENM 1202
            +F T  I  S + +++RY NL+ IG G+QG V +A DS     VAIKKLA PFQ+   AKR YRE  ++  ++H+N+I L++ F+      NF D+Y V  L+  +L ++I  + +  E   + +YQ+L G+K++H+ G+IHRDL P NI V  D  L+ILDFGL+R   D   MT YVV+RYYRAPE+I     YT  +D+WS GCI AEM+  RI+F G D  DQ  +I Q+  T  + F  ++     +NY       F ++ + L P D        H     Y     A DLL KMLV+DP QRIS  +AL H Y+  + +  D  V  P     + + D   + ++ WKD I+  +  +  + EN+
Sbjct:    3 KFKTYKIHYSDWHVVSRYENLKIIGHGSQGSVCSAFDSEFKIYVAIKKLASPFQSQDSAKRTYREMKILHHMDHENVICLIDLFSSSADRINFNDVYFVTPLLSFDLSKIIAKEFMKEENICFFIYQILRGLKYIHSTGVIHRDLAPKNIAVNEDNELRILDFGLSRKKDD--FMTGYVVSRYYRAPEIIFKNSNYTNKIDMWSAGCIMAEMLIHRILFRGNDQFDQLRQIMQIADTSHEGFWGQICAEEEKNY-------FLETVELLPPIDF-------HQFFRQYTEDLKAIDLLSKMLVLDPNQRISATDALLHPYLEFYHDETDESVGAPYLDTLESNSD---VDIETWKDGIWDCMNTFVPKIENL 355          
BLAST of c-Jun N-terminal kinases vs. Planmine SMEST
Match: SMESG000012868.1 (SMESG000012868.1)

HSP 1 Score: 239.195 bits (609), Expect = 1.960e-73
Identity = 133/361 (36.84%), Postives = 218/361 (60.39%), Query Frame = 3
Query:  123 TEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQQVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINNFQDLYLVMELMDANLCQVI-NMDLDHERTSYLLYQLLCGVKHLHAAGIIHRDLKPSNIVVKHDCTLKILDFGLAR----SAGDSFLMTPYVVTRYYRAPEVIL-GMGYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLSRL-QPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLKKMLVIDPLQRISVGEALRHQYINVWFEDY-EVNGPPPGQYDHSVDERELTVDQWKDLIFRKVKEY 1181
             ++  +  F + +RY+NLR IG GA G VV+A D+VT + VAIK+++ PF++ T  +R YRE  ++    H+N+I + N  TP   I + +D+Y+V  LMD ++ ++I +  L +E   Y LYQ+L GVK++H+A ++HRDLKPSN++V  +C LKI DFGLAR        + ++T YV TR+YRAPEV+L   GY++ +D+WS+GCI AEM+  + +FPG  ++ Q   I  +LG+P  E  S +     RN+V+       + +++LFP+    EP          +  D+L ++L  +P +R++  +AL+H Y+  ++E   E     P   +H +D   L+++  K +I+ +V  Y
Sbjct:    7 VQIFRNQPFYVGSRYTNLRFIGEGAYGIVVSATDNVTHEDVAIKRIS-PFEHQTFCQRTYREIKILLHFKHENVIDIKNLLTPASKIEDIKDIYIVQSLMDTDMYKLIKDQKLSNEHICYFLYQILRGVKYIHSANVLHRDLKPSNLLVNSNCDLKICDFGLARVNDPVQDHNGMLTEYVATRWYRAPEVMLNSKGYSKAMDMWSIGCILAEMLGCKPLFPGKHYVQQLKLIFDVLGSPDYEDKSWIVNEKARNFVEKLIDIPKRPWEELFPNS---EP----------FCLDILDQLLAFNPSKRLTADKALQHPYLQQYYEPTDEPESDSPFNSEHELD--NLSLNTLKQMIWEQVSSY 351          
The following BLAST results are available for this feature:
BLAST of c-Jun N-terminal kinases vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAPK100.000e+065.54mitogen-activated protein kinase 10 [Source:HGNC S... [more]
MAPK100.000e+065.54mitogen-activated protein kinase 10 [Source:HGNC S... [more]
MAPK100.000e+067.03mitogen-activated protein kinase 10 [Source:HGNC S... [more]
MAPK100.000e+067.03mitogen-activated protein kinase 10 [Source:HGNC S... [more]
MAPK100.000e+067.03mitogen-activated protein kinase 10 [Source:HGNC S... [more]
back to top
BLAST of c-Jun N-terminal kinases vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
jnk-16.697e-17765.83Stress-activated protein kinase jnk-1 [Source:Uni... [more]
jnk-16.697e-17765.83Stress-activated protein kinase jnk-1 [Source:Uni... [more]
jnk-11.829e-17565.83Stress-activated protein kinase jnk-1 [Source:Uni... [more]
kgb-18.350e-12953.39GLH-binding kinase 1 [Source:UniProtKB/Swiss-Prot... [more]
kgb-21.584e-10852.62Mitogen-activated protein kinase [Source:UniProtK... [more]
back to top
BLAST of c-Jun N-terminal kinases vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bsk0.000e+072.22gene:FBgn0000229 transcript:FBtr0300982[more]
bsk0.000e+072.22gene:FBgn0000229 transcript:FBtr0302378[more]
bsk0.000e+072.22gene:FBgn0000229 transcript:FBtr0080087[more]
p38a5.298e-10446.22gene:FBgn0015765 transcript:FBtr0084580[more]
p38a5.298e-10446.22gene:FBgn0015765 transcript:FBtr0300572[more]
back to top
BLAST of c-Jun N-terminal kinases vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapk100.000e+065.54mitogen-activated protein kinase 10 [Source:ZFIN;A... [more]
mapk100.000e+065.54mitogen-activated protein kinase 10 [Source:ZFIN;A... [more]
mapk100.000e+065.61mitogen-activated protein kinase 10 [Source:ZFIN;A... [more]
mapk100.000e+064.21mitogen-activated protein kinase 10 [Source:ZFIN;A... [more]
mapk100.000e+064.21mitogen-activated protein kinase 10 [Source:ZFIN;A... [more]
back to top
BLAST of c-Jun N-terminal kinases vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dpp80.000e+067.03dipeptidyl-peptidase 8 [Source:Xenbase;Acc:XB-GENE... [more]
dpp80.000e+067.30dipeptidyl-peptidase 8 [Source:Xenbase;Acc:XB-GENE... [more]
dpp80.000e+067.30dipeptidyl-peptidase 8 [Source:Xenbase;Acc:XB-GENE... [more]
dpp80.000e+067.30dipeptidyl-peptidase 8 [Source:Xenbase;Acc:XB-GENE... [more]
dpp80.000e+067.30dipeptidyl-peptidase 8 [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of c-Jun N-terminal kinases vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mapk100.000e+067.30mitogen-activated protein kinase 10 [Source:MGI Sy... [more]
Mapk100.000e+067.30mitogen-activated protein kinase 10 [Source:MGI Sy... [more]
Mapk100.000e+067.30mitogen-activated protein kinase 10 [Source:MGI Sy... [more]
Mapk100.000e+067.30mitogen-activated protein kinase 10 [Source:MGI Sy... [more]
Mapk100.000e+067.30mitogen-activated protein kinase 10 [Source:MGI Sy... [more]
back to top
BLAST of c-Jun N-terminal kinases vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P92208|JNK_DROME0.000e+072.22Stress-activated protein kinase JNK OS=Drosophila ... [more]
sp|P49187|MK10_RAT0.000e+067.30Mitogen-activated protein kinase 10 OS=Rattus norv... [more]
sp|P53779|MK10_HUMAN0.000e+067.30Mitogen-activated protein kinase 10 OS=Homo sapien... [more]
sp|Q61831|MK10_MOUSE0.000e+067.03Mitogen-activated protein kinase 10 OS=Mus musculu... [more]
sp|Q91Y86|MK08_MOUSE0.000e+065.28Mitogen-activated protein kinase 8 OS=Mus musculus... [more]
back to top
BLAST of c-Jun N-terminal kinases vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A089FZ030.000e+0100.00Mitogen-activated protein kinase OS=Schmidtea medi... [more]
A0A067Z8F70.000e+098.15Mitogen-activated protein kinase OS=Schmidtea medi... [more]
A0A3Q0KT260.000e+078.21Mitogen-activated protein kinase OS=Schistosoma ma... [more]
G4VLN20.000e+078.21Mitogen-activated protein kinase OS=Schistosoma ma... [more]
A0A430Q2V60.000e+077.65Mitogen-activated protein kinase (Fragment) OS=Sch... [more]
back to top
BLAST of c-Jun N-terminal kinases vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapk8b0.000e+066.49mitogen-activated protein kinase 8 [Source:NCBI ge... [more]
mapk8b1.404e-18066.49mitogen-activated protein kinase 8 [Source:NCBI ge... [more]
mapk8a1.484e-18067.03mitogen-activated protein kinase 8B [Source:NCBI g... [more]
mapk8a6.391e-18067.03mitogen-activated protein kinase 8B [Source:NCBI g... [more]
mapk92.693e-17666.20mitogen-activated protein kinase 9 [Source:NCBI ge... [more]
back to top
BLAST of c-Jun N-terminal kinases vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000729.10.000e+065.95pep scaffold:Pmarinus_7.0:GL477416:20288:37329:-1 ... [more]
ENSPMAT00000004133.14.419e-16164.08pep scaffold:Pmarinus_7.0:GL479498:22366:34653:-1 ... [more]
mapk14a8.651e-10146.43mitogen-activated protein kinase 14a [Source:NCBI ... [more]
mapk12a1.027e-9544.69mitogen-activated protein kinase 12a [Source:NCBI ... [more]
mapk11.397e-7438.24mitogen-activated protein kinase 1 [Source:ZFIN;Ac... [more]
back to top
BLAST of c-Jun N-terminal kinases vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HOG17.792e-7739.18Mitogen-activated protein kinase involved in osmor... [more]
SLT23.528e-6338.18Serine/threonine MAP kinase; coordinates expressio... [more]
FUS39.866e-6237.64Mitogen-activated serine/threonine protein kinase ... [more]
KSS11.507e-5837.28Mitogen-activated protein kinase (MAPK); involved ... [more]
KDX11.915e-5434.17Protein kinase; implicated in Slt2p mitogen-activa... [more]
back to top
BLAST of c-Jun N-terminal kinases vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO455251.258e-15762.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337902.285e-10253.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468811.255e-9142.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405734.552e-7537.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374351.373e-7038.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of c-Jun N-terminal kinases vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapk100.000e+066.76mitogen-activated protein kinase 10 [Source:NCBI g... [more]
mapk100.000e+066.22mitogen-activated protein kinase 10 [Source:NCBI g... [more]
mapk8b0.000e+067.03mitogen-activated protein kinase 8 [Source:NCBI ge... [more]
MAPK80.000e+066.22mitogen-activated protein kinase 8 [Source:NCBI ge... [more]
MAPK81.172e-18066.49mitogen-activated protein kinase 8 [Source:NCBI ge... [more]
back to top
BLAST of c-Jun N-terminal kinases vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043618.10.000e+0100.00SMESG000043618.1[more]
SMESG000075533.16.933e-9042.82SMESG000075533.1[more]
SMESG000075533.12.456e-8942.82SMESG000075533.1[more]
SMESG000075539.11.903e-7338.71SMESG000075539.1[more]
SMESG000012868.11.960e-7336.84SMESG000012868.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30020168
GenBankAIP89944.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020168 ID=SMED30020168|Name=c-Jun N-terminal kinases|organism=Schmidtea mediterranea sexual|type=transcript|length=1748bp
CTTGCACAATAATAATAATTAATTTAAATCGATATCAATTTTAATTTTTT
ATATAAATATTCGATCAAATATTTTAATTTCTGAACCGAATGGCTCAGGG
ATCATTCAATGAAAGATTTCACACAGAAGTCATCGGTGACTCTAGATTTA
CGATTTTAAATCGTTATTCTAATTTAAGAGCTATTGGTTCCGGTGCACAA
GGATACGTTGTAGCTGCACTTGATTCGGTAACCGGACAACAAGTTGCAAT
TAAAAAGCTTGCAAGACCTTTTCAAAATGTAACACATGCTAAACGAGCTT
ACCGTGAATTTATATTGATGAAACTTGTAAATCATAAAAATATCATTGGT
TTGTTAAATGCATTCACACCACAACAAACAATCAACAATTTTCAAGATCT
CTACCTTGTAATGGAATTGATGGATGCAAATCTTTGCCAAGTTATAAATA
TGGACTTAGATCACGAAAGGACGTCCTATTTACTTTATCAGCTTTTATGT
GGAGTGAAACATCTTCATGCCGCGGGAATAATTCACAGAGACCTCAAACC
GAGCAACATAGTTGTGAAACATGATTGCACTTTGAAAATTTTAGATTTTG
GATTAGCCAGATCTGCCGGAGACAGCTTTCTAATGACTCCATATGTCGTT
ACAAGATATTATCGTGCTCCTGAAGTCATTTTAGGAATGGGTTACACAGA
AAATGTCGACATCTGGTCAGTTGGGTGCATTTTTGCAGAAATGGTATGTG
AGAGAATCATGTTTCCCGGTACAGATCACATTGATCAATGGACGAAAATT
ACTCAGCTCTTGGGAACTCCAAGTGATGAATTTCTTAGCCGTTTACAGCC
ATCCGTTCGCAATTATGTTCAGTCGCGACCACGAACTTTCGGTAAATCAT
TTGATGATCTCTTTCCCGATGATTGTTTCCCTGAACCTTCACTCGAACAC
GCCACATTGAATGCCTATTGGGCTAGGGATTTATTGAAAAAGATGCTTGT
CATTGATCCACTTCAACGAATCTCGGTCGGTGAGGCACTGAGACACCAAT
ATATTAATGTTTGGTTTGAAGATTATGAAGTGAATGGGCCTCCGCCTGGC
CAATATGATCATTCGGTTGATGAAAGAGAGCTCACTGTGGATCAGTGGAA
AGATCTTATATTTCGTAAAGTAAAGGAATATGAAAGCCAACCTGAAAATA
TGTGATTTCGCTGTGAACATCAGTTTTCTCCGGTATCATATGTACAATGT
GGTAATGAAATGATTATGATTGTTAGGATAATATAGTGCTTCCTATTTTG
TTGATTATAAAAACGGAATGACGCTTTAATGGCTCAGTAATATCATAATT
CGTTTGGGTTCTTATTTTCGATAGGATTTGTATTCTTGGTGAATGTATTG
TACGATGTTTATTGGGAAATTGTAATATTCTAATACATCTATTTATTAAA
TAAGGAGCTGTAATTACTGGTGGATAAATGTATATTAGCATTATTATTTT
TAATATTAATTTATTATTATTATTATTAAATTATTATCGTTTGTAAATTG
ATGAGGCTGGAAGTATGTAATTTGTTTGGTTGATTTTGACATAGCGGTTA
TTTGATTTAGTTTATGTAAATGAGTATTTTTATTCATATATTTTGTTGAT
GATGACATTTAATAAATAGACGATATTTGTTTATTTTATTCGCTTCAATA
AATTTTCAGAATATTTATCGACTTTTTTTATGTTGGCGCGCAGAGTAT
back to top

protein sequence of SMED30020168-orf-1

>SMED30020168-orf-1 ID=SMED30020168-orf-1|Name=SMED30020168-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=372bp
MAQGSFNERFHTEVIGDSRFTILNRYSNLRAIGSGAQGYVVAALDSVTGQ
QVAIKKLARPFQNVTHAKRAYREFILMKLVNHKNIIGLLNAFTPQQTINN
FQDLYLVMELMDANLCQVINMDLDHERTSYLLYQLLCGVKHLHAAGIIHR
DLKPSNIVVKHDCTLKILDFGLARSAGDSFLMTPYVVTRYYRAPEVILGM
GYTENVDIWSVGCIFAEMVCERIMFPGTDHIDQWTKITQLLGTPSDEFLS
RLQPSVRNYVQSRPRTFGKSFDDLFPDDCFPEPSLEHATLNAYWARDLLK
KMLVIDPLQRISVGEALRHQYINVWFEDYEVNGPPPGQYDHSVDERELTV
DQWKDLIFRKVKEYESQPENM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000044cephalic ganglia
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000140anterior region of the whole animal
PLANA:0000429neoblast
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR008351MAPK_JNK
IPR000719Prot_kinase_dom
IPR003527MAP_kinase_CS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0000165MAPK cascade
GO:0016310phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004707MAP kinase activity
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008351Mitogen-activated protein (MAP) kinase, JNKPRINTSPR01772JNKMAPKINASEcoord: 76..85
score: 87.22
coord: 233..245
score: 59.4
coord: 261..277
score: 51.31
coord: 112..127
score: 87.15
coord: 135..146
score: 74.07
coord: 325..336
score: 46.76
coord: 173..183
score: 61.11
coord: 198..208
score: 85.35
coord: 281..305
score: 48.44
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 26..322
e-value: 1.6E-83
score: 293.5
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 26..322
e-value: 2.7E-63
score: 213.8
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 26..322
score: 43.382
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 19..361
e-value: 2.4E-138
score: 462.4
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 113..335
e-value: 2.4E-138
score: 462.4
NoneNo IPR availablePANTHERPTHR24055MITOGEN-ACTIVATED PROTEIN KINASEcoord: 8..370
NoneNo IPR availablePANTHERPTHR24055:SF222MITOGEN-ACTIVATED PROTEIN KINASE 8coord: 8..370
NoneNo IPR availableCDDcd07850STKc_JNKcoord: 25..361
e-value: 0.0
score: 690.692
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 147..159
IPR003527Mitogen-activated protein (MAP) kinase, conserved sitePROSITEPS01351MAPKcoord: 61..163
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 17..355