Talin

Overview
NameTalin
Smed IDSMED30020158
Length (bp)7571
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Talin (SMED30020158) t-SNE clustered cells

Violin plots show distribution of expression levels for Talin (SMED30020158) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Talin (SMED30020158) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Talin (SMED30020158) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020158

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30020158SMESG000037841.1 dd_Smed_v4_4579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020158SMESG000037841.1 dd_Smed_v4_4579_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30020158SMESG000037841.1 dd_Smed_v4_4579_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Talin vs. Ensembl Human
Match: TLN2 (talin 2 [Source:HGNC Symbol;Acc:HGNC:15447])

HSP 1 Score: 379.022 bits (972), Expect = 8.291e-105
Identity = 196/438 (44.75%), Postives = 307/438 (70.09%), Query Frame = 2
Query:  161 LKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNT--KTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
            LKI + H    K++  + ++ +Y  C  IR  + EA+  TG+ S DYGLFL  E  + G+WL+  + L  Y+L+ GD++EY+ + R   IR  D   KT++VDDS +V EL++ +C+++GI N+EEYSL+++  + +     T T  K  +  +++ K++K+K KL TDDD+NWL+ S+T R+Q +DE E LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS  +A +    Q Q + G     K+K   + LKE +PK+Y+K +G EKRI + +        IEAK +Y  L RSL+TYG++FFLVKEK+KGK+KL+PRLLG+++D V+R+DEKTKE+++ WPLT+++RWA S  +FT+DFGEY  + YY+ QT +GEQISQLI+GY+DII+K ++S++    +G EES++ E  + P ++ I++ +
Sbjct:    6 LKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQ--TGQAS-DYGLFLSDEDPRKGIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSRIGITNYEEYSLIQET-IEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQES-YYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQ 438          

HSP 2 Score: 81.6481 bits (200), Expect = 2.472e-14
Identity = 71/220 (32.27%), Postives = 105/220 (47.73%), Query Frame = 2
Query: 2342 SENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLR 3001
             E+L+ AAR LA A S +L AV+P   E     R+ +L AA  +G+AS  L RQI  ++                   +D  F+D L+ L K+VANA A LV   K V+Q   A D ++   R+I+  T   L+TSQLV C K+++PTI+   C  Q++     V  +++N          ++             LL  V  A + V  AL +L  H+R
Sbjct:  608 GEDLLRAARTLAGAVSDLLKAVQPTSGEP----RQTVLTAAGSIGQASGDLLRQIGENE-------------------TDERFQDVLMSLAKAVANAAAMLVLKAKNVAQ--VAEDTVLQ-NRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATTDSE------------LLKQVSAAASVVSQALHDLLQHVR 789          
BLAST of Talin vs. Ensembl Human
Match: TLN1 (talin 1 [Source:HGNC Symbol;Acc:HGNC:11845])

HSP 1 Score: 360.147 bits (923), Expect = 4.396e-99
Identity = 194/440 (44.09%), Postives = 307/440 (69.77%), Query Frame = 2
Query:  155 IVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNT--KTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
            + L + I      K++  + ++ +Y  C  IR  I EA    G  S D+GLFL  +  K G+WL+  K L  Y+L+ GD +EYR + R L IR  D   KT++VDDS +V+++++ +CA++GI NH+EYSL+++  + +    +T T  K  +  +++ K++K+K+KL TDD++NWL+  +TLR+Q ++E E LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS  +A + A  QCQ + G    QK+K   + LK+ +PK+YVK KG E++I + +        IEAK  Y  L RSLKTYG++FFLVKEK+KGK+KL+PRLLG++++ V+R+DEKTKE+I+ W LT+I+RWA S  +FT+DFG+Y  + YY+ QT +GEQI+QLI+GY+DII+K +KS++    +G EES++ E  + P ++ +++ +
Sbjct:    2 VALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEAP--AGPPS-DFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRE-LMEEKKEEITGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKG-ERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWAASPKSFTLDFGDYQ-DGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVLQQQ 435          

HSP 2 Score: 73.559 bits (179), Expect = 6.001e-12
Identity = 80/248 (32.26%), Postives = 120/248 (48.39%), Query Frame = 2
Query: 2351 LIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQ-RLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLRCGITVVNFAPRI-QSLELFLTEYDRLKNIF 3088
            L+ AA+ LA A S +L + +P   E     R+ +L AA  VG+AS +L +QI  SD                   +D  F+D+L+ L K+VA+A A LV   K+V+Q    S    G Q ++I+  T   L+TSQLV C K++APTI+   C  Q++ E   +      VA    G ++ ++   +     +  LL  V  A T V  AL+ L  H++   T    A R  Q+ +  LT  +   NIF
Sbjct:  608 LLQAAKGLAGAVSELLRSAQPASAEP----RQNLLQAAGNVGQASGELLQQIGESD-------------------TDPHFQDALMQLAKAVASAAAALVLKAKSVAQRTEDS----GLQTQVIAAATQCALSTSQLVACTKVVAPTISSPVCQEQLV-EAGRL------VAKAVEGCVSASQAATE-----DGQLLRGVGAAATAVTQALNELLQHVKAHATGAGPAGRYDQATDTILTVTE---NIF 813          

HSP 3 Score: 62.3882 bits (150), Expect = 1.540e-8
Identity = 59/217 (27.19%), Postives = 101/217 (46.54%), Query Frame = 2
Query: 5630 STIAQHILSILESRNKNVKLIENEPTSDLANTMSGMITDDDTTILFASAGIKNCD-LENYQDILSGKFLLNGEHKTVASFKNDAHCNVSNGFRNLVQKTAEALVLDTQTLVQNSGDKQKSLATNTESVILTISNLADECESGFVHETRKLSEAK--MMNAIQSVKSALNNTYSDRSAEFSRLIVSNSPSLVNHDSNNGNLEVTDIYSIEETILNIQN 6271
            S    H+L+ L++ N+       +     A+ +SG+I D DTTI+FA+AG  N +  E + D                              R  + KTA+ LV DT+ LVQN+   Q+ LA   +S + TI+ LAD  + G      +  E +  ++NA++ V  AL +  S   A   +  V + P+ V    N+  + VT++ S+ +T+  +++
Sbjct: 1958 SEKVSHVLAALQAGNRGT-----QACITAASAVSGIIADLDTTIMFATAGTLNREGTETFAD-----------------------------HREGILKTAKVLVEDTKVLVQNAAGSQEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKAAAGK--VGDDPA-VWQLKNSAKVMVTNVTSLLKTVKAVED 2137          
BLAST of Talin vs. Ensembl Human
Match: FERMT2 (fermitin family member 2 [Source:HGNC Symbol;Acc:HGNC:15767])

HSP 1 Score: 56.6102 bits (135), Expect = 2.267e-8
Identity = 34/106 (32.08%), Postives = 59/106 (55.66%), Query Frame = 2
Query:  929 TKITLKECVPKDYVK---NKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRW 1237
            T IT +  V   Y+K   NK I  RI++ +  +     IEAK  +    +SL  +GIT F+ + +   K +LI    G++ +R++R+D  T + IKTW  +++++W
Sbjct:   21 TDITPECLVSPRYLKKYKNKQITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELI----GIAYNRLIRMDASTGDAIKTWRFSNMKQW 122          
BLAST of Talin vs. Ensembl Human
Match: FERMT2 (fermitin family member 2 [Source:HGNC Symbol;Acc:HGNC:15767])

HSP 1 Score: 57.3806 bits (137), Expect = 4.173e-7
Identity = 41/164 (25.00%), Postives = 83/164 (50.61%), Query Frame = 2
Query:  929 TKITLKECVPKDYVK---NKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSF--NAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGF 1405
            T IT +  V   Y+K   NK I  RI++ +  +     IEAK  +    +SL  +GIT F+ + +   K +LI    G++ +R++R+D  T + IKTW  +++++W  ++     T++F +     +   + +  + + + I GY+ +  + +   E  + + F
Sbjct:  514 TDITPECLVSPRYLKKYKNKQITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELI----GIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVD-CKVVHEFIGGYIFLSTRAKDQNESLDEEMF 672          
BLAST of Talin vs. Ensembl Human
Match: FERMT2 (fermitin family member 2 [Source:HGNC Symbol;Acc:HGNC:15767])

HSP 1 Score: 57.3806 bits (137), Expect = 4.173e-7
Identity = 41/164 (25.00%), Postives = 83/164 (50.61%), Query Frame = 2
Query:  929 TKITLKECVPKDYVK---NKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSF--NAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGF 1405
            T IT +  V   Y+K   NK I  RI++ +  +     IEAK  +    +SL  +GIT F+ + +   K +LI    G++ +R++R+D  T + IKTW  +++++W  ++     T++F +     +   + +  + + + I GY+ +  + +   E  + + F
Sbjct:  514 TDITPECLVSPRYLKKYKNKQITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELI----GIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVD-CKVVHEFIGGYIFLSTRAKDQNESLDEEMF 672          
BLAST of Talin vs. Ensembl Celegans
Match: tln-1 (TaLiN [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUD9])

HSP 1 Score: 326.25 bits (835), Expect = 1.196e-92
Identity = 178/467 (38.12%), Postives = 278/467 (59.53%), Query Frame = 2
Query:  149 STIVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQL----------------------NDPSRNVTNTKTSSNXXXXXXXXXXXXXXXXXXXIN------WLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEH 1465
              + L +     G  K++  + ++ IY   +    +IRE        + +YG+F   E     LW+DN +    Y+++  D IEY+ + R L +R  D   KT+ VD+S  VS+LM+ +C K+GI N+EEYSL++D+ L                         SR+ ++ +         +    +K  +    ++      WL+ ++TLR+Q I E+E L+++RKYFFSD N+D+RDP+QL+LL++Q ++ I+ G HPV    A QLAALQ   + GD    K K   +  ++ +PK+Y KNK  EK++V +Y  L G   ++AK +Y  LCR LKTYG+TFF+VKEK+ GK+KL+PRLLGV+++ V+R+DE +K+I+K WPL  +RRW  S   F++DFG+Y  + YY+ QT  GE+I+QLI GYVDII+K +++Q+ Q  +G E S++ E  + P +A +V H
Sbjct:    2 GVLSLTVSSAEKGIKKTMQFEPSTLIYDAAK----LIREKFAMHDVNANEYGIFRLDENPSKSLWMDNGRTFEHYLVRNKDEIEYKRKIRLLKVRMLDGAVKTISVDESQPVSQLMMTVCNKIGISNYEEYSLVRDDILMQNGGGGGGGGGQNGGSTWNLKEKESRSKSSDRGGGGIYGTMRKKNEQKLEELRKKLHTDEELPWLDHTKTLREQGITEEETLILRRKYFFSDSNVDSRDPVQLNLLYVQCRDGILRGLHPVEKETAFQLAALQSHIQYGDFPYDKPKF-HLDGRDVLPKEYAKNKENEKKVVAMYKELSGTSELDAKSKYVHLCRGLKTYGVTFFVVKEKLPGKNKLVPRLLGVNKESVMRVDENSKQILKEWPLEQVRRWVPSAKCFSLDFGDYQ-DGYYSVQTTDGEKIAQLIQGYVDIILKKKRTQDHQGIEGDEGSTMLEDMVAPAKATLVAH 462          

HSP 2 Score: 84.7297 bits (208), Expect = 7.272e-16
Identity = 65/219 (29.68%), Postives = 94/219 (42.92%), Query Frame = 2
Query: 2348 NLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLRC 3004
            +L+DA +KL  AF   LN V P+ E R    R  +   A  VGE S  L         +VM                 + F++ L+   K+VA +TAQLV   KT+S       V    +R+I   T    ATSQLV C +++APTI+   C  Q+     EV  +++N+       +                 LT +  A   V  ALD+L +H +C
Sbjct:  638 DLLDATKKLCGAFGKFLNTVNPETEAR----RNEVFRTAGHVGETSQHLI--------NVM----------EAPNEGQQKFDERLVQSAKNVATSTAQLVLCAKTISAECDEPQV---QERVIQSATKCAFATSQLVACARVVAPTIDNNACQQQLSTAATEVTQSVNNLLHDAEHAVYQQSS------------LTDIHEAARQVTSALDSLLEHAKC 819          
BLAST of Talin vs. Ensembl Celegans
Match: tln-1 (TaLiN [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUD9])

HSP 1 Score: 330.872 bits (847), Expect = 1.640e-90
Identity = 178/465 (38.28%), Postives = 278/465 (59.78%), Query Frame = 2
Query:  155 IVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQL----------------------NDPSRNVTNTKTSSNXXXXXXXXXXXXXXXXXXXIN------WLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEH 1465
            + L +     G  K++  + ++ IY   +    +IRE        + +YG+F   E     LW+DN +    Y+++  D IEY+ + R L +R  D   KT+ VD+S  VS+LM+ +C K+GI N+EEYSL++D+ L                         SR+ ++ +         +    +K  +    ++      WL+ ++TLR+Q I E+E L+++RKYFFSD N+D+RDP+QL+LL++Q ++ I+ G HPV    A QLAALQ   + GD    K K   +  ++ +PK+Y KNK  EK++V +Y  L G   ++AK +Y  LCR LKTYG+TFF+VKEK+ GK+KL+PRLLGV+++ V+R+DE +K+I+K WPL  +RRW  S   F++DFG+Y  + YY+ QT  GE+I+QLI GYVDII+K +++Q+ Q  +G E S++ E  + P +A +V H
Sbjct:    4 LSLTVSSAEKGIKKTMQFEPSTLIYDAAK----LIREKFAMHDVNANEYGIFRLDENPSKSLWMDNGRTFEHYLVRNKDEIEYKRKIRLLKVRMLDGAVKTISVDESQPVSQLMMTVCNKIGISNYEEYSLVRDDILMQNGGGGGGGGGQNGGSTWNLKEKESRSKSSDRGGGGIYGTMRKKNEQKLEELRKKLHTDEELPWLDHTKTLREQGITEEETLILRRKYFFSDSNVDSRDPVQLNLLYVQCRDGILRGLHPVEKETAFQLAALQSHIQYGDFPYDKPKF-HLDGRDVLPKEYAKNKENEKKVVAMYKELSGTSELDAKSKYVHLCRGLKTYGVTFFVVKEKLPGKNKLVPRLLGVNKESVMRVDENSKQILKEWPLEQVRRWVPSAKCFSLDFGDY-QDGYYSVQTTDGEKIAQLIQGYVDIILKKKRTQDHQGIEGDEGSTMLEDMVAPAKATLVAH 462          

HSP 2 Score: 81.6481 bits (200), Expect = 8.882e-15
Identity = 66/221 (29.86%), Postives = 97/221 (43.89%), Query Frame = 2
Query: 2348 NLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQA--NNLLLTHVEGALTNVRHALDNLEDHLRC 3004
            +L+DA +KL  AF   LN V P+ E R    R  +   A  VGE S  L         +VM                 + F++ L+   K+VA +TAQLV   KT+S       V    +R+I   T    ATSQLV C +++APTI+   C  Q+     EV  +++N+              + ++  A      LT +  A   V  ALD+L +H +C
Sbjct:  638 DLLDATKKLCGAFGKFLNTVNPETEAR----RNEVFRTAGHVGETSQHLI--------NVM----------EAPNEGQQKFDERLVQSAKNVATSTAQLVLCAKTISAECDEPQV---QERVIQSATKCAFATSQLVACARVVAPTIDNNACQQQLSTAATEVTQSVNNL--------------LHDAEHAVYQQSSLTDIHEAARQVTSALDSLLEHAKC 819          
BLAST of Talin vs. Ensembl Celegans
Match: tln-1 (TaLiN [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUD9])

HSP 1 Score: 105.916 bits (263), Expect = 3.882e-22
Identity = 45/98 (45.92%), Postives = 69/98 (70.41%), Query Frame = 2
Query: 1172 LRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEH 1465
            +R+DE +K+I+K WPL  +RRW  S   F++DFG+Y  + YY+ QT  GE+I+QLI GYVDII+K +++Q+ Q  +G E S++ E  + P +A +V H
Sbjct:    1 MRVDENSKQILKEWPLEQVRRWVPSAKCFSLDFGDY-QDGYYSVQTTDGEKIAQLIQGYVDIILKKKRTQDHQGIEGDEGSTMLEDMVAPAKATLVAH 97          

HSP 2 Score: 79.7221 bits (195), Expect = 2.949e-14
Identity = 66/221 (29.86%), Postives = 97/221 (43.89%), Query Frame = 2
Query: 2348 NLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQA--NNLLLTHVEGALTNVRHALDNLEDHLRC 3004
            +L+DA +KL  AF   LN V P+ E R    R  +   A  VGE S  L         +VM                 + F++ L+   K+VA +TAQLV   KT+S       V    +R+I   T    ATSQLV C +++APTI+   C  Q+     EV  +++N+              + ++  A      LT +  A   V  ALD+L +H +C
Sbjct:  273 DLLDATKKLCGAFGKFLNTVNPETEAR----RNEVFRTAGHVGETSQHLI--------NVM----------EAPNEGQQKFDERLVQSAKNVATSTAQLVLCAKTISAECDEPQV---QERVIQSATKCAFATSQLVACARVVAPTIDNNACQQQLSTAATEVTQSVNNL--------------LHDAEHAVYQQSSLTDIHEAARQVTSALDSLLEHAKC 454          
BLAST of Talin vs. Ensembl Celegans
Match: tln-1 (TaLiN [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUD9])

HSP 1 Score: 103.605 bits (257), Expect = 7.571e-22
Identity = 45/98 (45.92%), Postives = 69/98 (70.41%), Query Frame = 2
Query: 1172 LRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEH 1465
            +R+DE +K+I+K WPL  +RRW  S   F++DFG+Y  + YY+ QT  GE+I+QLI GYVDII+K +++Q+ Q  +G E S++ E  + P +A +V H
Sbjct:    1 MRVDENSKQILKEWPLEQVRRWVPSAKCFSLDFGDY-QDGYYSVQTTDGEKIAQLIQGYVDIILKKKRTQDHQGIEGDEGSTMLEDMVAPAKATLVAH 97          

HSP 2 Score: 81.6481 bits (200), Expect = 4.247e-15
Identity = 65/219 (29.68%), Postives = 94/219 (42.92%), Query Frame = 2
Query: 2348 NLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLRC 3004
            +L+DA +KL  AF   LN V P+ E R    R  +   A  VGE S  L         +VM                 + F++ L+   K+VA +TAQLV   KT+S       V    +R+I   T    ATSQLV C +++APTI+   C  Q+     EV  +++N+       +                 LT +  A   V  ALD+L +H +C
Sbjct:  273 DLLDATKKLCGAFGKFLNTVNPETEAR----RNEVFRTAGHVGETSQHLI--------NVM----------EAPNEGQQKFDERLVQSAKNVATSTAQLVLCAKTISAECDEPQVQ---ERVIQSATKCAFATSQLVACARVVAPTIDNNACQQQLSTAATEVTQSVNNLLHDAEHAVYQQSS------------LTDIHEAARQVTSALDSLLEHAKC 454          
BLAST of Talin vs. Ensembl Fly
Match: rhea (gene:FBgn0260442 transcript:FBtr0333109)

HSP 1 Score: 354.369 bits (908), Expect = 3.276e-107
Identity = 196/451 (43.46%), Postives = 303/451 (67.18%), Query Frame = 2
Query:  149 STIVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMK-DNQLNDPSRNVTNTKTSS--------NXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHRSS 1474
            ST+ L+I +     TK+I    N+ ++  C+ IR   + AE   G+ S +YGLF+  E ++ G+WL+  + L  YIL   D +EYR + R L +R  D   KT+LVDDS  VS+LM+++C K+GI NHEEY L++ DN+  +   N+ + K  +         +    K++ ++KKL+TDD++NW++ S+TLR+Q IDE E +L++R++FFSD NID+RDP+QL+LL++Q+++AI++G HPV+  +A + A +Q   + G     K+K   + LK+ +P+ YV+ KGIEK+I   +        I+AK  Y    R L TYG+TFFLVKEK+ GK+KL+PRLLGV++D VLRLDE TKEI+ +WPLT++RRW  S N FT+DFG+YA N+YY+ QT + EQI QLI+GY+DII+K +++++    +G E S++ E  + P++A  ++H ++
Sbjct:    2 STLSLRIQLEGGRVTKTIQFQPNTTVFDACKVIR--DKFAEAVQGQPS-EYGLFISDEQNQQGVWLEPGRTLGYYILHNQDTLEYRRKTRTLRVRMLDGAVKTILVDDSQPVSQLMVVICTKIGITNHEEYGLVREDNEAQN--ENLPDNKFGTLTLKRKIMEKDRDAKMESLRKKLKTDDEMNWVDVSRTLREQGIDEAETVLLRRRFFFSDQNIDSRDPVQLNLLYVQARDAILDGTHPVTQDKACEFAGIQVHIQFGPHNEAKHKTGFLDLKDFLPQSYVRTKGIEKKIFSEHRKHVDLSEIDAKVLYTKTARELPTYGVTFFLVKEKMNGKNKLVPRLLGVTKDSVLRLDEHTKEILISWPLTTVRRWGASPNTFTLDFGDYA-NQYYSVQTTEAEQIVQLIAGYIDIILKKKQTKDHFGIEGDEGSTMVEESVAPSKATFLQHETN 446          
BLAST of Talin vs. Ensembl Fly
Match: rhea (gene:FBgn0260442 transcript:FBtr0305211)

HSP 1 Score: 363.229 bits (931), Expect = 1.844e-100
Identity = 196/450 (43.56%), Postives = 301/450 (66.89%), Query Frame = 2
Query:  149 STIVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMK-DNQLNDPSRNVTNTKTSS--------NXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHRS 1471
            ST+ L+I +     TK+I    N+ ++  C+ IR     AE   G+ S +YGLF+  E ++ G+WL+  + L  YIL   D +EYR + R L +R  D   KT+LVDDS  VS+LM+++C K+GI NHEEY L++ DN+  +   N+ + K  +         +    K++ ++KKL+TDD++NW++ S+TLR+Q IDE E +L++R++FFSD NID+RDP+QL+LL++Q+++AI++G HPV+  +A + A +Q   + G     K+K   + LK+ +P+ YV+ KGIEK+I   +        I+AK  Y    R L TYG+TFFLVKEK+ GK+KL+PRLLGV++D VLRLDE TKEI+ +WPLT++RRW  S N FT+DFG+YA N+YY+ QT + EQI QLI+GY+DII+K +++++    +G E S++ E  + P++A  ++H +
Sbjct:    2 STLSLRIQLEGGRVTKTIQFQPNTTVFDACKVIRDKF--AEAVQGQPS-EYGLFISDEQNQQGVWLEPGRTLGYYILHNQDTLEYRRKTRTLRVRMLDGAVKTILVDDSQPVSQLMVVICTKIGITNHEEYGLVREDNEAQN--ENLPDNKFGTLTLKRKIMEKDRDAKMESLRKKLKTDDEMNWVDVSRTLREQGIDEAETVLLRRRFFFSDQNIDSRDPVQLNLLYVQARDAILDGTHPVTQDKACEFAGIQVHIQFGPHNEAKHKTGFLDLKDFLPQSYVRTKGIEKKIFSEHRKHVDLSEIDAKVLYTKTARELPTYGVTFFLVKEKMNGKNKLVPRLLGVTKDSVLRLDEHTKEILISWPLTTVRRWGASPNTFTLDFGDYA-NQYYSVQTTEAEQIVQLIAGYIDIILKKKQTKDHFGIEGDEGSTMVEESVAPSKATFLQHET 445          

HSP 2 Score: 81.2629 bits (199), Expect = 1.458e-14
Identity = 57/188 (30.32%), Postives = 96/188 (51.06%), Query Frame = 2
Query: 2342 SENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMD 2905
             + L++AAR L  AFS +L A +P+ +E      + +++AA++VGEA++ +    T ++  V                 +RD  D L+ L K+VAN TA LV   K ++   ++ D      R+I   +   LATSQLV C K++APT++ A C  Q+ A    V   ++++  V +   N+ +   D
Sbjct:  621 GDQLLEAARNLCSAFSDLLKAAEPESKEPP----QHLINAASRVGEATTHVLS--TIAEEEV---------------PENRDLHDMLLALAKAVANTTAALVLRAKNIA---ASCDDEQARNRVIGAASQCALATSQLVACAKVVAPTLHNAACREQLEAAAKNVARAVNSLCEVCNEASNDPKLKAD 784          

HSP 3 Score: 60.8474 bits (146), Expect = 2.051e-8
Identity = 50/178 (28.09%), Postives = 87/178 (48.88%), Query Frame = 2
Query: 5603 IVKFLHQFDSTIAQHILSILESRNKNVKLIENEPTSDLANTMSGMITDDDTTILFASAGIKNCDLENYQDILSGKFLLNGEHKTVASFKNDAHCNVSNGFRNLVQKTAEALVLDTQTLVQNSGDKQKSLATNTESVILTISNLADECESGF--VHETRKLSEAKMMNAIQSVKSALNN 6130
            I +   +    +AQ +L+ L++ ++  +   N      A+T+SG+I D DTTI+FA+AG  + D +       G F  + EH                     + +TA+ALV DT+ LV  +   Q  LA   ++ + TI+ LA+  + G   +  T+  S+  ++NA++ V SAL +
Sbjct: 1959 IARSAREVSEKVAQ-VLAALQAGSRGTQACINA-----AHTVSGIIGDLDTTIMFATAGTLHSDGD-------GSFADHREH---------------------ILQTAKALVEDTKVLVTGAAGTQDQLANAAQNAVSTITQLAEAVKRGACSLGSTQPDSQVMVINAVKDVASALGD 2102          
BLAST of Talin vs. Ensembl Fly
Match: rhea (gene:FBgn0260442 transcript:FBtr0305212)

HSP 1 Score: 363.229 bits (931), Expect = 1.844e-100
Identity = 196/450 (43.56%), Postives = 301/450 (66.89%), Query Frame = 2
Query:  149 STIVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMK-DNQLNDPSRNVTNTKTSS--------NXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHRS 1471
            ST+ L+I +     TK+I    N+ ++  C+ IR     AE   G+ S +YGLF+  E ++ G+WL+  + L  YIL   D +EYR + R L +R  D   KT+LVDDS  VS+LM+++C K+GI NHEEY L++ DN+  +   N+ + K  +         +    K++ ++KKL+TDD++NW++ S+TLR+Q IDE E +L++R++FFSD NID+RDP+QL+LL++Q+++AI++G HPV+  +A + A +Q   + G     K+K   + LK+ +P+ YV+ KGIEK+I   +        I+AK  Y    R L TYG+TFFLVKEK+ GK+KL+PRLLGV++D VLRLDE TKEI+ +WPLT++RRW  S N FT+DFG+YA N+YY+ QT + EQI QLI+GY+DII+K +++++    +G E S++ E  + P++A  ++H +
Sbjct:    2 STLSLRIQLEGGRVTKTIQFQPNTTVFDACKVIRDKF--AEAVQGQPS-EYGLFISDEQNQQGVWLEPGRTLGYYILHNQDTLEYRRKTRTLRVRMLDGAVKTILVDDSQPVSQLMVVICTKIGITNHEEYGLVREDNEAQN--ENLPDNKFGTLTLKRKIMEKDRDAKMESLRKKLKTDDEMNWVDVSRTLREQGIDEAETVLLRRRFFFSDQNIDSRDPVQLNLLYVQARDAILDGTHPVTQDKACEFAGIQVHIQFGPHNEAKHKTGFLDLKDFLPQSYVRTKGIEKKIFSEHRKHVDLSEIDAKVLYTKTARELPTYGVTFFLVKEKMNGKNKLVPRLLGVTKDSVLRLDEHTKEILISWPLTTVRRWGASPNTFTLDFGDYA-NQYYSVQTTEAEQIVQLIAGYIDIILKKKQTKDHFGIEGDEGSTMVEESVAPSKATFLQHET 445          

HSP 2 Score: 81.2629 bits (199), Expect = 1.458e-14
Identity = 57/188 (30.32%), Postives = 96/188 (51.06%), Query Frame = 2
Query: 2342 SENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMD 2905
             + L++AAR L  AFS +L A +P+ +E      + +++AA++VGEA++ +    T ++  V                 +RD  D L+ L K+VAN TA LV   K ++   ++ D      R+I   +   LATSQLV C K++APT++ A C  Q+ A    V   ++++  V +   N+ +   D
Sbjct:  621 GDQLLEAARNLCSAFSDLLKAAEPESKEPP----QHLINAASRVGEATTHVLS--TIAEEEV---------------PENRDLHDMLLALAKAVANTTAALVLRAKNIA---ASCDDEQARNRVIGAASQCALATSQLVACAKVVAPTLHNAACREQLEAAAKNVARAVNSLCEVCNEASNDPKLKAD 784          

HSP 3 Score: 60.8474 bits (146), Expect = 2.051e-8
Identity = 50/178 (28.09%), Postives = 87/178 (48.88%), Query Frame = 2
Query: 5603 IVKFLHQFDSTIAQHILSILESRNKNVKLIENEPTSDLANTMSGMITDDDTTILFASAGIKNCDLENYQDILSGKFLLNGEHKTVASFKNDAHCNVSNGFRNLVQKTAEALVLDTQTLVQNSGDKQKSLATNTESVILTISNLADECESGF--VHETRKLSEAKMMNAIQSVKSALNN 6130
            I +   +    +AQ +L+ L++ ++  +   N      A+T+SG+I D DTTI+FA+AG  + D +       G F  + EH                     + +TA+ALV DT+ LV  +   Q  LA   ++ + TI+ LA+  + G   +  T+  S+  ++NA++ V SAL +
Sbjct: 1959 IARSAREVSEKVAQ-VLAALQAGSRGTQACINA-----AHTVSGIIGDLDTTIMFATAGTLHSDGD-------GSFADHREH---------------------ILQTAKALVEDTKVLVTGAAGTQDQLANAAQNAVSTITQLAEAVKRGACSLGSTQPDSQVMVINAVKDVASALGD 2102          
BLAST of Talin vs. Ensembl Fly
Match: rhea (gene:FBgn0260442 transcript:FBtr0333108)

HSP 1 Score: 362.459 bits (929), Expect = 5.338e-100
Identity = 196/450 (43.56%), Postives = 301/450 (66.89%), Query Frame = 2
Query:  149 STIVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMK-DNQLNDPSRNVTNTKTSS--------NXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHRS 1471
            ST+ L+I +     TK+I    N+ ++  C+ IR     AE   G+ S +YGLF+  E ++ G+WL+  + L  YIL   D +EYR + R L +R  D   KT+LVDDS  VS+LM+++C K+GI NHEEY L++ DN+  +   N+ + K  +         +    K++ ++KKL+TDD++NW++ S+TLR+Q IDE E +L++R++FFSD NID+RDP+QL+LL++Q+++AI++G HPV+  +A + A +Q   + G     K+K   + LK+ +P+ YV+ KGIEK+I   +        I+AK  Y    R L TYG+TFFLVKEK+ GK+KL+PRLLGV++D VLRLDE TKEI+ +WPLT++RRW  S N FT+DFG+YA N+YY+ QT + EQI QLI+GY+DII+K +++++    +G E S++ E  + P++A  ++H +
Sbjct:    2 STLSLRIQLEGGRVTKTIQFQPNTTVFDACKVIRDKF--AEAVQGQPS-EYGLFISDEQNQQGVWLEPGRTLGYYILHNQDTLEYRRKTRTLRVRMLDGAVKTILVDDSQPVSQLMVVICTKIGITNHEEYGLVREDNEAQN--ENLPDNKFGTLTLKRKIMEKDRDAKMESLRKKLKTDDEMNWVDVSRTLREQGIDEAETVLLRRRFFFSDQNIDSRDPVQLNLLYVQARDAILDGTHPVTQDKACEFAGIQVHIQFGPHNEAKHKTGFLDLKDFLPQSYVRTKGIEKKIFSEHRKHVDLSEIDAKVLYTKTARELPTYGVTFFLVKEKMNGKNKLVPRLLGVTKDSVLRLDEHTKEILISWPLTTVRRWGASPNTFTLDFGDYA-NQYYSVQTTEAEQIVQLIAGYIDIILKKKQTKDHFGIEGDEGSTMVEESVAPSKATFLQHET 445          

HSP 2 Score: 80.8777 bits (198), Expect = 1.743e-14
Identity = 57/188 (30.32%), Postives = 96/188 (51.06%), Query Frame = 2
Query: 2342 SENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMD 2905
             + L++AAR L  AFS +L A +P+ +E      + +++AA++VGEA++ +    T ++  V                 +RD  D L+ L K+VAN TA LV   K ++   ++ D      R+I   +   LATSQLV C K++APT++ A C  Q+ A    V   ++++  V +   N+ +   D
Sbjct:  621 GDQLLEAARNLCSAFSDLLKAAEPESKEPP----QHLINAASRVGEATTHVLS--TIAEEEV---------------PENRDLHDMLLALAKAVANTTAALVLRAKNIA---ASCDDEQARNRVIGAASQCALATSQLVACAKVVAPTLHNAACREQLEAAAKNVARAVNSLCEVCNEASNDPKLKAD 784          

HSP 3 Score: 54.6842 bits (130), Expect = 1.710e-6
Identity = 44/140 (31.43%), Postives = 71/140 (50.71%), Query Frame = 2
Query: 5717 ANTMSGMITDDDTTILFASAGIKNCDLENYQDILSGKFLLNGEHKTVASFKNDAHCNVSNGFRNLVQKTAEALVLDTQTLVQNSGDKQKSLATNTESVILTISNLADECESGF--VHETRKLSEAKMMNAIQSVKSALNN 6130
            A+T+SG+I D DTTI+FA+AG  + D +       G F  + EH                     + +TA+ALV DT+ LV  +   Q  LA   ++ + TI+ LA+  + G   +  T+  S+  ++NA++ V SAL +
Sbjct: 1991 AHTVSGIIGDLDTTIMFATAGTLHSDGD-------GSFADHREH---------------------ILQTAKALVEDTKVLVTGAAGTQDQLANAAQNAVSTITQLAEAVKRGACSLGSTQPDSQVMVINAVKDVASALGD 2102          
BLAST of Talin vs. Ensembl Fly
Match: rhea (gene:FBgn0260442 transcript:FBtr0333107)

HSP 1 Score: 362.459 bits (929), Expect = 5.693e-100
Identity = 196/450 (43.56%), Postives = 301/450 (66.89%), Query Frame = 2
Query:  149 STIVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMK-DNQLNDPSRNVTNTKTSS--------NXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHRS 1471
            ST+ L+I +     TK+I    N+ ++  C+ IR     AE   G+ S +YGLF+  E ++ G+WL+  + L  YIL   D +EYR + R L +R  D   KT+LVDDS  VS+LM+++C K+GI NHEEY L++ DN+  +   N+ + K  +         +    K++ ++KKL+TDD++NW++ S+TLR+Q IDE E +L++R++FFSD NID+RDP+QL+LL++Q+++AI++G HPV+  +A + A +Q   + G     K+K   + LK+ +P+ YV+ KGIEK+I   +        I+AK  Y    R L TYG+TFFLVKEK+ GK+KL+PRLLGV++D VLRLDE TKEI+ +WPLT++RRW  S N FT+DFG+YA N+YY+ QT + EQI QLI+GY+DII+K +++++    +G E S++ E  + P++A  ++H +
Sbjct:    2 STLSLRIQLEGGRVTKTIQFQPNTTVFDACKVIRDKF--AEAVQGQPS-EYGLFISDEQNQQGVWLEPGRTLGYYILHNQDTLEYRRKTRTLRVRMLDGAVKTILVDDSQPVSQLMVVICTKIGITNHEEYGLVREDNEAQN--ENLPDNKFGTLTLKRKIMEKDRDAKMESLRKKLKTDDEMNWVDVSRTLREQGIDEAETVLLRRRFFFSDQNIDSRDPVQLNLLYVQARDAILDGTHPVTQDKACEFAGIQVHIQFGPHNEAKHKTGFLDLKDFLPQSYVRTKGIEKKIFSEHRKHVDLSEIDAKVLYTKTARELPTYGVTFFLVKEKMNGKNKLVPRLLGVTKDSVLRLDEHTKEILISWPLTTVRRWGASPNTFTLDFGDYA-NQYYSVQTTEAEQIVQLIAGYIDIILKKKQTKDHFGIEGDEGSTMVEESVAPSKATFLQHET 445          

HSP 2 Score: 81.6481 bits (200), Expect = 1.265e-14
Identity = 57/188 (30.32%), Postives = 96/188 (51.06%), Query Frame = 2
Query: 2342 SENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMD 2905
             + L++AAR L  AFS +L A +P+ +E      + +++AA++VGEA++ +    T ++  V                 +RD  D L+ L K+VAN TA LV   K ++   ++ D      R+I   +   LATSQLV C K++APT++ A C  Q+ A    V   ++++  V +   N+ +   D
Sbjct:  600 GDQLLEAARNLCSAFSDLLKAAEPESKEPP----QHLINAASRVGEATTHVLS--TIAEEEV---------------PENRDLHDMLLALAKAVANTTAALVLRAKNIA---ASCDDEQARNRVIGAASQCALATSQLVACAKVVAPTLHNAACREQLEAAAKNVARAVNSLCEVCNEASNDPKLKAD 763          

HSP 3 Score: 55.0694 bits (131), Expect = 1.357e-6
Identity = 44/140 (31.43%), Postives = 71/140 (50.71%), Query Frame = 2
Query: 5717 ANTMSGMITDDDTTILFASAGIKNCDLENYQDILSGKFLLNGEHKTVASFKNDAHCNVSNGFRNLVQKTAEALVLDTQTLVQNSGDKQKSLATNTESVILTISNLADECESGF--VHETRKLSEAKMMNAIQSVKSALNN 6130
            A+T+SG+I D DTTI+FA+AG  + D +       G F  + EH                     + +TA+ALV DT+ LV  +   Q  LA   ++ + TI+ LA+  + G   +  T+  S+  ++NA++ V SAL +
Sbjct: 1970 AHTVSGIIGDLDTTIMFATAGTLHSDGD-------GSFADHREH---------------------ILQTAKALVEDTKVLVTGAAGTQDQLANAAQNAVSTITQLAEAVKRGACSLGSTQPDSQVMVINAVKDVASALGD 2081          
BLAST of Talin vs. Ensembl Zebrafish
Match: tln1 (talin 1 [Source:ZFIN;Acc:ZDB-GENE-031002-48])

HSP 1 Score: 366.311 bits (939), Expect = 3.800e-101
Identity = 196/439 (44.65%), Postives = 307/439 (69.93%), Query Frame = 2
Query:  155 IVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKD-NQLNDPSRNVTNTKTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
            + L + I      K++  + ++ +Y  C  IR  + EA+   G+ S DYGLFL  +  K G+WL+  K L  Y+L+ GD +EY+ + R L IR  D   KT++VDDS  VS++++ +CA++GI N++EYSL++D  +        T  +  +  ++  K++K+K+KL TDD++NWL+  +TLR+Q ++E E+LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS  +A + A  QCQ + GD    K+K   + LKE +PK+YVKNKG EKRI + +   +    IEAK  Y  L RSLKTYG++FFLVKEK+KGK+KL+PRLLG++++ V+R+DEKTKE+I+ W LT+I+RWA S  +FT+DFG+Y  + YY+ QT +GEQI+QLI+GY+DII+K +KS++    +G EES++ E  + P ++ +++ +
Sbjct:    2 VALSLKIGVGNVVKTMQFEPSTVVYDACRIIRERVPEAQ--LGQPS-DYGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTLEYKKKQRPLKIRMLDGTVKTVMVDDSKIVSDMLMTICARIGITNYDEYSLVRDVGEEKKEETTGTLKRDKTLLRDDKKMEKLKQKLHTDDELNWLDHGRTLREQGVEESEMLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGDHNESKHKPGFLDLKEFLPKEYVKNKG-EKRIFQAHKNCQNMTEIEAKVNYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDY-QDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVLQQQ 435          

HSP 2 Score: 71.633 bits (174), Expect = 1.513e-11
Identity = 69/220 (31.36%), Postives = 102/220 (46.36%), Query Frame = 2
Query: 2342 SENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLR 3001
             + L+ AA+ LA A S ML   +P   E     R+ +L AA  VG+AS +L +QI  SD                   +D+ F+D L+ L K+VANA A LV   K V+Q    S+      ++I+  T   L+TSQLV C +++APTI+   C  Q++     V  +++     + G   +              LL  V  A T V  AL+ L  H+R
Sbjct:  605 GQQLLGAAKNLACAVSDMLKTAQPSSTEP----RQNLLQAAGNVGQASGELLQQIGESD-------------------ADQHFQDMLMQLAKAVANAAAALVLKAKNVAQK---SEDSAQQNKVIAAATQCALSTSQLVACTRVVAPTISSPVCQEQLIEAGKLVAKSVEGCVEASHGATGDEH------------LLKQVGAAATGVTQALNELLQHIR 786          

HSP 3 Score: 60.4622 bits (145), Expect = 3.819e-8
Identity = 61/238 (25.63%), Postives = 110/238 (46.22%), Query Frame = 2
Query: 5645 HILSILESRNKNVKLIENEPTSDLANTMSGMITDDDTTILFASAGIKNCDLENYQDILSGKFLLNGEHKTVASFKNDAHCNVSNGFRNLVQKTAEALVLDTQTLVQNSGDKQKSLATNTESVILTISNLADECESGFVHETRKLSEAK--MMNAIQSVKSALNNTYSDRSAEFSRLIVSNSPSLVNHDSNNGNLEVTDIYSIEETILNIQNRLERFDDKIAHQINNSKNMETVHSRID 6352
            H+L+ L++ N+  +          A+ +SG+I D DTTI+FA+AG  N   EN +     ++ +  EH                     + KTA+ LV DT+ LV  +G  Q+ LA   +S + TI+ LAD  + G      +  E +  ++NA++ V  AL +  S   A   +    + P+++    N+  + VT++ S+ +T+  +++   +    +   I + K    V S  D
Sbjct: 1961 HVLAALQAGNRGTQACITA-----ASAVSGIIADLDTTIMFATAGTLN--RENAETFADHRYYI--EH---------------------ILKTAKVLVEDTKLLVSGAGASQEKLAQAAQSSVNTITKLADVVKLGAASLGSEDPETQVVLINAVKDVAKALGDLISATKAAAGK--PHDDPAMLQL-KNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATIEHIKQELAVFSSAD 2165          
BLAST of Talin vs. Ensembl Zebrafish
Match: tln2a (talin 2a [Source:ZFIN;Acc:ZDB-GENE-040724-263])

HSP 1 Score: 361.688 bits (927), Expect = 9.929e-100
Identity = 187/441 (42.40%), Postives = 306/441 (69.39%), Query Frame = 2
Query:  152 TIVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNT--KTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
             + LKI +      K++  + ++ +Y  C  IR  + EA+  TG+ S +YGLFL  E  + G+WL+  + L  Y+L+ GD++EY+ + R   ++  D   KT++VDDS +V EL++ +C+++GI N+EEYSL+++  + +     T T  K  +  +E+ K++K+K KL TDDD+NWL+  +T R+Q ++E E LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS  +A +   +Q Q + G     K+K   + LKE +PK+Y+K +G EK+I + +        IEAK +Y  L RSL+TYG++FFLVKEK+K K+KL+PRLLGV+++ V+R+DEKTK++++ WPLT+++RWA S  +FT+DFGEY  + YY+ QT +GEQISQLI+GY+DII+K ++S++    +G EE+++ E  + P ++ I++ +
Sbjct:    3 ALSLKICVRQCNVVKTMQFEPSTAVYDACRVIRERVPEAQ--TGQAS-EYGLFLSDEDPRKGIWLEGGRTLDYYMLRNGDILEYKKKQRPQKVKMLDGAVKTIMVDDSKTVGELLVTICSRIGITNYEEYSLIQET-VEEKKDEGTGTLKKDRTLLREERKMEKLKAKLHTDDDLNWLDHGRTFREQGVEESETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFGGIQTQIQFGPHIEHKHKTGFLDLKEFLPKEYIKQRGAEKKIFQEHKGCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKSKNKLVPRLLGVTKESVMRVDEKTKDVVQEWPLTTVKRWAASPKSFTLDFGEYQES-YYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEEATMLEESVSPKKSTILQQQ 438          

HSP 2 Score: 69.707 bits (169), Expect = 6.858e-11
Identity = 74/247 (29.96%), Postives = 113/247 (45.75%), Query Frame = 2
Query: 2348 NLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDN-VAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLRCGITVVNFAPRIQSLELFLTEYDRLKNI 3085
            +L+ AAR L  A S +L AV+P   E     R+ +L AA  +G+AS  L RQI  ++                   +D  F+D L+ L K+VANA A +V   K V+Q    S+  +   R+I+  T   L+TSQLV C K+++PTI+   C  Q++     V  +++  V A  S   +               LL  V  A   V  AL +L  H+R      N+A R + +  +    D + N+
Sbjct:  610 DLMRAARTLTGAVSDLLKAVEPTSGEP----RQTVLTAAGSIGQASGDLLRQIGENE-------------------TDERFQDVLMNLAKAVANAAAMMVLKAKNVAQ---VSEDSVMQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVEGCVKACLSATSDGE-------------LLKAVSAAAGIVTQALSDLLTHVR------NYATRGEPIGRYDQATDTIMNV 811          

HSP 3 Score: 54.6842 bits (130), Expect = 2.477e-6
Identity = 59/214 (27.57%), Postives = 96/214 (44.86%), Query Frame = 2
Query: 5648 ILSILESRNKNVKLIENEPTSDLANTMSGMITDDDTTILFASAGIKNCDLENYQDILSGKFLLNGEHKTVASFKNDAHCNVSNGFRNLVQKTAEALVLDTQTLVQNSGDKQKSLATNTESVILTISNLADECESGF--VHETRKLSEAKMMNAIQSVKSALNNTYSDRSAEFSRLIVSNSPSLVNHDSNNGNLEVTDIYSIEETILNIQNRLER 6283
            +LS L++ NK       +     A+ +SG+I D DTTI+FASAG  N   EN  D                SF +          R  + KTA+ALV DT+ LV  +   Q+ LA   +S   TI+ L D  + G   +      ++  ++NA++ V  AL    S       +   ++ PS+    S    + VT++ S+ +T+  +++   R
Sbjct: 1962 VLSALQAGNKGT-----QACITAASAVSGIIADLDTTIMFASAGTLNA--ENDSD----------------SFADH---------RENILKTAKALVEDTKNLVSGAASSQEKLAQAAQSSAKTITQLTDVVKLGAASIGPDDPETQVVLINAVKDVAKALAELISATKCAAGK--AADDPSMFQLKS-AAKVMVTNVTSLLKTVKAVEDEASR 2140          
BLAST of Talin vs. Ensembl Zebrafish
Match: tln2a (talin 2a [Source:ZFIN;Acc:ZDB-GENE-040724-263])

HSP 1 Score: 361.688 bits (927), Expect = 1.102e-99
Identity = 187/438 (42.69%), Postives = 305/438 (69.63%), Query Frame = 2
Query:  161 LKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNT--KTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
            LKI +      K++  + ++ +Y  C  IR  + EA+  TG+ S +YGLFL  E  + G+WL+  + L  Y+L+ GD++EY+ + R   ++  D   KT++VDDS +V EL++ +C+++GI N+EEYSL+++  + +     T T  K  +  +E+ K++K+K KL TDDD+NWL+  +T R+Q ++E E LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS  +A +   +Q Q + G     K+K   + LKE +PK+Y+K +G EK+I + +        IEAK +Y  L RSL+TYG++FFLVKEK+K K+KL+PRLLGV+++ V+R+DEKTK++++ WPLT+++RWA S  +FT+DFGEY  + YY+ QT +GEQISQLI+GY+DII+K ++S++    +G EE+++ E  + P ++ I++ +
Sbjct:    6 LKICVRQCNVVKTMQFEPSTAVYDACRVIRERVPEAQ--TGQAS-EYGLFLSDEDPRKGIWLEGGRTLDYYMLRNGDILEYKKKQRPQKVKMLDGAVKTIMVDDSKTVGELLVTICSRIGITNYEEYSLIQET-VEEKKDEGTGTLKKDRTLLREERKMEKLKAKLHTDDDLNWLDHGRTFREQGVEESETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFGGIQTQIQFGPHIEHKHKTGFLDLKEFLPKEYIKQRGAEKKIFQEHKGCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKSKNKLVPRLLGVTKESVMRVDEKTKDVVQEWPLTTVKRWAASPKSFTLDFGEYQES-YYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEEATMLEESVSPKKSTILQQQ 438          

HSP 2 Score: 69.3218 bits (168), Expect = 7.034e-11
Identity = 74/247 (29.96%), Postives = 113/247 (45.75%), Query Frame = 2
Query: 2348 NLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDN-VAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLRCGITVVNFAPRIQSLELFLTEYDRLKNI 3085
            +L+ AAR L  A S +L AV+P   E     R+ +L AA  +G+AS  L RQI  ++                   +D  F+D L+ L K+VANA A +V   K V+Q    S+  +   R+I+  T   L+TSQLV C K+++PTI+   C  Q++     V  +++  V A  S   +               LL  V  A   V  AL +L  H+R      N+A R + +  +    D + N+
Sbjct:  610 DLMRAARTLTGAVSDLLKAVEPTSGEP----RQTVLTAAGSIGQASGDLLRQIGENE-------------------TDERFQDVLMNLAKAVANAAAMMVLKAKNVAQ---VSEDSVMQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVEGCVKACLSATSDGE-------------LLKAVSAAAGIVTQALSDLLTHVR------NYATRGEPIGRYDQATDTIMNV 811          

HSP 3 Score: 54.6842 bits (130), Expect = 2.477e-6
Identity = 59/214 (27.57%), Postives = 96/214 (44.86%), Query Frame = 2
Query: 5648 ILSILESRNKNVKLIENEPTSDLANTMSGMITDDDTTILFASAGIKNCDLENYQDILSGKFLLNGEHKTVASFKNDAHCNVSNGFRNLVQKTAEALVLDTQTLVQNSGDKQKSLATNTESVILTISNLADECESGF--VHETRKLSEAKMMNAIQSVKSALNNTYSDRSAEFSRLIVSNSPSLVNHDSNNGNLEVTDIYSIEETILNIQNRLER 6283
            +LS L++ NK       +     A+ +SG+I D DTTI+FASAG  N   EN  D                SF +          R  + KTA+ALV DT+ LV  +   Q+ LA   +S   TI+ L D  + G   +      ++  ++NA++ V  AL    S       +   ++ PS+    S    + VT++ S+ +T+  +++   R
Sbjct: 1965 VLSALQAGNKGT-----QACITAASAVSGIIADLDTTIMFASAGTLNA--ENDSD----------------SFADH---------RENILKTAKALVEDTKNLVSGAASSQEKLAQAAQSSAKTITQLTDVVKLGAASIGPDDPETQVVLINAVKDVAKALAELISATKCAAGK--AADDPSMFQLKS-AAKVMVTNVTSLLKTVKAVEDEASR 2143          
BLAST of Talin vs. Ensembl Zebrafish
Match: tln1 (talin 1 [Source:ZFIN;Acc:ZDB-GENE-031002-48])

HSP 1 Score: 354.755 bits (909), Expect = 1.246e-97
Identity = 194/439 (44.19%), Postives = 303/439 (69.02%), Query Frame = 2
Query:  155 IVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKD-NQLNDPSRNVTNTKTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
            + L + I      K++  + ++ +Y  C  IR  + EA+   G+ S DYGLFL  +  K G+WL+  K L  Y+L+ GD +EY+ + R L IR  D   KT++VDDS  VS++++ +CA++GI N++EYSL++D  +        T  +  +  ++  K++K+K+KL TDD++NWL+  +TLR+Q ++E E+LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS  +A + A  QCQ + GD    K+K   + LKE +PK+YVKNKG EKRI + +   +    IEAK  Y  L RSLKTYG++FFLVKEK+KGK+KL+PRLLG++++ V+R+DEKTKE+I+ W LT+I+RWA S      DFG+Y  + YY+ QT +GEQI+QLI+GY+DII+K +KS++    +G EES++ E  + P ++ +++ +
Sbjct:    2 VALSLKIGVGNVVKTMQFEPSTVVYDACRIIRERVPEAQ--LGQPS-DYGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTLEYKKKQRPLKIRMLDGTVKTVMVDDSKIVSDMLMTICARIGITNYDEYSLVRDVGEEKKEETTGTLKRDKTLLRDDKKMEKLKQKLHTDDELNWLDHGRTLREQGVEESEMLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGDHNESKHKPGFLDLKEFLPKEYVKNKG-EKRIFQAHKNCQNMTEIEAKVNYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKEVIQEWSLTNIKRWAAS----PKDFGDY-QDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVLQQQ 431          

HSP 2 Score: 67.0106 bits (162), Expect = 3.965e-10
Identity = 69/221 (31.22%), Postives = 102/221 (46.15%), Query Frame = 2
Query: 2342 SENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVK-ILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLR 3001
             + L+ AA+ LA A S ML   +P   E     R+ +L AA  VG+AS +L +QI  SD                   +D+ F+D L+ L K+VANA A LV   K V+Q    S+      ++I+  T   L+TSQLV C + ++APTI+   C  Q++     V  +++     + G   +              LL  V  A T V  AL+ L  H+R
Sbjct:  601 GQQLLGAAKNLACAVSDMLKTAQPSSTEP----RQNLLQAAGNVGQASGELLQQIGESD-------------------ADQHFQDMLMQLAKAVANAAAALVLKAKNVAQK---SEDSAQQNKVIAAATQCALSTSQLVACTRVVVAPTISSPVCQEQLIEAGKLVAKSVEGCVEASHGATGDEH------------LLKQVGAAATGVTQALNELLQHIR 783          
BLAST of Talin vs. Ensembl Zebrafish
Match: CABZ01046980.1 (pep chromosome:GRCz11:25:33002963:33016471:1 gene:ENSDARG00000112342.1 transcript:ENSDART00000187366.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01046980.1)

HSP 1 Score: 195.282 bits (495), Expect = 1.300e-54
Identity = 114/287 (39.72%), Postives = 195/287 (67.94%), Query Frame = 2
Query:  152 TIVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNT--KTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKI 1006
             + LKI +      K++  + ++P+Y  C  IR  + EA+  +G+ S DYGLFL  +  + G+WL++ + L  Y+L+ GD++EY+ + R   I+  D   KT++VDDS +V EL++ +C+++GI N+EEYSL+++ Q+ +   +   T  K  +  +++ K++K+K KL TDDD+NWL+ S+T R+Q ++E E+LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS  +A + A +Q Q + G     K+K   + LKE +PK+Y+K +G EKRI ++
Sbjct:    3 ALSLKICVRQCNVVKTMQFEPSTPVYDACRIIRERVPEAQ--SGQAS-DYGLFLSDDDPRKGIWLESGRTLDYYMLRNGDVLEYKKKQRPQKIKMLDGTIKTIMVDDSKTVGELLVTICSRIGITNYEEYSLIQE-QVEEKKEDGMGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVEESEILLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGIQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQV 285          
BLAST of Talin vs. Ensembl Xenopus
Match: TLN2 (talin 2 [Source:NCBI gene;Acc:100144637])

HSP 1 Score: 372.474 bits (955), Expect = 7.374e-103
Identity = 188/438 (42.92%), Postives = 305/438 (69.63%), Query Frame = 2
Query:  161 LKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNT--KTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
            LKI +      K++  + ++ +Y  C  IR  + EA+     ++ D+GLFL  E  + G+WL+  + L  Y+L+ GD++EY+ ++R   IR  D   K +LVDDS +V EL++ +C+++GI N+EEYSL+++  + +     T T  K  +  +++ K++K+K KL T+D++NWL+ S+T R+Q +DE E LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS  +A +   +Q Q + G     K+K   + LKE +PK+Y+K +G EK+I + +        IEAK +Y  L RSL+TYG++FFLVKEK+KGK+KL+PRLLG+++D V+R+DEKTKE+++ WPLT+++RWA S  +FT+DFGEY  + YY+ QT +GEQISQLI+GY+DII+K ++S++    +G EES++ E  + P ++ I++ +
Sbjct:    6 LKICVRQCNVVKTMQFEPSTAVYDACRIIRERVSEAQ---SGQALDFGLFLSDEDPRKGIWLEAGRTLDYYMLRNGDVLEYKKKHRPQKIRMLDGAAKMILVDDSKTVGELLVTICSRIGITNYEEYSLIRET-MEEKKEEQTGTLKKDRTLLRDEKKMEKLKAKLHTEDELNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFGGIQAQIQFGPHVESKHKPGFLELKEFLPKEYMKQRGAEKKIFQEHKNCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQES-YYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQ 438          

HSP 2 Score: 79.337 bits (194), Expect = 1.048e-13
Identity = 71/220 (32.27%), Postives = 107/220 (48.64%), Query Frame = 2
Query: 2342 SENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLR 3001
             E L+ AAR LA A S +L AV+P   E     R+ +L AA  +G+AS +L RQI  ++                   +D  F+D L+ L K+VANA A LV   K V+Q     D ++   R+I+  T   L+TSQLV C K+++PTI+   C  Q++     V  +++N              +  +S   +  LL  V  A + V  AL++L  H+R
Sbjct:  609 GEKLLGAARTLAGAVSDLLTAVQPSSGEP----RQTVLTAAGSIGQASGELLRQIGENE-------------------ADERFQDVLMNLAKAVANAAAMLVLKAKNVAQ--VTEDTVLQ-NRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCV------------HACHSATEDIELLKQVSAAASVVSQALNDLLQHVR 790          

HSP 3 Score: 53.1434 bits (126), Expect = 9.492e-6
Identity = 62/232 (26.72%), Postives = 103/232 (44.40%), Query Frame = 2
Query: 5648 ILSILESRNKNVKLIENEPTSDLANTMSGMITDDDTTILFASAGIKNCDLENYQDILSGKFLLNGEHKTVASFKNDAHCNVSNGFRNLVQKTAEALVLDTQTLVQNSGDKQKSLATNTESVILTISNLADECESGFVHETRKLSEAK--MMNAIQSVKSALNNTYSDRSAEFSRLIVSNSPSLVNHDSNNGNLEVTDIYSIEETILNIQNRLERFDDKIAHQINNSKNMETV 6337
            +LS L++ NK  +          ++ +SG+I D DTTI+FA+AG                  LN E+K   SF +          R  + KTA+ALV DT+ LV  +   Q+ LA   +S   TI+ LA+  + G         E +  ++NAI+ V  AL +          +   ++ PS+    S    + VT++ S+ +T+  +++   R    +   I + K   TV
Sbjct: 1926 VLSALQAGNKGTQACITA-----SSAVSGIIADLDTTIMFATAGT-----------------LNAENKE--SFAD---------HRENILKTAKALVEDTKLLVSGAASSQEKLAQAAQSSANTITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALGDLIEATKCAAGK--AADDPSMYQLKS-AAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIEHIKQELTV 2121          
BLAST of Talin vs. Ensembl Xenopus
Match: TLN2 (talin 2 [Source:NCBI gene;Acc:100144637])

HSP 1 Score: 372.474 bits (955), Expect = 7.519e-103
Identity = 188/438 (42.92%), Postives = 305/438 (69.63%), Query Frame = 2
Query:  161 LKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNT--KTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
            LKI +      K++  + ++ +Y  C  IR  + EA+     ++ D+GLFL  E  + G+WL+  + L  Y+L+ GD++EY+ ++R   IR  D   K +LVDDS +V EL++ +C+++GI N+EEYSL+++  + +     T T  K  +  +++ K++K+K KL T+D++NWL+ S+T R+Q +DE E LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS  +A +   +Q Q + G     K+K   + LKE +PK+Y+K +G EK+I + +        IEAK +Y  L RSL+TYG++FFLVKEK+KGK+KL+PRLLG+++D V+R+DEKTKE+++ WPLT+++RWA S  +FT+DFGEY  + YY+ QT +GEQISQLI+GY+DII+K ++S++    +G EES++ E  + P ++ I++ +
Sbjct:    6 LKICVRQCNVVKTMQFEPSTAVYDACRIIRERVSEAQ---SGQALDFGLFLSDEDPRKGIWLEAGRTLDYYMLRNGDVLEYKKKHRPQKIRMLDGAAKMILVDDSKTVGELLVTICSRIGITNYEEYSLIRET-MEEKKEEQTGTLKKDRTLLRDEKKMEKLKAKLHTEDELNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFGGIQAQIQFGPHVESKHKPGFLELKEFLPKEYMKQRGAEKKIFQEHKNCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQES-YYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQ 438          

HSP 2 Score: 74.3294 bits (181), Expect = 3.606e-12
Identity = 71/222 (31.98%), Postives = 107/222 (48.20%), Query Frame = 2
Query: 2342 SENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFE--DSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLR 3001
             E L+ AAR LA A S +L AV+P   E     R+ +L AA  +G+AS +L RQI  ++                   +D  F+  D L+ L K+VANA A LV   K V+Q     D ++   R+I+  T   L+TSQLV C K+++PTI+   C  Q++     V  +++N              +  +S   +  LL  V  A + V  AL++L  H+R
Sbjct:  609 GEKLLGAARTLAGAVSDLLTAVQPSSGEP----RQTVLTAAGSIGQASGELLRQIGENE-------------------ADERFQVFDVLMNLAKAVANAAAMLVLKAKNVAQ--VTEDTVLQ-NRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCV------------HACHSATEDIELLKQVSAAASVVSQALNDLLQHVR 792          

HSP 3 Score: 53.1434 bits (126), Expect = 9.913e-6
Identity = 62/232 (26.72%), Postives = 103/232 (44.40%), Query Frame = 2
Query: 5648 ILSILESRNKNVKLIENEPTSDLANTMSGMITDDDTTILFASAGIKNCDLENYQDILSGKFLLNGEHKTVASFKNDAHCNVSNGFRNLVQKTAEALVLDTQTLVQNSGDKQKSLATNTESVILTISNLADECESGFVHETRKLSEAK--MMNAIQSVKSALNNTYSDRSAEFSRLIVSNSPSLVNHDSNNGNLEVTDIYSIEETILNIQNRLERFDDKIAHQINNSKNMETV 6337
            +LS L++ NK  +          ++ +SG+I D DTTI+FA+AG                  LN E+K   SF +          R  + KTA+ALV DT+ LV  +   Q+ LA   +S   TI+ LA+  + G         E +  ++NAI+ V  AL +          +   ++ PS+    S    + VT++ S+ +T+  +++   R    +   I + K   TV
Sbjct: 1968 VLSALQAGNKGTQACITA-----SSAVSGIIADLDTTIMFATAGT-----------------LNAENKE--SFAD---------HRENILKTAKALVEDTKLLVSGAASSQEKLAQAAQSSANTITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALGDLIEATKCAAGK--AADDPSMYQLKS-AAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIEHIKQELTV 2163          
BLAST of Talin vs. Ensembl Xenopus
Match: TLN2 (talin 2 [Source:NCBI gene;Acc:100144637])

HSP 1 Score: 372.474 bits (955), Expect = 8.304e-103
Identity = 188/438 (42.92%), Postives = 305/438 (69.63%), Query Frame = 2
Query:  161 LKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNT--KTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
            LKI +      K++  + ++ +Y  C  IR  + EA+     ++ D+GLFL  E  + G+WL+  + L  Y+L+ GD++EY+ ++R   IR  D   K +LVDDS +V EL++ +C+++GI N+EEYSL+++  + +     T T  K  +  +++ K++K+K KL T+D++NWL+ S+T R+Q +DE E LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS  +A +   +Q Q + G     K+K   + LKE +PK+Y+K +G EK+I + +        IEAK +Y  L RSL+TYG++FFLVKEK+KGK+KL+PRLLG+++D V+R+DEKTKE+++ WPLT+++RWA S  +FT+DFGEY  + YY+ QT +GEQISQLI+GY+DII+K ++S++    +G EES++ E  + P ++ I++ +
Sbjct:   10 LKICVRQCNVVKTMQFEPSTAVYDACRIIRERVSEAQ---SGQALDFGLFLSDEDPRKGIWLEAGRTLDYYMLRNGDVLEYKKKHRPQKIRMLDGAAKMILVDDSKTVGELLVTICSRIGITNYEEYSLIRET-MEEKKEEQTGTLKKDRTLLRDEKKMEKLKAKLHTEDELNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFGGIQAQIQFGPHVESKHKPGFLELKEFLPKEYMKQRGAEKKIFQEHKNCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQES-YYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQ 442          

HSP 2 Score: 79.337 bits (194), Expect = 1.142e-13
Identity = 71/220 (32.27%), Postives = 107/220 (48.64%), Query Frame = 2
Query: 2342 SENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLR 3001
             E L+ AAR LA A S +L AV+P   E     R+ +L AA  +G+AS +L RQI  ++                   +D  F+D L+ L K+VANA A LV   K V+Q     D ++   R+I+  T   L+TSQLV C K+++PTI+   C  Q++     V  +++N              +  +S   +  LL  V  A + V  AL++L  H+R
Sbjct:  613 GEKLLGAARTLAGAVSDLLTAVQPSSGEP----RQTVLTAAGSIGQASGELLRQIGENE-------------------ADERFQDVLMNLAKAVANAAAMLVLKAKNVAQ--VTEDTVLQ-NRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCV------------HACHSATEDIELLKQVSAAASVVSQALNDLLQHVR 794          

HSP 3 Score: 53.1434 bits (126), Expect = 8.956e-6
Identity = 62/232 (26.72%), Postives = 103/232 (44.40%), Query Frame = 2
Query: 5648 ILSILESRNKNVKLIENEPTSDLANTMSGMITDDDTTILFASAGIKNCDLENYQDILSGKFLLNGEHKTVASFKNDAHCNVSNGFRNLVQKTAEALVLDTQTLVQNSGDKQKSLATNTESVILTISNLADECESGFVHETRKLSEAK--MMNAIQSVKSALNNTYSDRSAEFSRLIVSNSPSLVNHDSNNGNLEVTDIYSIEETILNIQNRLERFDDKIAHQINNSKNMETV 6337
            +LS L++ NK  +          ++ +SG+I D DTTI+FA+AG                  LN E+K   SF +          R  + KTA+ALV DT+ LV  +   Q+ LA   +S   TI+ LA+  + G         E +  ++NAI+ V  AL +          +   ++ PS+    S    + VT++ S+ +T+  +++   R    +   I + K   TV
Sbjct: 1945 VLSALQAGNKGTQACITA-----SSAVSGIIADLDTTIMFATAGT-----------------LNAENKE--SFAD---------HRENILKTAKALVEDTKLLVSGAASSQEKLAQAAQSSANTITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALGDLIEATKCAAGK--AADDPSMYQLKS-AAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIEHIKQELTV 2140          
BLAST of Talin vs. Ensembl Xenopus
Match: TLN2 (talin 2 [Source:NCBI gene;Acc:100144637])

HSP 1 Score: 371.703 bits (953), Expect = 1.044e-102
Identity = 188/438 (42.92%), Postives = 305/438 (69.63%), Query Frame = 2
Query:  161 LKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNT--KTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
            LKI +      K++  + ++ +Y  C  IR  + EA+     ++ D+GLFL  E  + G+WL+  + L  Y+L+ GD++EY+ ++R   IR  D   K +LVDDS +V EL++ +C+++GI N+EEYSL+++  + +     T T  K  +  +++ K++K+K KL T+D++NWL+ S+T R+Q +DE E LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS  +A +   +Q Q + G     K+K   + LKE +PK+Y+K +G EK+I + +        IEAK +Y  L RSL+TYG++FFLVKEK+KGK+KL+PRLLG+++D V+R+DEKTKE+++ WPLT+++RWA S  +FT+DFGEY  + YY+ QT +GEQISQLI+GY+DII+K ++S++    +G EES++ E  + P ++ I++ +
Sbjct:    6 LKICVRQCNVVKTMQFEPSTAVYDACRIIRERVSEAQ---SGQALDFGLFLSDEDPRKGIWLEAGRTLDYYMLRNGDVLEYKKKHRPQKIRMLDGAAKMILVDDSKTVGELLVTICSRIGITNYEEYSLIRET-MEEKKEEQTGTLKKDRTLLRDEKKMEKLKAKLHTEDELNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFGGIQAQIQFGPHVESKHKPGFLELKEFLPKEYMKQRGAEKKIFQEHKNCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQES-YYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQ 438          

HSP 2 Score: 79.7221 bits (195), Expect = 8.388e-14
Identity = 71/220 (32.27%), Postives = 107/220 (48.64%), Query Frame = 2
Query: 2342 SENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLR 3001
             E L+ AAR LA A S +L AV+P   E     R+ +L AA  +G+AS +L RQI  ++                   +D  F+D L+ L K+VANA A LV   K V+Q     D ++   R+I+  T   L+TSQLV C K+++PTI+   C  Q++     V  +++N              +  +S   +  LL  V  A + V  AL++L  H+R
Sbjct:  609 GEKLLGAARTLAGAVSDLLTAVQPSSGEP----RQTVLTAAGSIGQASGELLRQIGENE-------------------ADERFQDVLMNLAKAVANAAAMLVLKAKNVAQ--VTEDTVLQ-NRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCV------------HACHSATEDIELLKQVSAAASVVSQALNDLLQHVR 790          

HSP 3 Score: 53.1434 bits (126), Expect = 8.631e-6
Identity = 62/232 (26.72%), Postives = 103/232 (44.40%), Query Frame = 2
Query: 5648 ILSILESRNKNVKLIENEPTSDLANTMSGMITDDDTTILFASAGIKNCDLENYQDILSGKFLLNGEHKTVASFKNDAHCNVSNGFRNLVQKTAEALVLDTQTLVQNSGDKQKSLATNTESVILTISNLADECESGFVHETRKLSEAK--MMNAIQSVKSALNNTYSDRSAEFSRLIVSNSPSLVNHDSNNGNLEVTDIYSIEETILNIQNRLERFDDKIAHQINNSKNMETV 6337
            +LS L++ NK  +          ++ +SG+I D DTTI+FA+AG                  LN E+K   SF +          R  + KTA+ALV DT+ LV  +   Q+ LA   +S   TI+ LA+  + G         E +  ++NAI+ V  AL +          +   ++ PS+    S    + VT++ S+ +T+  +++   R    +   I + K   TV
Sbjct: 1877 VLSALQAGNKGTQACITA-----SSAVSGIIADLDTTIMFATAGT-----------------LNAENKE--SFAD---------HRENILKTAKALVEDTKLLVSGAASSQEKLAQAAQSSANTITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALGDLIEATKCAAGK--AADDPSMYQLKS-AAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIEHIKQELTV 2072          
BLAST of Talin vs. Ensembl Xenopus
Match: TLN2 (talin 2 [Source:NCBI gene;Acc:100144637])

HSP 1 Score: 371.703 bits (953), Expect = 1.095e-102
Identity = 188/438 (42.92%), Postives = 305/438 (69.63%), Query Frame = 2
Query:  161 LKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNT--KTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
            LKI +      K++  + ++ +Y  C  IR  + EA+     ++ D+GLFL  E  + G+WL+  + L  Y+L+ GD++EY+ ++R   IR  D   K +LVDDS +V EL++ +C+++GI N+EEYSL+++  + +     T T  K  +  +++ K++K+K KL T+D++NWL+ S+T R+Q +DE E LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS  +A +   +Q Q + G     K+K   + LKE +PK+Y+K +G EK+I + +        IEAK +Y  L RSL+TYG++FFLVKEK+KGK+KL+PRLLG+++D V+R+DEKTKE+++ WPLT+++RWA S  +FT+DFGEY  + YY+ QT +GEQISQLI+GY+DII+K ++S++    +G EES++ E  + P ++ I++ +
Sbjct:    6 LKICVRQCNVVKTMQFEPSTAVYDACRIIRERVSEAQ---SGQALDFGLFLSDEDPRKGIWLEAGRTLDYYMLRNGDVLEYKKKHRPQKIRMLDGAAKMILVDDSKTVGELLVTICSRIGITNYEEYSLIRET-MEEKKEEQTGTLKKDRTLLRDEKKMEKLKAKLHTEDELNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFGGIQAQIQFGPHVESKHKPGFLELKEFLPKEYMKQRGAEKKIFQEHKNCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQES-YYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQ 438          

HSP 2 Score: 79.7221 bits (195), Expect = 7.393e-14
Identity = 71/220 (32.27%), Postives = 106/220 (48.18%), Query Frame = 2
Query: 2342 SENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLR 3001
             E L+ AAR LA A S +L AV+P   E     R+ +L AA  +G+AS +L RQI  ++                   +D  F+D L+ L K+VANA A LV   K V+Q     D ++   R+I+  T   L+TSQLV C K+++PTI+   C  Q++     V  +++N                 +S   +  LL  V  A + V  AL++L  H+R
Sbjct:  609 GEKLLGAARTLAGAVSDLLTAVQPSSGEP----RQTVLTAAGSIGQASGELLRQIGENE-------------------ADERFQDVLMNLAKAVANAAAMLVLKAKNVAQ--VTEDTVLQ-NRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVHAC------------HSATEDIELLKQVSAAASVVSQALNDLLQHVR 790          

HSP 3 Score: 53.5286 bits (127), Expect = 6.845e-6
Identity = 62/232 (26.72%), Postives = 103/232 (44.40%), Query Frame = 2
Query: 5648 ILSILESRNKNVKLIENEPTSDLANTMSGMITDDDTTILFASAGIKNCDLENYQDILSGKFLLNGEHKTVASFKNDAHCNVSNGFRNLVQKTAEALVLDTQTLVQNSGDKQKSLATNTESVILTISNLADECESGFVHETRKLSEAK--MMNAIQSVKSALNNTYSDRSAEFSRLIVSNSPSLVNHDSNNGNLEVTDIYSIEETILNIQNRLERFDDKIAHQINNSKNMETV 6337
            +LS L++ NK  +          ++ +SG+I D DTTI+FA+AG                  LN E+K   SF +          R  + KTA+ALV DT+ LV  +   Q+ LA   +S   TI+ LA+  + G         E +  ++NAI+ V  AL +          +   ++ PS+    S    + VT++ S+ +T+  +++   R    +   I + K   TV
Sbjct: 1966 VLSALQAGNKGTQACITA-----SSAVSGIIADLDTTIMFATAGT-----------------LNAENKE--SFAD---------HRENILKTAKALVEDTKLLVSGAASSQEKLAQAAQSSANTITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALGDLIEATKCAAGK--AADDPSMYQLKS-AAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIEHIKQELTV 2161          
BLAST of Talin vs. Ensembl Mouse
Match: Tln2 (talin 2 [Source:MGI Symbol;Acc:MGI:1917799])

HSP 1 Score: 379.022 bits (972), Expect = 5.790e-105
Identity = 196/438 (44.75%), Postives = 307/438 (70.09%), Query Frame = 2
Query:  161 LKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNT--KTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
            LKI + H    K++  + ++ +Y  C  IR  + EA+  TG+ S DYGLFL  E  + G+WL+  + L  Y+L+ GD++EY+ + R   IR  D   KT++VDDS +V EL++ +C+++GI N+EEYSL+++  + +     T T  K  +  +++ K++K+K KL TDDD+NWL+ S+T R+Q +DE E LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS  +A +    Q Q + G     K+K   + LKE +PK+Y+K +G EKRI + +        IEAK +Y  L RSL+TYG++FFLVKEK+KGK+KL+PRLLG+++D V+R+DEKTKE+++ WPLT+++RWA S  +FT+DFGEY  + YY+ QT +GEQISQLI+GY+DII+K ++S++    +G EES++ E  + P ++ I++ +
Sbjct:    6 LKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQ--TGQAS-DYGLFLSDEDPRKGIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSRIGITNYEEYSLIQET-IEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQES-YYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQ 438          

HSP 2 Score: 82.0333 bits (201), Expect = 1.223e-14
Identity = 71/220 (32.27%), Postives = 106/220 (48.18%), Query Frame = 2
Query: 2342 SENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLR 3001
             E+L+ AAR LA A S +L AV+P   E     R+ +L AA  +G+AS  L RQI  ++                   +D  F+D L+ L K+VANA A LV   K V+Q   A D ++   R+I+  T   L+TSQLV C K+++PTI+   C  Q++     V  +++N         +++             LL  V  A + V  AL +L  H+R
Sbjct:  608 GEDLLRAARTLAGAVSDLLKAVQPTSGEP----RQTVLTAAGSIGQASGDLLRQIGENE-------------------TDERFQDVLMSLAKAVANAAAMLVLKAKNVAQ--VAEDTVLQ-NRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATSDSE------------LLKQVSAAASVVSQALHDLLQHVR 789          
BLAST of Talin vs. Ensembl Mouse
Match: Tln2 (talin 2 [Source:MGI Symbol;Acc:MGI:1917799])

HSP 1 Score: 379.022 bits (972), Expect = 5.790e-105
Identity = 196/438 (44.75%), Postives = 307/438 (70.09%), Query Frame = 2
Query:  161 LKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNT--KTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
            LKI + H    K++  + ++ +Y  C  IR  + EA+  TG+ S DYGLFL  E  + G+WL+  + L  Y+L+ GD++EY+ + R   IR  D   KT++VDDS +V EL++ +C+++GI N+EEYSL+++  + +     T T  K  +  +++ K++K+K KL TDDD+NWL+ S+T R+Q +DE E LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS  +A +    Q Q + G     K+K   + LKE +PK+Y+K +G EKRI + +        IEAK +Y  L RSL+TYG++FFLVKEK+KGK+KL+PRLLG+++D V+R+DEKTKE+++ WPLT+++RWA S  +FT+DFGEY  + YY+ QT +GEQISQLI+GY+DII+K ++S++    +G EES++ E  + P ++ I++ +
Sbjct:    6 LKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQ--TGQAS-DYGLFLSDEDPRKGIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSRIGITNYEEYSLIQET-IEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQES-YYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQ 438          

HSP 2 Score: 82.0333 bits (201), Expect = 1.223e-14
Identity = 71/220 (32.27%), Postives = 106/220 (48.18%), Query Frame = 2
Query: 2342 SENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLR 3001
             E+L+ AAR LA A S +L AV+P   E     R+ +L AA  +G+AS  L RQI  ++                   +D  F+D L+ L K+VANA A LV   K V+Q   A D ++   R+I+  T   L+TSQLV C K+++PTI+   C  Q++     V  +++N         +++             LL  V  A + V  AL +L  H+R
Sbjct:  608 GEDLLRAARTLAGAVSDLLKAVQPTSGEP----RQTVLTAAGSIGQASGDLLRQIGENE-------------------TDERFQDVLMSLAKAVANAAAMLVLKAKNVAQ--VAEDTVLQ-NRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATSDSE------------LLKQVSAAASVVSQALHDLLQHVR 789          
BLAST of Talin vs. Ensembl Mouse
Match: Tln2 (talin 2 [Source:MGI Symbol;Acc:MGI:1917799])

HSP 1 Score: 379.022 bits (972), Expect = 5.850e-105
Identity = 196/438 (44.75%), Postives = 307/438 (70.09%), Query Frame = 2
Query:  161 LKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNT--KTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
            LKI + H    K++  + ++ +Y  C  IR  + EA+  TG+ S DYGLFL  E  + G+WL+  + L  Y+L+ GD++EY+ + R   IR  D   KT++VDDS +V EL++ +C+++GI N+EEYSL+++  + +     T T  K  +  +++ K++K+K KL TDDD+NWL+ S+T R+Q +DE E LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS  +A +    Q Q + G     K+K   + LKE +PK+Y+K +G EKRI + +        IEAK +Y  L RSL+TYG++FFLVKEK+KGK+KL+PRLLG+++D V+R+DEKTKE+++ WPLT+++RWA S  +FT+DFGEY  + YY+ QT +GEQISQLI+GY+DII+K ++S++    +G EES++ E  + P ++ I++ +
Sbjct:    8 LKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQ--TGQAS-DYGLFLSDEDPRKGIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSRIGITNYEEYSLIQET-IEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQES-YYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQ 440          

HSP 2 Score: 82.0333 bits (201), Expect = 1.203e-14
Identity = 71/220 (32.27%), Postives = 106/220 (48.18%), Query Frame = 2
Query: 2342 SENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLR 3001
             E+L+ AAR LA A S +L AV+P   E     R+ +L AA  +G+AS  L RQI  ++                   +D  F+D L+ L K+VANA A LV   K V+Q   A D ++   R+I+  T   L+TSQLV C K+++PTI+   C  Q++     V  +++N         +++             LL  V  A + V  AL +L  H+R
Sbjct:  610 GEDLLRAARTLAGAVSDLLKAVQPTSGEP----RQTVLTAAGSIGQASGDLLRQIGENE-------------------TDERFQDVLMSLAKAVANAAAMLVLKAKNVAQ--VAEDTVLQ-NRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATSDSE------------LLKQVSAAASVVSQALHDLLQHVR 791          
BLAST of Talin vs. Ensembl Mouse
Match: Tln1 (talin 1 [Source:MGI Symbol;Acc:MGI:1099832])

HSP 1 Score: 358.992 bits (920), Expect = 8.003e-99
Identity = 193/441 (43.76%), Postives = 305/441 (69.16%), Query Frame = 2
Query:  155 IVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPET-GRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNT--KTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
            + L + I      K++  + ++ +Y  C     MIRE  PE       D+GLFL  +  K G+WL+  K L  Y+L+ GD +EYR + R L IR  D   KT++VDDS +V+++++ +CA++GI NH+EYSL+++  + +     T T  K  +  +++ K++K+K+KL TDD++NWL+  +TLR+Q ++E E LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS  +A + A  QCQ + G    QK+K   + LK+ +PK+YVK KG E++I + +        IEAK  Y  L RSLKTYG++FFLVKEK+KGK+KL+PRLLG++++ V+R+DEKTKE+I+ W LT+I+RWA S  +FT+DFG+Y  + YY+ QT +GEQI+QLI+GY+DII+K +KS++    +G EES++ E  + P ++ +++ +
Sbjct:    2 VALSLKISIGNVVKTMQFEPSTMVYDACR----MIRERIPEALAGPPNDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRE-LMEEKKDEGTGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKG-ERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQ-DGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVLQQQ 435          

HSP 2 Score: 72.4034 bits (176), Expect = 1.091e-11
Identity = 81/248 (32.66%), Postives = 118/248 (47.58%), Query Frame = 2
Query: 2351 LIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQ-RLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLRCGITVVNFAPRI-QSLELFLTEYDRLKNIF 3088
            L+ AA+ LA A S +L + +P   E     R+ +L AA  VG+AS +L +QI  SD                   +D  F+D L+ L K+VA+A A LV   K+V+Q    S    G Q ++I+  T   L+TSQLV C K++APTI+   C  Q L E   +      VA    G ++ ++   +     +  LL  V  A T V  AL+ L  H++   T    A R  Q+ +  LT  +   NIF
Sbjct:  608 LLQAAKGLAGAVSELLRSAQPASAEP----RQNLLQAAGNVGQASGELLQQIGESD-------------------TDPHFQDVLMQLAKAVASAAAALVLKAKSVAQRTEDS----GLQTQVIAAATQCALSTSQLVACTKVVAPTISSPVCQEQ-LVEAGRL------VAKAVEGCVSASQAATE-----DGQLLRGVGAAATAVTQALNELLQHVKAHATGAGPAGRYDQATDTILTVTE---NIF 813          

HSP 3 Score: 62.3882 bits (150), Expect = 1.141e-8
Identity = 59/217 (27.19%), Postives = 101/217 (46.54%), Query Frame = 2
Query: 5630 STIAQHILSILESRNKNVKLIENEPTSDLANTMSGMITDDDTTILFASAGIKNCD-LENYQDILSGKFLLNGEHKTVASFKNDAHCNVSNGFRNLVQKTAEALVLDTQTLVQNSGDKQKSLATNTESVILTISNLADECESGFVHETRKLSEAK--MMNAIQSVKSALNNTYSDRSAEFSRLIVSNSPSLVNHDSNNGNLEVTDIYSIEETILNIQN 6271
            S    H+L+ L++ N+       +     A+ +SG+I D DTTI+FA+AG  N +  E + D                              R  + KTA+ LV DT+ LVQN+   Q+ LA   +S + TI+ LAD  + G      +  E +  ++NA++ V  AL +  S   A   +  V + P+ V    N+  + VT++ S+ +T+  +++
Sbjct: 1958 SEKVSHVLAALQAGNRGT-----QACITAASAVSGIIADLDTTIMFATAGTLNREGAETFAD-----------------------------HREGILKTAKVLVEDTKVLVQNAAGSQEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKAAAGK--VGDDPA-VWQLKNSAKVMVTNVTSLLKTVKAVED 2137          
BLAST of Talin vs. Ensembl Mouse
Match: Tln1 (talin 1 [Source:MGI Symbol;Acc:MGI:1099832])

HSP 1 Score: 167.933 bits (424), Expect = 4.668e-46
Identity = 95/235 (40.43%), Postives = 157/235 (66.81%), Query Frame = 2
Query:  155 IVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPET-GRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNT--KTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVS 850
            + L + I      K++  + ++ +Y  C     MIRE  PE       D+GLFL  +  K G+WL+  K L  Y+L+ GD +EYR + R L IR  D   KT++VDDS +V+++++ +CA++GI NH+EYSL+++  + +     T T  K  +  +++ K++K+K+KL TDD++NWL+  +TLR+Q ++E E LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS
Sbjct:    2 VALSLKISIGNVVKTMQFEPSTMVYDACR----MIRERIPEALAGPPNDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRE-LMEEKKDEGTGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVS 231          
BLAST of Talin vs. UniProt/SwissProt
Match: sp|Q9Y4G6|TLN2_HUMAN (Talin-2 OS=Homo sapiens OX=9606 GN=TLN2 PE=1 SV=4)

HSP 1 Score: 379.022 bits (972), Expect = 3.982e-104
Identity = 196/438 (44.75%), Postives = 307/438 (70.09%), Query Frame = 2
Query:  161 LKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNT--KTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
            LKI + H    K++  + ++ +Y  C  IR  + EA+  TG+ S DYGLFL  E  + G+WL+  + L  Y+L+ GD++EY+ + R   IR  D   KT++VDDS +V EL++ +C+++GI N+EEYSL+++  + +     T T  K  +  +++ K++K+K KL TDDD+NWL+ S+T R+Q +DE E LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS  +A +    Q Q + G     K+K   + LKE +PK+Y+K +G EKRI + +        IEAK +Y  L RSL+TYG++FFLVKEK+KGK+KL+PRLLG+++D V+R+DEKTKE+++ WPLT+++RWA S  +FT+DFGEY  + YY+ QT +GEQISQLI+GY+DII+K ++S++    +G EES++ E  + P ++ I++ +
Sbjct:    6 LKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQ--TGQAS-DYGLFLSDEDPRKGIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSRIGITNYEEYSLIQET-IEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQES-YYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQ 438          

HSP 2 Score: 81.6481 bits (200), Expect = 1.187e-13
Identity = 71/220 (32.27%), Postives = 105/220 (47.73%), Query Frame = 2
Query: 2342 SENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLR 3001
             E+L+ AAR LA A S +L AV+P   E     R+ +L AA  +G+AS  L RQI  ++                   +D  F+D L+ L K+VANA A LV   K V+Q   A D ++   R+I+  T   L+TSQLV C K+++PTI+   C  Q++     V  +++N          ++             LL  V  A + V  AL +L  H+R
Sbjct:  608 GEDLLRAARTLAGAVSDLLKAVQPTSGEP----RQTVLTAAGSIGQASGDLLRQIGENE-------------------TDERFQDVLMSLAKAVANAAAMLVLKAKNVAQ--VAEDTVLQ-NRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATTDSE------------LLKQVSAAASVVSQALHDLLQHVR 789          
BLAST of Talin vs. UniProt/SwissProt
Match: sp|Q71LX4|TLN2_MOUSE (Talin-2 OS=Mus musculus OX=10090 GN=Tln2 PE=1 SV=3)

HSP 1 Score: 375.555 bits (963), Expect = 3.451e-103
Identity = 195/431 (45.24%), Postives = 301/431 (69.84%), Query Frame = 2
Query:  161 LKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNT--KTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQ 1447
            LKI + H    K++  + ++ +Y  C  IR  + EA+  TG+ S DYGLFL  E  + G+WL+  + L  Y+L+ GD++EY+ + R   IR  D   KT++VDDS +V EL++ +C+++GI N+EEYSL+++  + +     T T  K  +  +++ K++K+K KL TDDD+NWL+ S+T R+Q +DE E LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS  +A +    Q Q + G     K+K   + LKE +PK+Y+K +G EKRI + +        IEAK +Y  L RSL+TYG++FFLVKEK+KGK+KL+PRLLG+++D V+R+DEKTKE+++ WPLT+++RWA S  +FT+DFGEY    YY+ QT +GEQISQLI+GY+DII+K ++S++    +G EES++ E  + P +
Sbjct:    6 LKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQ--TGQAS-DYGLFLSDEDPRKGIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSRIGITNYEEYSLIQET-IEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEY-QESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKK 431          

HSP 2 Score: 82.0333 bits (201), Expect = 9.280e-14
Identity = 71/220 (32.27%), Postives = 106/220 (48.18%), Query Frame = 2
Query: 2342 SENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLR 3001
             E+L+ AAR LA A S +L AV+P   E     R+ +L AA  +G+AS  L RQI  ++                   +D  F+D L+ L K+VANA A LV   K V+Q   A D ++   R+I+  T   L+TSQLV C K+++PTI+   C  Q++     V  +++N         +++             LL  V  A + V  AL +L  H+R
Sbjct:  609 GEDLLRAARTLAGAVSDLLKAVQPTSGEP----RQTVLTAAGSIGQASGDLLRQIGENE-------------------TDERFQDVLMSLAKAVANAAAMLVLKAKNVAQ--VAEDTVLQ-NRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATSDSE------------LLKQVSAAASVVSQALHDLLQHVR 790          
BLAST of Talin vs. UniProt/SwissProt
Match: sp|Q9Y490|TLN1_HUMAN (Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3)

HSP 1 Score: 360.147 bits (923), Expect = 2.111e-98
Identity = 194/440 (44.09%), Postives = 307/440 (69.77%), Query Frame = 2
Query:  155 IVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNT--KTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
            + L + I      K++  + ++ +Y  C  IR  I EA    G  S D+GLFL  +  K G+WL+  K L  Y+L+ GD +EYR + R L IR  D   KT++VDDS +V+++++ +CA++GI NH+EYSL+++  + +    +T T  K  +  +++ K++K+K+KL TDD++NWL+  +TLR+Q ++E E LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS  +A + A  QCQ + G    QK+K   + LK+ +PK+YVK KG E++I + +        IEAK  Y  L RSLKTYG++FFLVKEK+KGK+KL+PRLLG++++ V+R+DEKTKE+I+ W LT+I+RWA S  +FT+DFG+Y  + YY+ QT +GEQI+QLI+GY+DII+K +KS++    +G EES++ E  + P ++ +++ +
Sbjct:    2 VALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEAP--AGPPS-DFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRE-LMEEKKEEITGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKG-ERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWAASPKSFTLDFGDYQ-DGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVLQQQ 435          

HSP 2 Score: 73.559 bits (179), Expect = 2.882e-11
Identity = 80/248 (32.26%), Postives = 120/248 (48.39%), Query Frame = 2
Query: 2351 LIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQ-RLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLRCGITVVNFAPRI-QSLELFLTEYDRLKNIF 3088
            L+ AA+ LA A S +L + +P   E     R+ +L AA  VG+AS +L +QI  SD                   +D  F+D+L+ L K+VA+A A LV   K+V+Q    S    G Q ++I+  T   L+TSQLV C K++APTI+   C  Q++ E   +      VA    G ++ ++   +     +  LL  V  A T V  AL+ L  H++   T    A R  Q+ +  LT  +   NIF
Sbjct:  608 LLQAAKGLAGAVSELLRSAQPASAEP----RQNLLQAAGNVGQASGELLQQIGESD-------------------TDPHFQDALMQLAKAVASAAAALVLKAKSVAQRTEDS----GLQTQVIAAATQCALSTSQLVACTKVVAPTISSPVCQEQLV-EAGRL------VAKAVEGCVSASQAATE-----DGQLLRGVGAAATAVTQALNELLQHVKAHATGAGPAGRYDQATDTILTVTE---NIF 813          
BLAST of Talin vs. UniProt/SwissProt
Match: sp|P26039|TLN1_MOUSE (Talin-1 OS=Mus musculus OX=10090 GN=Tln1 PE=1 SV=2)

HSP 1 Score: 358.992 bits (920), Expect = 5.598e-98
Identity = 193/441 (43.76%), Postives = 305/441 (69.16%), Query Frame = 2
Query:  155 IVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPET-GRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNT--KTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
            + L + I      K++  + ++ +Y  C     MIRE  PE       D+GLFL  +  K G+WL+  K L  Y+L+ GD +EYR + R L IR  D   KT++VDDS +V+++++ +CA++GI NH+EYSL+++  + +     T T  K  +  +++ K++K+K+KL TDD++NWL+  +TLR+Q ++E E LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS  +A + A  QCQ + G    QK+K   + LK+ +PK+YVK KG E++I + +        IEAK  Y  L RSLKTYG++FFLVKEK+KGK+KL+PRLLG++++ V+R+DEKTKE+I+ W LT+I+RWA S  +FT+DFG+Y  + YY+ QT +GEQI+QLI+GY+DII+K +KS++    +G EES++ E  + P ++ +++ +
Sbjct:    2 VALSLKISIGNVVKTMQFEPSTMVYDACR----MIRERIPEALAGPPNDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRE-LMEEKKDEGTGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKG-ERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQ-DGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVLQQQ 435          

HSP 2 Score: 72.4034 bits (176), Expect = 7.633e-11
Identity = 81/248 (32.66%), Postives = 118/248 (47.58%), Query Frame = 2
Query: 2351 LIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQ-RLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLRCGITVVNFAPRI-QSLELFLTEYDRLKNIF 3088
            L+ AA+ LA A S +L + +P   E     R+ +L AA  VG+AS +L +QI  SD                   +D  F+D L+ L K+VA+A A LV   K+V+Q    S    G Q ++I+  T   L+TSQLV C K++APTI+   C  Q L E   +      VA    G ++ ++   +     +  LL  V  A T V  AL+ L  H++   T    A R  Q+ +  LT  +   NIF
Sbjct:  608 LLQAAKGLAGAVSELLRSAQPASAEP----RQNLLQAAGNVGQASGELLQQIGESD-------------------TDPHFQDVLMQLAKAVASAAAALVLKAKSVAQRTEDS----GLQTQVIAAATQCALSTSQLVACTKVVAPTISSPVCQEQ-LVEAGRL------VAKAVEGCVSASQAATE-----DGQLLRGVGAAATAVTQALNELLQHVKAHATGAGPAGRYDQATDTILTVTE---NIF 813          
BLAST of Talin vs. UniProt/SwissProt
Match: sp|P54939|TLN1_CHICK (Talin-1 OS=Gallus gallus OX=9031 GN=TLN1 PE=1 SV=2)

HSP 1 Score: 358.221 bits (918), Expect = 8.850e-98
Identity = 193/441 (43.76%), Postives = 305/441 (69.16%), Query Frame = 2
Query:  155 IVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETG-RESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNT--KTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
            + L + I      K++  + ++ +Y  C     MIRE  PE    +  D+GLFL  E  K G+WL+  K L  Y+L+ GD +EY+ + R L IR  D   KT++VDDS +V++++  +CA++GI N++EYSL+++  + +    VT T  K  +  +++ K++K+K+KL TDD++NWL+  +TLR+Q ID+ E LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS  +A + A  QCQ + G    QK+K   + LK+ +PK+Y+K KG E++I   +        IEAK  Y  L RSLKTYG++FFLVKEK+KGK+KL+PRLLG++++ V+R+DEKTKE+I+ W LT+I+RWA S  +FT+DFG+Y  + YY+ QT +GEQI+QLI+GY+DII+K +KS++    +G EES++ E  + P ++ +++ +
Sbjct:    2 VALSLKISIGNVVKTMQFEPSTMVYDACR----MIRERVPEAQMGQPNDFGLFLSDEDPKKGIWLEAGKALDYYMLRNGDTMEYKKKQRPLKIRMLDGTVKTVMVDDSKTVTDMLTTICARIGITNYDEYSLVREI-MEEKKEEVTGTLKKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGIDDNETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPGFLELKDFLPKEYIKQKG-ERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQ-DGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVLQQQ 435          

HSP 2 Score: 64.6994 bits (156), Expect = 1.717e-8
Identity = 68/217 (31.34%), Postives = 105/217 (48.39%), Query Frame = 2
Query: 2351 LIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLR 3001
            L+ AA+ LA A S +L   +P   E     R+ +L AA  VG+ S +L +QI  SD                   +D  F+D L+ L K+VA+A A LV   K V+Q    S +     ++I+  T   L+TSQLV C K++APTI+   C  Q++ E  ++      VA    G +  ++   +     ++ LL  V  A T V  AL++L  H++
Sbjct:  608 LLQAAKNLASAVSDLLKTAQPASAEP----RQNLLQAAGLVGQTSGELLQQIGESD-------------------TDPRFQDMLMQLAKAVASAAAALVLKAKNVAQKTEDSALQT---QVIAAATQCALSTSQLVACTKVVAPTISSPVCQEQLI-EAGKL------VAKSAEGCVEASKAATN-----DDQLLKQVGVAATAVTQALNDLLQHIK 786          
BLAST of Talin vs. TrEMBL
Match: A0A504YNR7 (Talin OS=Fasciola gigantica OX=46835 GN=FGIG_00042 PE=4 SV=1)

HSP 1 Score: 621.313 bits (1601), Expect = 1.694e-177
Identity = 443/1283 (34.53%), Postives = 682/1283 (53.16%), Query Frame = 2
Query:  152 TIVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNTKTSSNXXX----XXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHRSSFQMKSLEDISREIQIAITTPTEDFSQIASVFDSSQVDVTCITSMPQSSEDQTNRSDNCDFDNINLIDTANRKIDNEFDRTQMIGKGLEDRELDSAMSFGTSRGVHNFYSNSRNTMNSPDAIRMLNHSPDSFMTGGTRICHTVRRLNVTQQSLLQNINVNLDKLQTSKLLLNXXXXXXXXXXXXXXXXXXHIQV-----ISKEHAIHNLGSMNTEVVQVLRSSKHAPL-----TAVAVDNLKENNNQHLKDIEKSFKIITVHFPSFIDNVRMXXXXXXXXXXXXXXXXXXXXXXXFSEEKSENLIDAARKLADAFSGMLNAVKP--QEEERDI----------------------------DFRKAILDAANKVGEASSQLFRQI-TFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANN---LLLTHVEGALTNVRHALDNLEDHLRCGITVVNFAPRIQSLELFLTEYDRLKNIFILNLSNKRSNKPDDLLESLSNFLIISGKINEEILF---LCDQEQNQEDPLMESQKIFAAIIVKILAINKRWSSDFPDLL--KDLYYEVDNLVLSLLYQPGTRIISHDQLIHNLYRSAQTLITCSHKLI-----------TSYHQVLLNDELSPECAEVIERSEHILVIMNSLKFYPTDDKILTAFIRDSEKLAQSCVTFCRNIHNTIPNTSXXXXXXXXXXXXSQTLAECEHMEQTIKCVKPIKAHLEL-AAVAKM 3805
            ++ L++H   +G TK++  D    +   CEHIR  +RE++   G  +KD+GLFLPHE +K GLWLDN + L  YIL+ GD +EYRYRYRWL IR+ D  +K L VDDS SV+ELM+++C KMGI NHEEYSL++++  ND  R+ T  +  +        Q+K++K+K+KL TDDD++WLNPSQ+LRQQ IDE+EVLL++R+YFFSDMN+D RDP+QL+LL++Q K+AI+ G HPVS+ EA +LAA+QCQ + GD   +K K   + LK+ +PK+Y K + +EK+I + ++ + G   ++AK EYC  CRSLKTYGITFFLVKE+IKGK+KLIPRLLGV++D+V+RLDE+TKE++KTWPLTSI RWA S +AFTMDFGEY+P++ YTAQT++GEQISQLI+GYVDII K QK+++     G EES++ E  +   +A IV+H+                     PT        + +         T+ P  S D          D+I +  +A  +I N + +  +IG G+    +    S  TS GV            SPD          +FM GGT I H  + +   Q++LL  IN +++ LQ +K  L      E +      +E     +      S+      +G+MN  V Q LRS+  A        A A      +    L  +++SF+++T+HFP+F+D+V+ ++ +         +        + +EE ++NL+ AAR +ADAF+ +L + +P      R++                              RKAI++AA++VGEAS+ L R +   S   V+ S+     L       +R ++D L+ L K+VANATA LV   K ++   +        QR+I+  T  GL TSQLV C K+LAPTI+Q +C  Q+     EV   +D V   +  +        D  PQ  +   + +T  E A T VR ALD L  HL   +     A    +L+ F   Y+        NL    +     L+ S       + ++  +I     L   + +++  L  + K  A     ++ + K  S++  D++   +L    +NL + + Y     ++ H +LI +L  +A+  +T + +L+            + +QV+ +   +     +I R+  I+ I  S +  P D       I   E+  Q C    R+  +  P  SD  +   +  + +Q ++  E +   +  + P+  HL++  A+A++
Sbjct:   16 SLALRVHFPKSGVTKTMVFDAQMTVGQACEHIRAQMRESDQTDG--TKDHGLFLPHEDNKKGLWLDNARTLEHYILRNGDTVEYRYRYRWLYIRTMDGTRKKLCVDDSKSVAELMLMICTKMGIYNHEEYSLVREHDENDRDRSSTLRRQGTGMVTIGRDQEKMEKLKRKLHTDDDMDWLNPSQSLRQQGIDEREVLLLKRRYFFSDMNVDARDPVQLNLLYVQLKDAILKGTHPVSLEEAIRLAAIQCQVQFGDYVPEKFKPNFLDLKDFLPKEYAKLRSLEKKIFQQHAEMIGLSEVDAKFEYCQFCRSLKTYGITFFLVKERIKGKNKLIPRLLGVTKDKVIRLDERTKEVLKTWPLTSISRWAASLHAFTMDFGEYSPDDCYTAQTSEGEQISQLIAGYVDIITKKQKAKDHAGFQGDEESAMYEENVRAERATIVQHQR------------------MPPTRGPRAKEGLLNG--------TAEPLISRDMD--------DSIQM--SAVHRI-NGWSQQHIIGDGMS--TVVDGQSIATS-GVQP------PRQMSPD----------NFMIGGTHIFH-YQEMTPAQRALLVTINEDVETLQAAKEQLQIGPAGERVLLGVGSDETSRRWLSESLGASQAKVTDEMGAMNAAVAQALRSANRAEAYDGIPPAQAGLGASSDPGDDLMMMQQSFRVVTIHFPAFVDDVKRVAVLRREAGAIRADQTGEPTVAEQTEESTQNLLSAARYVADAFTDLLESARPLASGHTREVMDGTDDTATGSHAVITTTTTTTGGPVSSSSRKAIIEAASRVGEASNDLLRHVMNESGDDVLESTTHLQLLT----EEERLYQDHLLSLAKAVANATAGLVVKAKNLATQPNLDPE--AQQRVIAAATQTGLCTSQLVACTKVLAPTIHQPSCQQQLSEAAREVSWAVDGVVQASRAV---GLTLADQPPQIQHSVQMAVTDTETAATEVRDALDALNAHL---LKASAKAYSGDALDNFQLAYE--------NLQQNHAGGGQRLVASARRLAQATAQMIADIKAQAELSGDDPDRQSRLFAAAKQLADATTNLIEVAKVCSANPDDIMLQNELREAAENLNV-IAYSAAAELL-HTRLIRSLQAAARATVTGATQLVNVSQVAGKRSRGNTYQVISD---AKAVNGMIPRT--IISIRES-RANPDDPMTQMELIGACERFVQPCEALIRSSRSIAPTVSDPTVQAALDNSTAQLVSAVETLRACLGRLAPLSRHLQIDGALARL 1211          
BLAST of Talin vs. TrEMBL
Match: A0A564YWH5 (FERM domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS10242 PE=4 SV=1)

HSP 1 Score: 582.793 bits (1501), Expect = 4.813e-165
Identity = 447/1313 (34.04%), Postives = 695/1313 (52.93%), Query Frame = 2
Query:  155 IVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRE-SKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNTKTSSNXXXXXXXXXXXXXXXXXXXIN------WLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHRSSFQMKSLEDISREIQ-IAITTPTEDFSQIASVFDSSQVDVTCITSMPQSSEDQTNRSDNCDFDNINLIDTANRKIDNEFDRTQMIGKGLEDRELDSAMSFGTSRGVHNFYSNSRNTMNSPDA-IRMLNHSPDSFMTGGTR--ICHTVRRLNVTQQSLLQNINVNLDKLQ-----------TSKLLLNXXXXXXXXXXXXXXXXXXHIQVISKEHAIHNLGSMNTEVVQVLRSSKHAPLTAVAVD----NLKE--NNNQHLKDIEKSFKIITVHFPSFIDNVR----MXXXXXXXXXXXXXXXXXXXXXXXFSEEKSENLIDAARKLADAFSGMLNAVKP---QEEERDIDF---------------RKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVS-QNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQI--LAEINEVRCTIDNVAAVTSGIINNNRGNM-DNSPQANNLLLTHVEGALTNVRHALDNLEDHLRCGITVVNFAP-RIQSLELFLTEYDRLK---NIFILNLSNKRSNKPDDLLESLSNFLIISGKINEEILFLCDQEQNQEDPLMESQKIFAAIIVKILA------INK----RWSSDFPDLLKDLYYEVDNLVLSLLYQPGTRIISHDQLIHNLYRSAQTLITCSHKLITS------------YHQVLLNDELSPECAEVIERSEHILVIMNSLKFYPTDDKILTAFIRDSEKLAQSCVTFCRNIHNTIPNTSXXXXXXXXXXXXSQTLAECEHMEQTIKCVKPIKAHLEL-AAVAKMLTEHR----LENLHK 3838
            + L+IH+  A  TK++  D    +   C+ IR  IRE +   G + SKDYGLFLPHE +K GLWLDN ++L  YIL+ GD +EY+YR+RWL IR+ D  +KTL VDDS +++ELM+ +C KMGI N+EEY L++D +  +  R++T  +   +      L    K  +   +++      WLNP+Q+LRQQ +DE+EVLL++R+YFFSDMN+D RDP+QL+LL++Q K+AI+NG HPV++ EA  LAALQCQ ELG+ +  K +   + LK+ +PK+++K K +EK+I + +++L G  +IEA+ +YC  CRSLKTYGITFFLVKEK+KGK++L+PRLLG+++D V+RLDE+TKE++K WPLTSI +WA S NAFTMDFGEY+P+EYYTAQT +GEQISQLI+GY+DII+K QK+++ Q   G EES++ E  +   +A+ V++    + +S+    RE + +A+    E       V    Q   T I  +   +  Q   +D+   + +  I T+ R+                                    + S  T++S  A +R  + S D F TGGT+  IC T   +   Q++L   I  N++ LQ           T ++L+N   D+       +      ++V  +      +G+MN  V Q +RS+  A     +V      + E  +    L  +++SF+++TVHFP+F+DNV+    +  +      +D  + +      D SE  ++NL+ AAR +AD+F+ +L A  P   ++ E D+D                RKAIL+AAN+VGEAS+   R +   D  V       +    + +  +R ++D L+ L K VAN+TA LV   K ++ Q     D     Q ++   T  GL TSQLV C K+LAPTI+QA+C  Q+   A        +    A +SG   ++R ++ D   Q  N  +  VE A   VR +LD L  HL  G    +  P +  +L+LF   YD L+   +   L  + +R       L  ++  +I   K+  E L        + DP  ++ ++FAA   K LA      IN+        D P    DL +  D+LV+ + Y     +++  ++I +L  +A+ +++ S+ LIT+            YH  ++ DE +     V +    ++  +  ++  P D       I   E   Q C    R+    +P  SD  + + +  + SQ +   E ++  +    PI   L++  A+A +L   R    LE L K
Sbjct:    8 LALRIHVPDAEVTKALVFDALMTVGQACDQIRHQIREID---GLDNSKDYGLFLPHEDNKKGLWLDNSRSLEHYILRNGDTLEYKYRFRWLYIRTMDGTRKTLRVDDSKTLAELMLPICTKMGIYNYEEYLLVRDTEEAEKERSLTLKRAHQSGGLVGTLRDADKMEKLRKELHTDDEVIWLNPAQSLRQQGVDEKEVLLLRRRYFFSDMNVDARDPVQLNLLYVQLKDAILNGTHPVTLEEAVTLAALQCQVELGNYSPAKFRPGYLDLKDYLPKEFLKIKNVEKKIFQQHASLNGLTDIEARVKYCHFCRSLKTYGITFFLVKEKMKGKNRLVPRLLGITKDSVVRLDERTKEVVKVWPLTSILKWAASPNAFTMDFGEYSPDEYYTAQTAEGEQISQLIAGYIDIILKKQKARDHQGLQGDEESAMYEENVRAERAKFVQN----ERRSVGPADRERERLALEETIE-------VQRRLQHQATPIPPLLNGASQQVAVNDD---NMVGYIGTSERRY---------------------------------IQAGSIPTLSSETARMRSNDDSTDDFCTGGTQYYICKT---MTPAQRALHVTIEENINALQEGKQRLEIGPPTERVLVNLGHDEASRRWLNESMGATEVRVADE------MGAMNAAVAQAVRSANRADAAVGSVGPTTYGVAEVTDPADDLMRMQQSFRVVTVHFPAFVDNVKRVAVLRRESGLLRAEDEPDERVRHGIADESEANAQNLLGAARTVADSFTELLKAATPLTTRQTEYDLDTVNYVTEQGTQAPGSSRKAILEAANRVGEASNDFLRYV-MQDSEV-------TEGEIVPEEDERVYQDKLLELAKEVANSTAVLVVKAKNLATQTNLDPD---HQQMVVMSATQTGLCTSQLVACTKVLAPTIHQASCQQQLSESARDVSSAVDVVVRTARSSGQAAHDRMDLSDADVQEVNAAVVEVEDAAAEVRTSLDRLNAHLLRG----SARPYQGDTLDLFQQAYDALQQETDGVRLVAAARR-------LSQVTAQMITDLKVQAETL--------EGDPERQT-RLFAA--AKQLADSTTDLINQAKVCSGDPDSPVRQADLKHSADDLVV-VAYASAAELLNA-RVIRSLQAAARAVVSASNNLITTSRVASSKSRSNNYH--MMTDERA-----VNDLLPKMVSAIRFIRRDPEDPLAQLELICTCEHAVQPCSYLARSCRQMVPTISDAALQNALDGSTSQMVVAVETLKACLARASPIARQLQMDGALAILLRTVREAEELEKLAK 1219          
BLAST of Talin vs. TrEMBL
Match: A0A4E0S2C9 (Talin OS=Fasciola hepatica OX=6192 GN=D915_001787 PE=4 SV=1)

HSP 1 Score: 492.271 bits (1266), Expect = 1.887e-136
Identity = 245/443 (55.30%), Postives = 337/443 (76.07%), Query Frame = 2
Query:  152 TIVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNTKTSSNXXX----XXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
            ++ L++H   +G TK++  D    +   CEHIR  +RE++   G  +KD+GLFLPHE +K GLWLDN + L  YIL+ GD +EYRYRYRWL IR+ D  +K L VDDS SV+ELM+++C KMGI NHEEYSL++++  ND  R+ T  +  +        Q+K++K+K+KL TDDD++WLNPSQ+LRQQ IDE+EVLL++R+YFFSDMN+D RDP+QL+LL++Q K+AI+ G HPVS+ EA +LAA+QCQ + GD   +K K   + LK+ +PK+Y K + +EK+I + ++ + G   ++AK EYC  CRSLKTYGITFFLVKE+IKGK+KLIPRLLGV++D+V+RLDE+TKE++KTWPLTSI RWA S +AFTMDFGEY+P++ YTAQT++GEQISQLI+GYVDII K QK+++     G EES++ E  +   +A IV+H+
Sbjct:   51 SLALRVHFPKSGVTKTMVFDAQMTVGQACEHIRAQMRESDQTDG--TKDHGLFLPHEDNKKGLWLDNARTLEHYILRNGDTVEYRYRYRWLYIRTMDGTRKKLCVDDSKSVAELMLMICTKMGIYNHEEYSLVREHDENDRDRSSTLRRQGTGMVTIGRDQEKMEKLKRKLHTDDDMDWLNPSQSLRQQGIDEREVLLLKRRYFFSDMNVDARDPVQLNLLYVQLKDAILKGTHPVSLEEAIRLAAIQCQVQFGDYVPEKFKPNFLDLKDFLPKEYAKLRSLEKKIFQQHAEMIGLSEVDAKFEYCQFCRSLKTYGITFFLVKERIKGKNKLIPRLLGVTKDKVIRLDERTKEVLKTWPLTSISRWAASLHAFTMDFGEYSPDDCYTAQTSEGEQISQLIAGYVDIITKKQKAKDHAGFQGDEESAMYEENVRAERATIVQHQ 491          

HSP 2 Score: 167.162 bits (422), Expect = 4.295e-37
Identity = 175/708 (24.72%), Postives = 311/708 (43.93%), Query Frame = 2
Query: 1853 SPDSFMTGGTRICHTVRRLNVTQQSLLQNINVNLDKLQTSKLLLNXXXXXXXXXXXXXXXXXXHIQV-----ISKEHAIHNLGSMNTEVVQVLRSSKHAPL-----TAVAVDNLKENNNQHLKDIEKSFKIITVHFPSFIDNVRMXXXXXXXXXXXXXXXXXXXXXXXFSEEKSENLIDAARKLADAFSGMLNAVKP--QEEERDI----------------------------DFRKAILDAANKVGEASSQLFRQI-TFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANN---LLLTHVEGALTNVRHALDNLEDHLRCGITVVNFAPRIQSLELFLTEYDRLKNIFILNLSNKRSNKPDDLLESLSNFLIISGKINEEILF---LCDQEQNQEDPLMESQKIFAAIIVKILAINKRWSSDFPDLL--KDLYYEVDNLVLSLLYQPGTRIISHDQLIHNLYRSAQTLITCSHKLITSYHQVLLNDELSPECAEVIERSEHI-------LVIMNSLKFYPTDDKILTAFIRDSEKLAQSCVTFCRNIHNTIPNTSXXXXXXXXXXXXSQTLAECEHMEQTIKCVKPIKAHLEL-AAVAKM 3805
            SPD+FM GGT I H  + +   Q++LL  IN +++ LQ +K  L      E +      +E     +      S+      +G+MN  V Q LRS+  A        A A      +    L  +++SF+++T+HFP+F+D+V+ ++ +         +        + +EE ++NL+ AAR +ADAF+ +L + +P      R++                              RKAI++AA++VGEAS+ L R +   S   V+ S+     L       +R ++D L+ L K+VANATA LV   K ++   +        QR+I+  T  GL TSQLV C K+LAPTI+Q +C  Q+     EV   +D V   +  +       +D  PQ  +   + +T  E A T VR ALD L  HL   +     A    +L+ F   Y+        NL    +     L+ S       + ++  +I     L   + +++  L  + K  A     ++ + K  S++  D++   +L    +NL + + Y     ++ H +LI +L  +A+  +T + +L+            +P   +VI  ++ +       ++ +   +  P D       I   E+  Q C    R+  +  P  SD  +   +  + +Q ++  E +   +  + P+  HL++  A+A++
Sbjct:  564 SPDNFMIGGTHIFH-YQEMTPAQRALLVTINEDVETLQAAKEQLQIGPAGERVLLGVGSDETSRRWLSESLGASQAKVTDEMGAMNAAVAQALRSANRAEAYDGIPPAQAGLGASSDPGDDLMMMQQSFRVVTIHFPAFVDDVKRVAVLRREAGAIRADQTGEPTVAEQTEESTQNLLSAARYVADAFTDLLESARPLASGHTREVMDGTDDTATGSHAVITTTTTTTGGPVSSSSRKAIIEAASRVGEASNDLLRHVMNESGDDVLESTTHLQLLT----EEERLYQDHLLSLAKAVANATAGLVVKAKNLATQPNLDPE--AQQRVIAAATQTGLCTSQLVACTKVLAPTIHQPSCQQQLSEAAREVSWAVDGVVQASRAV---GLTLVDQPPQIQHSVQMAVTDTETAATEVRDALDALNAHL---LKASAKAYSGDALDNFQLAYE--------NLQQNHAGGGQRLVASARRLAQATAQMIADIKAQAELSGDDPDRQSRLFAAAKQLADATTNLIEVAKVCSANPDDIMLQNELREAAENLNV-IAYSAAAELL-HTRLIRSLQAAARATVTGATQLVNVSQVAGKRSRGNPY--QVISDAKAVNGMIPRTIISIRESRANPDDPMTQMELIGACERFVQPCEALVRSSRSIAPTVSDPTVQAALDNSTAQLVSAVETLRACLGRLAPLSRHLQIDGALARL 1246          

HSP 3 Score: 65.855 bits (159), Expect = 2.020e-6
Identity = 57/198 (28.79%), Postives = 102/198 (51.52%), Query Frame = 2
Query: 5717 ANTMSGMITDDDTTILFASAGIKNCDLENYQD-ILSG-----KFLLNGEHKTVASFKNDAHCNVSNG-FRNLVQKTAEALVLDTQTLVQNSGDKQKSLATNTESVILTISNLADECESG--FVHETRKLSEAKMMNAIQSVKSALNNTYSDRSAEFSRLIVSNSPSLVNHDSNNGNLEVTDIYSIEETILNIQNRLER 6283
            A+T+SG+I D DTTILFAS+G  +  + +  D +LSG     ++ L G         + +    S G  R  + +TA ALV DTQ LV  +G+ Q  LA+   + +  ++ LA+  + G   +   +  ++ ++++A + V + L + +   S   +R +  + P +VN   NN  L V+ I S+ + +  I++   R
Sbjct: 2237 ASTVSGIIADLDTTILFASSGTLHPPIHDDVDALLSGDEYHSRYELTGPGALDRRGGSGSQSTESFGPIRESIVRTARALVDDTQNLVSGTGEDQARLASTAHTAVERVTQLANVVKRGAAVIGPGQPDTQVELLSACRDVATGLRSVFQSASQLPARTV--DDP-VVNEVRNNAQLTVSGITSLLQKVKAIEDDERR 2431          
BLAST of Talin vs. TrEMBL
Match: G4V653 (Putative talin 2 OS=Schistosoma mansoni OX=6183 GN=Smp_142630 PE=4 SV=1)

HSP 1 Score: 487.263 bits (1253), Expect = 7.700e-136
Identity = 244/471 (51.80%), Postives = 338/471 (71.76%), Query Frame = 2
Query:   83 ILSFF*IYTYRF-LDQMKTILSGS-TIVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNTKTSSNXXXXXXXXXXXXXXXXXXX-------INWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
            +L F    TYRF L  ++++L  S ++VL++H+  AG TK+   D    +   CE IR  +RE++   G  +KDYGLFLPHE +K GLWLDN + L  YIL+ GD IEYRYRYRWL IR+ D  +KTL VDDS +V+ELM+++C KMGI N+EEY L +D    D  R  T  +++ +      L + ++K++           + WLNPSQ+LRQQ +DE+E+LL++R+YFFSDMN+D RDP+QL+LL++Q K+AI+ G HPVS+ EA  LA +QCQ + G+   +K K   + LK+ +PK+Y K + +EK+I + ++ L G   IEAK +YC  CRSLKTYGITFFLVKE+IKGK+KLIPRLLG+++D V+RLDEKTKE++K WPLTSI +WA S +AFTMDFGEY+P+EYYTAQT++GEQISQLI+GY+DII+K QK+ +     G EES++ E  ++  +A IV+H+
Sbjct:    2 LLCFCNRNTYRFILIVVRSMLGDSRSLVLRVHLPKAGITKTTAFDAQMTVGQACERIRAQVRESDQTDG--AKDYGLFLPHEDNKKGLWLDNSRTLEHYILRNGDTIEYRYRYRWLYIRTMDGTRKTLKVDDSKTVAELMLMICTKMGIYNYEEYLLARDRDETDRERTNTLKRSTGHHHHTGTLMRDQEKMEKLKRKLHTDDDMEWLNPSQSLRQQGVDEKEILLLKRRYFFSDMNVDARDPVQLNLLYVQLKDAILKGTHPVSLEEAVYLAGIQCQVQFGNYVAEKFKPNFLDLKDFLPKEYAKIRSLEKKIFQQHAELCGLSEIEAKVKYCQFCRSLKTYGITFFLVKERIKGKNKLIPRLLGITKDSVVRLDEKTKEVLKIWPLTSICKWAASPHAFTMDFGEYSPDEYYTAQTSEGEQISQLIAGYIDIILKKQKATDHPGLQGDEESAMYEENVQAERATIVQHQ 470          

HSP 2 Score: 126.716 bits (317), Expect = 6.692e-25
Identity = 167/688 (24.27%), Postives = 278/688 (40.41%), Query Frame = 2
Query: 1853 SPDSFMTGGTRICHTVRRLNVTQQSLLQNINVNLDKLQ-----------TSKLLLNXXXXXXXXXXXXXXXXXXHIQVISKEHAIHNLGSMNTEVVQVLRSSKHAPLTAV-AVDNLKENNNQH-----LKDIEKSFKIITVHFPSFIDNVRMXXXXXXXXXXXXXXXXXXXXXXXFSEEKSENLIDAARKLADAFSGMLNAVKPQEEERD--IDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNM---DNSPQANNLLLTHVEGALTNVRHALDNLEDHLRCGITVVNFAPRIQSLELFLTEYDRLKNIFILNLSNKRSNKPDDLLESLSNFLIISGKINEEILFLCDQEQNQEDPLMESQKIFAAIIVKILAINKRWSSDFPD---LLKDLYYEVDNLVLSLLYQPGTRIISHDQLIHNLYRSAQTLITCSHKLI------TSYHQV----LLNDELSPECAEVIERSEHILVIMNSLKFYPTDDKILTAFIRDSEKLAQSCVTFCRNIHNTIPNTSXXXXXXXXXXXXSQTLAECEHMEQTIKCVKPIKAHLELAAVAKMLT 3811
            SPD+FMTGGT I H  + ++  Q+SLL  IN +L+ LQ           T + LLN   D+       +       +V  +      +G+MN  V Q LRS+  A  T + AV   +  +  H     L  +++SF+++T+HFP+F+D+++ ++ +   +     +        + +EE ++NL+ AAR +ADAF+ +L + +P    +D  +   KA+ +A   +   +  L  QIT                      SD + +  +I  V      T+Q                                     LV C K+LAPTI+Q  C  Q+     EV   +D       G++  +R  +      PQ     +   E A T VR ALD L  HL  G +   +  +  +L  F T Y+ LK  +  +   +R       L   +  +I   K   E       + ++++ L  + K  A     ++   K  SS+ PD   L  +L    D L  +L Y  G       +LIHNL  +A+  +T + +L+      T Y +     L ND  +     +I ++   ++ +   +  P D   L   I   E+  Q C    R+  +  P  SD  +   +  + SQ  +  E +   +  V P   HL+L      LT
Sbjct:  543 SPDNFMTGGTHIFH-YQEMSPAQKSLLITINEDLETLQAAKEHLDIGPPTERHLLNVGTDEASKRWLSESMGASQAKVTDE------VGAMNAAVAQALRSANRAESTDINAVQQGQPLDQIHDPGDDLMMMQQSFRVVTIHFPAFVDDLKRVAVLRRESGALKADQTGQPIIAEKTEESTQNLLSAARHVADAFTDLLQSARPLAMGQDQLLGLAKAVANATAGLVVKAKVLASQIT----------------------SDPEAQQRVIASVTQTGLCTSQ-------------------------------------LVACTKVLAPTIHQPTCQQQLSEAGREVTWAVD-------GVVQASRAAVHVPSEDPQMVQQSIIETETAATEVRDALDQLNAHLLKG-SYKGY--QGDALNSFQTSYEDLKQYYTTD--GQRMVASARRLAQATALMIADIKAQAE---ESGDDSDRQNRLFHAAKQLADATTNLINAAKACSSN-PDNIQLQTELRDAADEL-YTLAYSAGGEQF-QTRLIHNLQSAARATVTGATQLVNISQAATKYSRGNSYQLHND--TRNVTNLIPKT---VITIRESRANPDDPMALLELIGACERFVQPCTAMVRSSKSLAPTLSDPSIQAALENSNSQLASALETLITCLIKVAPFARHLQLDGALTRLT 1141          
BLAST of Talin vs. TrEMBL
Match: H2KNJ2 (Talin OS=Clonorchis sinensis OX=79923 GN=CLF_100272 PE=4 SV=1)

HSP 1 Score: 442.58 bits (1137), Expect = 2.667e-135
Identity = 241/429 (56.18%), Postives = 322/429 (75.06%), Query Frame = 2
Query:  152 TIVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNTKTSSNXXX----XXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAE 1426
            ++ L++H+     TK +  D    +   CEHIR  +RE E  TG  +KD+GLFLPHE +K GLWLDN + L  YIL+ GD ++YRYR RWL IR+   ++K LLVDDS +V+ELM  +C+ MGI NH+EYSL+++    D  RN T  K+++        QDK++K+K+KL TDDD++WLNPSQ+LRQQ I+E EVLL++R+YFFSDMN+D RDPIQL+LL++Q K+AI+ G HPVS  EA  LAALQCQ +LGD   +K +   + LK+ +PK+Y K + +EK+I++ ++   G  +IEAK +YC  CRSLKTYGITFFLVKE+IKGK+KLIPRLLGV++D V+RLDEKTKE++K WPLTSI RWA S +AFTMDFGEY+P++ YTAQT++GEQISQLI+GYVDII K QK+++     G EES++ E
Sbjct:   16 SLTLRVHLPEKRLTKMLAFDAQMTVAKACEHIRNQLREFEL-TG-SAKDHGLFLPHEDNKKGLWLDNSRTLEHYILRNGDTVQYRYRNRWLYIRTMAGVQKKLLVDDSQTVAELMRKICSSMGIYNHDEYSLVRERDETD--RNQTLRKSTTGVGTLGRDQDKMEKLKRKLHTDDDMDWLNPSQSLRQQGIEEDEVLLLKRRYFFSDMNVDARDPIQLNLLYLQLKDAILKGTHPVSQEEAIYLAALQCQIQLGDCNPEKFRANFLDLKDLLPKEYAKIRSLEKKILQQHAEFTGLSDIEAKVKYCQFCRSLKTYGITFFLVKERIKGKNKLIPRLLGVTKDSVIRLDEKTKEVLKIWPLTSISRWAASLHAFTMDFGEYSPDDCYTAQTSEGEQISQLIAGYVDIITKKQKAKDYPGLQGDEESAMYE 440          
BLAST of Talin vs. Ensembl Cavefish
Match: tln2b (talin 2b [Source:ZFIN;Acc:ZDB-GENE-130325-1])

HSP 1 Score: 369.392 bits (947), Expect = 3.636e-102
Identity = 191/441 (43.31%), Postives = 311/441 (70.52%), Query Frame = 2
Query:  152 TIVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNT--KTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
             + LKI +      K++  + ++P+Y  C  IR  + EA+  TG+ S DYGLFL  +  + G+WL++ + L  Y+L+ GD++EY+ + R   I+  D   KT++VDDS +V EL++ +C+++GI N+EEYSL+++ Q  +   +   T  K  +  +++ K++K+K KL TDDD+NWL+ S+T R+Q ++E E LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS  +A + A +Q Q + G     K+K   + LKE +PK+Y+K +G EKRI + + +      IEAK +Y  L RSL+TYG++FFLVKEK+K K+KL+PRLLG++++ V+R+DE+TK++++ WPLT+++RWA S  +FT+DFGEY  + YY+ QT +GEQISQLI+GY+DII+K ++S++    DG EES++ E  + P ++ I++ +
Sbjct:    3 ALSLKICVRQCNVVKTMQFEPSTPVYDACRIIRERVPEAQ--TGQAS-DYGLFLSDDDPRKGIWLESGRTLDYYMLRNGDILEYKKKQRPQKIKMLDGAIKTIMVDDSKTVGELLVTICSRIGITNYEEYSLIQE-QGEERKEDGMGTLKKERTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVEESETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGIQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQDHKSCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKSKNKLVPRLLGITKESVMRVDERTKDVVQEWPLTTVKRWAASPKSFTLDFGEYQES-YYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLDGDEESTMLEESVSPKKSTILQQQ 438          

HSP 2 Score: 77.0258 bits (188), Expect = 2.898e-13
Identity = 71/226 (31.42%), Postives = 106/226 (46.90%), Query Frame = 2
Query: 2342 SENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLR----CG 3007
             +NL+ AAR L  A S +L AV+P   E     R+ +L AA  +G+AS  L RQ+   +                   +D  F+D ++ L K+VANA A LV   K V+Q   A D ++   R+I+  T   L+TSQLV C K+++PTI+   C  Q++     V  +++       G +       + +      LL  V GA   V  AL +L  H+R    CG
Sbjct:  609 GQNLMCAARTLTGAVSDLLRAVEPASGEP----RQTVLTAAGSIGQASGDLLRQMGEGE-------------------TDERFQDIMMNLAKAVANAAAMLVLKAKNVAQ--VAEDTVLQ-NRVITAATQCALSTSQLVACTKVVSPTISSPVCQEQLVEAGRLVERSVE-------GCVKACHAASEEAE-----LLRQVNGAAGAVSQALSDLLQHVRHYASCG 796          

HSP 3 Score: 53.5286 bits (127), Expect = 3.771e-6
Identity = 62/238 (26.05%), Postives = 102/238 (42.86%), Query Frame = 2
Query: 5648 ILSILESRNKNVKLIENEPTSDLANTMSGMITDDDTTILFASAGIKNCDLENYQDILSGKFLLNGEHKTVASFKNDAHCNVSNGFRNLVQKTAEALVLDTQTLVQNSGDKQKSLATNTESVILTISNLADECESGFVHETRKLSEAK--MMNAIQSVKSALNNTYSDRSAEFSRLIVSNSPSLVNHDSNNGNLEVTDIYSIEETILNIQNRLERFDDKIAHQINNSKNMETVHSRIDS 6355
            +LS L++ NK       +     A+++SG+I D DTTI+FASAG  N + E                    SF +          R  + KTA+ALV DT+ LV  +   Q+ LA   +S   TI+ L D  + G      +  E +  ++NA++ V  AL            +   ++ PS+    S    + VT++ S+ +T+  +++   R    +   I   K   TV    D+
Sbjct: 1917 VLSALQAGNKGT-----QACITAASSVSGIIADLDTTIMFASAGTLNAENEE-------------------SFADH---------RENILKTAKALVEDTKLLVAGAASSQEKLAQAAQSSAKTITQLTDVVKLGAASMGSEDPETQVVLINAVRDVAKALAELIGATKCAAGK--AADDPSMYQLKS-AAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIEFIKQELTVFQSKDT 2118          
BLAST of Talin vs. Ensembl Cavefish
Match: tln1 (talin 1 [Source:ZFIN;Acc:ZDB-GENE-031002-48])

HSP 1 Score: 361.688 bits (927), Expect = 9.256e-100
Identity = 191/439 (43.51%), Postives = 305/439 (69.48%), Query Frame = 2
Query:  155 IVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKD-NQLNDPSRNVTNTKTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
            + L + I      K++  + ++ +Y  C  IR  + EA+     +  DYGLFL  E  K G+WL+  K L  Y+L+ GD ++Y+ + R L IR  D   KT++VDDS  VS++++ +CA++GI N++EYSL++D  +        T  +  +  ++  K++K+K+KL TDD++NWL+  +TLR+Q ++E E+LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS  +A + A  QCQ + GD    K+K   + LKE +PK+Y+KNKG EK+I + +   +    IEAK  Y  L RSLKTYG++FFLVKEK+KGK+KL+PRLLG++++ V+R+DEKTKE+++ W LT+I+RWA S  +FT+DFG+Y  + YY+ QT +GEQI+QLI+GY+DII+K +KS++    +G EES++ E  + P ++ +++ +
Sbjct:    2 VALSLKIGVGNVVKTMQFEPSTMVYDACRIIRERVPEAQL---GQPNDYGLFLSDEDPKKGIWLEAGKALDYYMLRNGDTLDYKKKQRPLKIRMLDGTVKTVMVDDSKIVSDMLMTICARIGITNYDEYSLVRDIGEEKKEETTGTLKRDKTLLRDDKKMEKLKQKLHTDDELNWLDHGRTLREQGVEETEMLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGDHNESKHKPGFLDLKEFLPKEYIKNKG-EKKIFQAHKNCQNMTEIEAKVSYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKEVMQEWSLTNIKRWAASPKSFTLDFGDY-QDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVMQQQ 435          

HSP 2 Score: 73.9442 bits (180), Expect = 2.822e-12
Identity = 71/222 (31.98%), Postives = 103/222 (46.40%), Query Frame = 2
Query: 2342 SENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQN--ESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLR 3001
             + L+ AAR LA A S ML   +P   E     R+ +L AA  VG+AS +L +QI  SD                   +D+ F+D L+ L K+VANA A LV   K V+Q   +SA        R+I+  T   L+TSQLV C +++APTI+   C  Q++     V  +++     + G   +              LL  V  A T V  AL+ L  H++
Sbjct:  605 GQQLLGAARNLACAVSDMLKTAQPASTEP----RQNLLQAAGNVGQASGELLQQIGESD-------------------ADQQFQDMLMKLAKAVANAAAALVLKAKNVAQKTEDSAQQ-----NRVIAAATQCALSTSQLVACTRVVAPTISSPVCQEQLIEAGKLVAKSVEGCVEASQGATGDEH------------LLKQVGAAATGVTQALNELLQHIK 786          
BLAST of Talin vs. Ensembl Cavefish
Match: tln2a (talin-2-like [Source:NCBI gene;Acc:103042966])

HSP 1 Score: 359.762 bits (922), Expect = 3.223e-99
Identity = 185/437 (42.33%), Postives = 302/437 (69.11%), Query Frame = 2
Query:  161 LKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTN-TKTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
            LKI +      K++     + +Y  C  IR  + EA+  TG  S ++GLFL  E  + G+WL++ + L  Y+L+ GD++EYR + R   ++  D   KT++VDDS +V EL++ +C+++GI N++EYS++++         ++   K  +  +++ K++K+K KL TDD++NWL+  +T R+Q ++E E LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS  +A +   +Q Q + G    QK++   + LKE +PK+YVK +G EK+I + +        IEAK +Y  L RSLKTYG++FFLVKEK+K K+KL+PRLLGV+++ V+R+DEKTKE+++ WPLT+++RWA S  +FT+DFGEY  + YY+ QT +GEQISQLI+GY+DII+K +KS++    +G EE+++ E  + P ++ I++ +
Sbjct:    6 LKICVRQCNVVKTMQFKPATAVYDACRVIRERVPEAQ--TGPAS-EFGLFLSDEDPRKGIWLESGRTLDYYMLRNGDVLEYRRKQRPQKVKMLDGAVKTVMVDDSKTVGELLLTICSRIGITNYDEYSVVRETGEERRDEGMSTLRKDRTLLRDERKMEKLKAKLHTDDELNWLDHGRTFREQGVEESETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFGGIQTQIQFGPHIEQKHRTGLLDLKEFLPKEYVKQRGAEKKIFQEHKACGEMTEIEAKVKYVKLARSLKTYGVSFFLVKEKMKSKNKLVPRLLGVTKESVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQES-YYSVQTTEGEQISQLIAGYIDIILKKKKSKDRFGLEGDEEATMLEDSVSPKKSTILQQQ 438          

HSP 2 Score: 74.7146 bits (182), Expect = 1.757e-12
Identity = 73/226 (32.30%), Postives = 106/226 (46.90%), Query Frame = 2
Query: 2342 SENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLR----CG 3007
             ++L+ AAR L  A S +LNAV+P   E     R+ +L+AA  +G+AS  L RQI                     + +D  F+D L+ L K+VANA A +V   K V+Q    S+  +   R+I+  T   L+TSQLV C K+++PTI+   C  Q++    E    +D       G +N      D+       LL  V  A   V  AL +L  H+R    CG
Sbjct:  608 GQDLMRAARTLTGAVSDLLNAVEPTSGEP----RQTVLNAAGSIGQASGDLLRQI-------------------GEKETDERFQDVLMNLAKAVANAAAMMVLKAKNVAQ---VSEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLM----EAGKLVDR---SVQGCVNACLSATDDGE-----LLKAVSAAAGVVTQALADLLAHVRNYDSCG 795          
BLAST of Talin vs. Ensembl Cavefish
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:553051])

HSP 1 Score: 62.003 bits (149), Expect = 6.871e-9
Identity = 38/147 (25.85%), Postives = 78/147 (53.06%), Query Frame = 2
Query:  971 KNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSF--NAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGF 1405
            KNK I  RI++ +  +     IEAK  +    +SL  +GIT FL K +   + +LI    G++ +R++R+D  T++ IKTW  +++++W  ++     T++F +     +  A+ +  + + + I GY+ +  + +   E  + + F
Sbjct:  485 KNKQISARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLAKFQGSKREELI----GITYNRLIRIDASTRDAIKTWRFSNMKQWNVNWEIKMVTVEFADEPSLSFICAEVD-CKVVHEFIGGYIFLSTRAKDQNESLDEEMF 626          
BLAST of Talin vs. Ensembl Cavefish
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:553051])

HSP 1 Score: 56.9954 bits (136), Expect = 2.293e-7
Identity = 35/143 (24.48%), Postives = 75/143 (52.45%), Query Frame = 2
Query:  983 IEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSF--NAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGF 1405
            I  RI++ +  +     IEAK  +    +SL  +GIT FL K +   + +LI    G++ +R++R+D  T++ IKTW  +++++W  ++     T++F +     +  A+ +  + + + I GY+ +  + +   E  + + F
Sbjct:  496 ISARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLAKFQGSKREELI----GITYNRLIRIDASTRDAIKTWRFSNMKQWNVNWEIKMVTVEFADEPSLSFICAEVD-CKVVHEFIGGYIFLSTRAKDQNESLDEEMF 633          
BLAST of Talin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003776.1 (pep scaffold:Pmarinus_7.0:GL481036:4073:28398:-1 gene:ENSPMAG00000003436.1 transcript:ENSPMAT00000003776.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 328.176 bits (840), Expect = 2.723e-91
Identity = 183/448 (40.85%), Postives = 292/448 (65.18%), Query Frame = 2
Query:  152 TIVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAE----PET-----GRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNT--KTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVE 1462
             + LKI + H    K++  + ++ +Y  C  IR  + EA+    P T        S    L LP            + +       P DL+EYR + R L +R  D   KT +VDDS +V ++++ +CA++GI N+EEYSL+++    + + + T T  K  S  +++ K++K+K+KL TDDD+NWL+  +TLR+Q +++ E LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS   A + A  Q Q + G     K+K   + LKE +PK+YVK +G EKR+ + +        IEAK  Y    RSLKTYG++FFLVKEK+KGK+KL+PRL G++++ V+R+DE+TKE+I+ WPLT+++RWA S  +FT+DFG+Y+ + YY+ QT +GEQI+QLI+GY+DII+K +KS++    +G EES++ E  + P ++ +++
Sbjct:    3 ALSLKICVRHCNVVKTMQFEPSTVVYDACRIIRERVPEAQDGQPPATPLALSSLPSPPRPLHLP------------ISSTATSPPHPQDLLEYRKKQRPLKVRMLDGTIKTAMVDDSKTVGDMLLAVCARIGITNYEEYSLVREV-AEEKAMDGTGTLKKDRSLLRDEKKMEKLKQKLHTDDDMNWLDHGRTLREQGVEDSETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEMACEFAGYQAQIQFGPHNEVKHKPGFLDLKEFLPKEYVKQRGAEKRLFQEHKKCESMTEIEAKVRYVRQARSLKTYGVSFFLVKEKMKGKNKLVPRLFGITKESVMRVDERTKEVIQEWPLTTVKRWAASPKSFTLDFGDYS-DGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDRFGTEGDEESTMLEDSVSPKKSTVIQ 436          

HSP 2 Score: 75.0998 bits (183), Expect = 2.209e-13
Identity = 72/217 (33.18%), Postives = 105/217 (48.39%), Query Frame = 2
Query: 2351 LIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLR 3001
            L+ AAR L D  S +L  V+P   E     R+A+L AA+ VG +S+ L +QI                     Q  D+ F+D L  L K+VANA A LV   KTV+Q   A D  +  Q +I+  T   L+TSQLV C K++ PT++   C  Q++ E  ++      VA    G + +++         ++ LL  V GA   V  ALD L  H++
Sbjct:  610 LLQAARGLIDCISDLLKTVQPSSTEP----RQAVLTAASTVGRSSNNLLKQIG-------------------QQGVDQQFQDVLNQLAKAVANAAAGLVLKAKTVAQK--ADDQALQNQ-VIAAATQCALSTSQLVACTKVVGPTMDSPVCQEQLM-ESGKL------VARAVEGCVRSSQ-----EATKDDELLRQVGGAAGAVTQALDALLQHVK 788          
BLAST of Talin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007752.1 (pep scaffold:Pmarinus_7.0:GL478287:501:47681:-1 gene:ENSPMAG00000006982.1 transcript:ENSPMAT00000007752.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 176.407 bits (446), Expect = 1.702e-44
Identity = 75/147 (51.02%), Postives = 116/147 (78.91%), Query Frame = 2
Query: 1028 DNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
            + I AK +Y  L RSL+TYG++FFLVKEK+K K+KL+PRLLGV+++ VLR+DE+TKE+++ WPLT+++RWA S  +FT+DFG+Y    YY+ QT +GEQISQLI+GY+DII+K +++++    +G EES++ E  + P ++ I++ +
Sbjct:   10 NEITAKSKYVKLARSLRTYGVSFFLVKEKMKSKNKLVPRLLGVTKESVLRVDERTKEVMQEWPLTTVKRWAASPKSFTLDFGDYQVG-YYSVQTTEGEQISQLIAGYIDIILKKKQAKDRFGLEGDEESTMLEESVSPKKSTILQQQ 155          

HSP 2 Score: 73.9442 bits (180), Expect = 4.797e-13
Identity = 70/220 (31.82%), Postives = 104/220 (47.27%), Query Frame = 2
Query: 2342 SENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLR 3001
             ++L+ AAR LA A S +L  V P   E     R+++L AA  VG+AS +L R I   +                   +D+ F+D L+ L K+VANA A LV   K V+Q    ++      R+I+  T   L+TSQLV C K++ PTI    C  Q++ E  ++      VA    G +  ++   +        LL  V  A T V  AL++L  H+R
Sbjct:  325 GQDLMQAARGLASAVSDLLKTVDPSTAEP----RQSVLTAAGNVGQASGELLRTIGEDE-------------------ADQSFQDMLMQLAKAVANAAATLVLKAKNVAQR---AEDPAQQNRVIAAATQCALSTSQLVACTKVVGPTIRSPACQEQLM-EAGKL------VARAVEGCVQASQDATEEEE-----LLRQVGEAATAVTQALNDLLRHVR 506          
BLAST of Talin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007037.1 (pep scaffold:Pmarinus_7.0:GL476737:73889:120616:-1 gene:ENSPMAG00000006357.1 transcript:ENSPMAT00000007037.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.05 bits (362), Expect = 6.157e-39
Identity = 87/212 (41.04%), Postives = 145/212 (68.40%), Query Frame = 2
Query:  389 DLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLM-------KDNQLNDPSRNVTNTKTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVK 1003
            DL+EY+ + R L +R  D + KT++VDDS +V +L+I +C ++GI N++EYSL+       +        R+ T  K  +  +++ K++K+K+KL TDD++NW++  +TLR+Q ++E E LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+N  HPVS  +A + A +Q Q + G     K+K   + LKE +PK+YVK KG EK+I +
Sbjct:    1 DLLEYKRKVRPLKVRMLDGMIKTVMVDDSKTVGDLLITICTRIGITNYDEYSLIWEGGGEERKEDGGGTLRSGTLKKDRTLLRDEKKMEKLKQKLHTDDELNWVDHGRTLREQGVEENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNSSHPVSYDKACEFAGIQAQIQFGPHVEHKHKAGFLDLKEFLPKEYVKQKGSEKKIFQ 212          
BLAST of Talin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010194.1 (pep scaffold:Pmarinus_7.0:GL480176:295:15370:1 gene:ENSPMAG00000009228.1 transcript:ENSPMAT00000010194.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 1.379e-7
Identity = 52/187 (27.81%), Postives = 91/187 (48.66%), Query Frame = 2
Query: 5717 ANTMSGMITDDDTTILFASAGIKNCDLENYQDILSGKFLLNGEHKTVASFKNDAHCNVSNGFRNLVQKTAEALVLDTQTLVQNSGDKQKSLATNTESVILTISNLADECESGFVHETRKLSEAK--MMNAIQSVKSALNNTYSDRSAEFSRLIVSNSPSLVNHDSNNGNLEVTDIYSIEETILNIQN 6271
            A+T+SG++ D DTTI+FA+AG  + +              N E     SF +          R  + KTA+ALV DT+ LV  +G  Q+ LA   +S + TI+ LAD  + G      +  E +  ++NA++ V  AL +  S   +   +    + P++ N       + VT++ S+ +T+  +++
Sbjct:  293 ASTVSGIVADLDTTIMFATAGTLHAE--------------NNE-----SFAD---------HREGILKTAKALVEDTKLLVAGAGATQEKLAQAAQSSVGTITRLADVVKLGAASLGSEDPETQVVLINAVKDVAKALGDLISATKSAAGKQ--PDDPAMHNLK-GAAKIMVTNVTSLLKTVKAVED 448          
BLAST of Talin vs. Ensembl Nematostella
Match: EDO47777 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL15])

HSP 1 Score: 346.665 bits (888), Expect = 1.169e-95
Identity = 195/452 (43.14%), Postives = 304/452 (67.26%), Query Frame = 2
Query:  152 TIVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETG-RESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLM---KDNQLNDPSRNVTNTKTSSN--------XXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHRS 1471
             + LKI++V   + K+  L FN P   V E +R+ IRE  P+    +  DYGLF   +    G WL+  +++  Y LK GD++EY+ + R + I+  D   KTL +DDS +V +++  +C KMGI N EE+SL+   KD++  +  +  T  +            E+++ K+D++KKKL T+DD+ WL+  +TLR+Q  D+   ++++RKYF+SD N+D +DP+QL+LL++Q ++ I++G HP +  EA QL A+Q Q + GD    K KL  I LKE +PK+YVK+K I+K+I + +    G D ++ + +Y  LCR LKTYG+TFFLVKEK+KGK+KL+PRLLG++++ +LR+DEKTKE++KTWPLT++RRWA S N+FT+DFG+Y    YY+ QTN+GE+ISQLI+GY+DII+K +K  E  + D  E S++ E ++ P++   ++ ++
Sbjct:    2 ALSLKINVVKNNSIKT--LQFN-PEATVAEALRI-IREKVPDASPGKVADYGLFKQEDDPAKGKWLEPARSINFYPLKDGDMLEYKSKIRLIKIKFMDGNVKTLQIDDSHTVGQILETVCVKMGISNPEEFSLLVEGKDDEKEEAEKTSTLKRVMMKDVPIKRLEERDRKKMDQLKKKLHTEDDVQWLDHDKTLREQGTDDSHTVVMRRKYFYSDQNVDIKDPVQLNLLYVQCRDGILDGTHPCTQEEASQLGAIQIQVQFGDYEESKYKL--IDLKEVLPKEYVKSKNIDKKIKEEHRKFNGLDELQGRYKYVQLCRGLKTYGVTFFLVKEKMKGKNKLVPRLLGITKESILRVDEKTKEVMKTWPLTTVRRWAASPNSFTLDFGDYT-ESYYSVQTNEGEKISQLIAGYIDIILKKRKGMEGYDPDFDEVSAMEEDQVAPSKGTYLDRQT 446          

HSP 2 Score: 77.7962 bits (190), Expect = 7.503e-14
Identity = 65/227 (28.63%), Postives = 105/227 (46.26%), Query Frame = 2
Query: 2333 EEKSENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQ--RLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLRCG 3007
            ++ S  L+DAAR LA AFS +L A + +    D + R  +L+AA  VG + +QL   +   +                    D++ +++L+ L ++VANATA LV   K V     AS      Q  ++I       + TSQLV CVK++ P+I    C  Q++    +V   +++      G  + +  NM       N+L+   +G    VR AL+ L   +R G
Sbjct:  615 QDDSSKLLDAARGLAGAFSLLLKAAQ-EGAGGDKEKRSQLLNAAGNVGSSGAQLLEYMGEPE-------------------VDQETQETLLKLAQAVANATATLVLKAKNV-----ASQCPDTAQQNKVIGAAKDTAMTTSQLVACVKLVVPSITSQMCQEQVVESAKQVAKAVEDTEGACKGACDPDSENM-------NVLIDAAQG----VRDALNALLKKVREG 805          
BLAST of Talin vs. Ensembl Nematostella
Match: EDO49269 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH05])

HSP 1 Score: 64.3142 bits (155), Expect = 8.640e-10
Identity = 38/115 (33.04%), Postives = 55/115 (47.83%), Query Frame = 2
Query:  908 ATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLR--GKDNIEAKREYCALCRSLKTYGITFFLVKE---KIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRW 1237
             T   KL+   LK+ V   + K K I KRI       +  G     AK  Y   C+++  YG  FF +KE    I   S  + RL G+S  +V+ LDE+TK ++  W    ++RW
Sbjct: 1538 GTGSEKLSASRLKQAVHPSFYKVKNIAKRIRGQREHFQNEGLSERNAKHNYIDCCQAMPGYGCRFFQLKECLGTISRNSGHVDRLFGISPKKVVLLDERTKGVVGNWQFNDVKRW 1652          
BLAST of Talin vs. Ensembl Nematostella
Match: EDO35658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKY6])

HSP 1 Score: 58.9214 bits (141), Expect = 3.638e-8
Identity = 40/157 (25.48%), Postives = 72/157 (45.86%), Query Frame = 2
Query:  941 LKECVPKDYVKNKGIE---KRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIP--RLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNA 1396
            +KE +P D VK    +   + IV  ++   G+   EAK  +  +     T+G  FF VK+   G     P   L+ +++  V  ++ +TKEI+ T+P T I  W+     F M  G          +T+ G ++  L++ Y+ +++ +   Q    A
Sbjct: 1762 VKELIPHDLVKQMSPDEWKRAIVAQFNKHPGRTKSEAKISFLKIIYRWPTFGSAFFEVKQ---GTEPNFPDNLLIAINKSGVNLINPQTKEILATYPFTKISNWSSGNTYFHMTIGSLVKGSKLLCETSLGYKMDDLLTSYISLMLTNMNKQRKAPA 1915          
BLAST of Talin vs. Ensembl Nematostella
Match: EDO36565 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIB3])

HSP 1 Score: 57.7658 bits (138), Expect = 5.229e-8
Identity = 37/154 (24.03%), Postives = 75/154 (48.70%), Query Frame = 2
Query:  956 PKDYV--------KNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQN 1393
            P+D+V        K K I  RI++ ++ L     +E+K  Y    +SL  +G++ F+V+ +     K    +LG++ +R++R+D  T+E IKTW  + +R W  ++    M          +   +   + + + I GY+ + ++   +Q P +
Sbjct:  476 PEDFVGQRMLKKYKPKQIAARILESHTALHKASLVESKMMYIRQWQSLPEFGVSHFIVRFRSDKPKK--EEILGIAFNRIMRIDASTREAIKTWRYSVMRAWNVNWETREMIVQCEDEMIAFNCVSADIKAVHEFIGGYIFLSMRKDVNQPPSD 627          
BLAST of Talin vs. Ensembl Medaka
Match: tln2a (talin-2 [Source:NCBI gene;Acc:101173776])

HSP 1 Score: 367.466 bits (942), Expect = 1.403e-101
Identity = 191/438 (43.61%), Postives = 309/438 (70.55%), Query Frame = 2
Query:  161 LKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNT--KTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
            LKI +      K++  + ++ IY  C  IR  + EA+  TG+ S DYGLFL  E  + G+WL++ + L  Y+L+ GD++EY+ + R   I+  D   KT++VDDS +V EL++ +C+++GI N+EEYSL+++  + +   + T T  K  +  +++ K++K+K KL TDDD+NWL+ S+T R+Q +D+ E LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS  +A + A +Q Q + G     K+K   + LKE +PK+Y+K +G EK+I + +        IEAK +Y  L RSL+TYG++FFLVKEK+K K+KL+PRLLG++++ V+R+DEKTK++++ WPLT+++RWA S  +FT+DFGEY  + YY+ QT +GEQISQLI+GY+DII+K ++S++    +G EES++ E  + P ++ I++ +
Sbjct:    6 LKICVRQCNVVKTMQFEPSTAIYDACRIIRDRVPEAQ--TGQAS-DYGLFLSDEDPRKGIWLESGRTLDYYMLRNGDILEYKKKQRPQKIKMLDGAVKTIMVDDSKTVGELLVTICSRIGITNYEEYSLIQET-VEEKKEDGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDDNETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGIQAQIQFGSHIEHKHKPGFLDLKEFLPKEYIKQRGAEKKIFQEHKNCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKSKNKLVPRLLGITKESVMRVDEKTKDVVQEWPLTTVKRWAASPKSFTLDFGEYQES-YYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQ 438          

HSP 2 Score: 75.8702 bits (185), Expect = 6.413e-13
Identity = 74/218 (33.94%), Postives = 105/218 (48.17%), Query Frame = 2
Query: 2348 NLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLR 3001
            +L+ AAR LA A S +L AV+P   E     R+ +L AA  +G+AS  L RQI  ++                   +D  F+D L+ L K+VANA A LV   K V+Q   A D ++   R+I+  T   L+TSQLV C K+++PTI+   C  Q++    E    +D   +V S I        D        LL  V  A + V  AL +L  H+R
Sbjct:  610 DLMKAARTLAGAVSDLLKAVEPASGEP----RQTVLTAAGSIGQASGDLLRQIGENE-------------------TDERFQDVLMNLAKAVANAAAMLVLKAKNVAQ--VAEDTVLQ-NRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLI----EAGKLVDR--SVESCIQACLSATEDGE------LLKQVSAAASVVSQALADLLQHVR 789          
BLAST of Talin vs. Ensembl Medaka
Match: tln2a (talin-2 [Source:NCBI gene;Acc:101173776])

HSP 1 Score: 367.466 bits (942), Expect = 1.438e-101
Identity = 191/438 (43.61%), Postives = 309/438 (70.55%), Query Frame = 2
Query:  161 LKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNT--KTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
            LKI +      K++  + ++ IY  C  IR  + EA+  TG+ S DYGLFL  E  + G+WL++ + L  Y+L+ GD++EY+ + R   I+  D   KT++VDDS +V EL++ +C+++GI N+EEYSL+++  + +   + T T  K  +  +++ K++K+K KL TDDD+NWL+ S+T R+Q +D+ E LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS  +A + A +Q Q + G     K+K   + LKE +PK+Y+K +G EK+I + +        IEAK +Y  L RSL+TYG++FFLVKEK+K K+KL+PRLLG++++ V+R+DEKTK++++ WPLT+++RWA S  +FT+DFGEY  + YY+ QT +GEQISQLI+GY+DII+K ++S++    +G EES++ E  + P ++ I++ +
Sbjct:    6 LKICVRQCNVVKTMQFEPSTAIYDACRIIRDRVPEAQ--TGQAS-DYGLFLSDEDPRKGIWLESGRTLDYYMLRNGDILEYKKKQRPQKIKMLDGAVKTIMVDDSKTVGELLVTICSRIGITNYEEYSLIQET-VEEKKEDGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDDNETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGIQAQIQFGSHIEHKHKPGFLDLKEFLPKEYIKQRGAEKKIFQEHKNCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKSKNKLVPRLLGITKESVMRVDEKTKDVVQEWPLTTVKRWAASPKSFTLDFGEYQES-YYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQ 438          

HSP 2 Score: 75.8702 bits (185), Expect = 6.359e-13
Identity = 74/218 (33.94%), Postives = 105/218 (48.17%), Query Frame = 2
Query: 2348 NLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLR 3001
            +L+ AAR LA A S +L AV+P   E     R+ +L AA  +G+AS  L RQI  ++                   +D  F+D L+ L K+VANA A LV   K V+Q   A D ++   R+I+  T   L+TSQLV C K+++PTI+   C  Q++    E    +D   +V S I        D        LL  V  A + V  AL +L  H+R
Sbjct:  610 DLMKAARTLAGAVSDLLKAVEPASGEP----RQTVLTAAGSIGQASGDLLRQIGENE-------------------TDERFQDVLMNLAKAVANAAAMLVLKAKNVAQ--VAEDTVLQ-NRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLI----EAGKLVDR--SVESCIQACLSATEDGE------LLKQVSAAASVVSQALADLLQHVR 789          
BLAST of Talin vs. Ensembl Medaka
Match: tln2b (talin 2 [Source:NCBI gene;Acc:101167954])

HSP 1 Score: 364.77 bits (935), Expect = 9.600e-101
Identity = 190/443 (42.89%), Postives = 308/443 (69.53%), Query Frame = 2
Query:  161 LKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLM-------KDNQLNDPSRNVTNTKTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
            LKI +      K++  + ++P+Y  C  IR  + EA+  TG+ S DYGLFL  +  + G+WL++ + L  Y+L+ GD++EY+ + R   I+  D   KT++VDDS +V EL++ +C+++GI N+EEYS++       KD+ L    ++ T        +++ K++K+K KL TDDD+NWL+ S+T R+Q ++E E LL++RK+F+SD N+D+RDP+QL+LL++Q+++ IING HPVS  +A + A +Q Q + G     K+K   + LKE +PK+Y+K +G EK++ + +        IE K +Y  L RSL+TYG++FFLVKEK+KGK+KL+PRLLG++++ V+R+DEKTK++++ WPLT+++RWA S  +FT+DFGEY  + YY+ QT +GEQISQLI+GY+DII+K ++S++    +G EES++ E  + P ++ I++ +
Sbjct:    6 LKICVRQCNVVKTMQFEPSTPVYDACRIIRERVPEAQ--TGQAS-DYGLFLSDDDPRKGIWLESGRTLDYYMLRNGDILEYKKKQRPQKIKMLDGTIKTVMVDDSKTVGELLVTICSRIGITNYEEYSVIQELTEDKKDDGLGTLRKDRTLL-----LRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVEESETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDIINGSHPVSFDKACEFAGIQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKKVFQEHKNCGEMTEIEGKVKYVKLARSLQTYGVSFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKDVVQEWPLTTVKRWAASPKSFTLDFGEYQES-YYSVQTTEGEQISQLIAGYIDIILKKKQSKDHFGLEGDEESTMLEESVSPKRSTILQQQ 439          

HSP 2 Score: 73.1738 bits (178), Expect = 4.694e-12
Identity = 70/223 (31.39%), Postives = 103/223 (46.19%), Query Frame = 2
Query: 2351 LIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLR----CG 3007
            L+ AAR LA A S +L +V+P   E     R+ +L AA  +G+AS  L R +   +                   +D  F+D+L+ L K+VANA A LV   K V+Q   A D  +   R+I+  T   L+TSQLV C K+++PTI+   C  Q++     V  +++         +   R   D+       LL  V  A   V  AL +L  H+R    CG
Sbjct:  613 LMGAARMLAGAVSDLLRSVEPAAAEP----RQTVLTAAGSIGQASGDLLRHMGEGE-------------------TDEKFQDTLMNLAKAVANAAAMLVLKAKNVAQ--VAEDTTLQ-NRVIAAATQCALSTSQLVACTKVVSPTISSPVCQEQLVEAGKLVDRSVETC-------VKACRSASDDGE-----LLKQVAAAAGVVSQALSDLLQHVRHYASCG 797          
BLAST of Talin vs. Ensembl Medaka
Match: tln1 (talin 1 [Source:NCBI gene;Acc:101157630])

HSP 1 Score: 361.303 bits (926), Expect = 1.052e-99
Identity = 193/439 (43.96%), Postives = 304/439 (69.25%), Query Frame = 2
Query:  155 IVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKD-NQLNDPSRNVTNTKTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
            + L + I      K++  + ++ +Y  C  IR  + EA+     +  DYGLFL  E  K G+WL+  K L  Y+L+ GD ++Y+ + R L IR  D   KT++VDDS  VS++++ +CA++GI N++EYSL+ D  +        T  K  +  ++  K++K+K+KL TDD++NWL+  +TLR+Q ++E E+LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS  +A + A  QCQ + GD    K+K   + LKE +PK+Y+KNKG EK+I + +   +    IEAK  Y  L RSLKTYG++FFLVKEK+KGK+KL+PRLLG++++ V+R+DEKTKE+I+ W LT+I+RWA S  +FT+DFG+Y  + YY+ QT +GEQI+QLI+GY+DII+K +KS++    +G EES++ E  + P ++ +++ +
Sbjct:    2 VALSLKIGVGNVVKTMQFEPSTMVYDACRIIRERVPEAQL---GQPNDYGLFLSDEDPKKGIWLEAGKALDYYMLRNGDTLDYKKKQRPLKIRMLDGTVKTVMVDDSKIVSDMLMTICARIGITNYDEYSLVHDIGEEKKEETTGTLKKDKTLLRDDKKMEKLKQKLHTDDELNWLDHGRTLREQGVEETEMLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGDHNESKHKSGFLDLKEFLPKEYIKNKG-EKKIFQAHKNCQNMTEIEAKVSYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWAASPKSFTLDFGDY-QDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGMEGDEESTMLEDSVSPKKSTVLQQQ 435          

HSP 2 Score: 61.2326 bits (147), Expect = 1.671e-8
Identity = 56/212 (26.42%), Postives = 101/212 (47.64%), Query Frame = 2
Query: 5645 HILSILESRNKNVKLIENEPTSDLANTMSGMITDDDTTILFASAG-IKNCDLENYQDILSGKFLLNGEHKTVASFKNDAHCNVSNGFRNLVQKTAEALVLDTQTLVQNSGDKQKSLATNTESVILTISNLADECESGFVHETRKLSEAK--MMNAIQSVKSALNNTYSDRSAEFSRLIVSNSPSLVNHDSNNGNLEVTDIYSIEETILNIQN 6271
            H+L+ L++ N+  +          A+ +SG+I D DTTI+FA+AG +   + E + D                              R  + KTA+ALV DT+ LV  +G  Q+ LA   +S + TI+ LA+  + G      +  E +  ++NA++ V  AL+N  S   A   +    + PS++    N+  + VT++ S+ +T+  +++
Sbjct: 1961 HVLASLQAGNRGTQACITA-----ASAVSGIIADLDTTIMFATAGTLHRENAETFAD-----------------------------HRECILKTAKALVEDTKLLVSGAGASQEKLAQAAQSSVSTITKLAEVVKLGAASLGSEDPETQVVLINAVKDVAKALSNLISATKAAAGK--PHDDPSMLQL-KNSAKVMVTNVTSLLKTVKAVED 2135          

HSP 3 Score: 58.151 bits (139), Expect = 1.546e-7
Identity = 65/219 (29.68%), Postives = 97/219 (44.29%), Query Frame = 2
Query: 2351 LIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQN--ESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLR 3001
            L+ AA+ LA A S ML   +P   E     R+ +L AA  VG+ S +L   I  +D                   +D  F++ L+ L K+VANA A LV   K V+Q   +SA        R+I+  T   L+TSQLV C +++APTI+   C  Q++     V  +++     +    N+              LL  V  A T V   L+ L  H++
Sbjct:  608 LLGAAKNLACAVSDMLKTAQPANTEP----RQNLLQAAGNVGQTSGELLSHIGETD-------------------TDPQFQEMLMQLAKAVANAAAALVLKAKNVAQKTEDSAQQ-----NRVIAAATQCALSTSQLVACTRVVAPTISSPVCQEQLIEASKLVAKSVEGCVGASQSATNDEG------------LLKQVGVAATGVTQTLNELLQHIK 786          
BLAST of Talin vs. Ensembl Medaka
Match: tln2a (talin-2 [Source:NCBI gene;Acc:101173776])

HSP 1 Score: 310.071 bits (793), Expect = 5.355e-84
Identity = 158/345 (45.80%), Postives = 254/345 (73.62%), Query Frame = 2
Query:  440 DDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNT--KTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHR 1468
            D   KT++VDDS +V EL++ +C+++GI N+EEYSL+++  + +   + T T  K  +  +++ K++K+K KL TDDD+NWL+ S+T R+Q +D+ E LL++RK+F+SD N+D+RDP+QL+LL++Q+++ I+NG HPVS  +A + A +Q Q + G     K+K   + LKE +PK+Y+K +G EK+I + +        IEAK +Y  L RSL+TYG++FFLVKEK+K K+KL+PRLLG++++ V+R+DEKTK++++ WPLT+++RWA S  +FT+DFGEY    YY+ QT +GEQISQLI+GY+DII+K ++S++    +G EES++ E  + P ++ I++ +
Sbjct:    3 DGAVKTIMVDDSKTVGELLVTICSRIGITNYEEYSLIQET-VEEKKEDGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDDNETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGIQAQIQFGSHIEHKHKPGFLDLKEFLPKEYIKQRGAEKKIFQEHKNCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKSKNKLVPRLLGITKESVMRVDEKTKDVVQEWPLTTVKRWAASPKSFTLDFGEY-QESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQ 345          

HSP 2 Score: 75.8702 bits (185), Expect = 7.294e-13
Identity = 74/218 (33.94%), Postives = 105/218 (48.17%), Query Frame = 2
Query: 2348 NLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLR 3001
            +L+ AAR LA A S +L AV+P   E     R+ +L AA  +G+AS  L RQI  ++                   +D  F+D L+ L K+VANA A LV   K V+Q   A D ++   R+I+  T   L+TSQLV C K+++PTI+   C  Q++    E    +D   +V S I        D        LL  V  A + V  AL +L  H+R
Sbjct:  517 DLMKAARTLAGAVSDLLKAVEPASGEP----RQTVLTAAGSIGQASGDLLRQIGENE-------------------TDERFQDVLMNLAKAVANAAAMLVLKAKNVAQ--VAEDTVLQ-NRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLI----EAGKLVDR--SVESCIQACLSATEDGE------LLKQVSAAASVVSQALADLLQHVR 696          
BLAST of Talin vs. Planmine SMEST
Match: SMESG000037841.1 (SMESG000037841.1)

HSP 1 Score: 4552.66 bits (11807), Expect = 0.000e+0
Identity = 2365/2430 (97.33%), Postives = 2381/2430 (97.98%), Query Frame = 2
Query:  128 MKTILSGSTIVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPSRNVTNTKTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHRSSFQMKSLEDISREIQIAITTPTEDFSQIASVFDSSQVDVTCITSMPQSSEDQTNRSDNCDFDNINLIDTANRKIDNEFDRTQMIGKGLEDRELDSAMSFGTSRGVHNFYSNSRNTMNSPDAIRMLNHSPDSFMTGGTRICHTVRRLNVTQQSLLQNINVNLDKLQTSKLLLNXXXXXXXXXXXXXXXXXXHIQVISKEHAIHNLGSMNTEVVQVLRSSKHAPLTAVAVDNLKENNNQHLKDIEKSFKIITVHFPSFIDNVRMXXXXXXXXXXXXXXXXXXXXXXXFSEEKSENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLRCGITVVNFAPRIQSLELFLTEYDRLKNIFILNLSNKRSNKPDDLLESLSNFLIISGKINEEILFLCDQEQNQEDPLMESQKIFAAIIVKILAINKRWSSDFPDLLKDLYYEVDNLVLSLLYQPGTRIISHDQLIHNLYRSAQTLITCSHKLITSYHQVLLNDELSPECAEVIERSEHILVIMNSLKFYPTDDKILTAFIRDSEKLAQSCVTFCRNIHNTIPNTSXXXXXXXXXXXXSQTLAECEHMEQTIKCVKPIKAHLELAAVAKMLTEHRLENLHKQFPKNTQPKLNLSQLFHISIAILEKMRNNIEQTLPRAHFSTMFEMYNFENTEPSLIINLYHHLVKMNEIIETESELDMQSRFKNVILMVYRLVALADTLLISYGQHPAIHYPLIKNVDEILSTVSSLQSKSGNVFDKFKANILNKQNIFRSKSSNILANSNMESGNSFDFYYDKANIAAKMLVENCSCCKQNYGSSKLTDDVLAVQQAFNEIAECCEWILNLAGDTRIIDEFIILSLSLLNFVLEIENSLTSSEDQLIVKRISNKFRAVSESTVKLKEILTKTFMKHRGIFHSIISKLEETKTHLRNTQLGHPVKWEKTIFVNLLMKNMTIKVNNEQLRQIVEVNQSVNFDKQLLCIMESIADICLLICEKFEPFEERNQIITRSIDLSLNIINMSLKMFQTKESTNLIKKLGFYMKDLTDNISFLINCVREQIPGYKEXXXXXXXXXXXXYDVQEIEFSIASENETIKKTKQFNTEDEKKAAECLYKMATSVFNIQLSLENETVPDQKLPGDIEEFTNYLTELMQLVIHFAKNDSALSEVKLYVDYANQLVDYSDRYLQDVKQYFNNIGAEDVPKHSDANMTDLINYIVKFLHQFDSTIAQHILSILESRNKNVKLIENEPTSDLANTMSGMITDDDTTILFASAGIKNCDLENYQDILSGKFLLNGEHKTVASFKNDAHCNVSNGFRNLVQKTAEALVLDTQTLVQNSGDKQKSLATNTESVILTISNLADECESGFVHETRKLSEAKMMNAIQSVKSALNNTYSDRSAEFSRLIVSNSPSLVNHDSNNGNLEVTDIYSIEETILNIQNRLERFDDKIAHQINNSKNMETVHSRIDSLMEKXXXXXXXXXXXXXXXMRMPFQKLFQTPEQTCSIVTNISNQCQATLFDYLDSLEELAFRVTNRKINQKIMSIGKTLSNQFIKFFQILQKIQRHPDNKFNKSSMLDVFYEIQNCIKIFLEFSEEVQKSLENQISPTRKVSFKDSSFVNLNQNCVSTPKQHMKADSLVSTKEKIVQFNKIMFDLTHSNQVTVNNKEAVFLKFFIEILVRFVKVSSDLIGLSKHCNDQKSFADLQTNFPLAINSDIAICFDQISEALRICVYVRNRNLNDQLMEIKAYIKEIASKSADLLTYYRNQAIKSSWHELLQSVALDLRNVSKEILQXXXXXXXXXXXQDPNQPGQTFICKSSAVSSCK 7417
            MKTILSGSTIVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDP RN+TNTKTSSNEKEQDKLDKMKKKLQTDDDINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTEAEQLAALQCQAELGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHRSSFQMKSLEDISREIQIAITTPTEDFSQIASVFDSSQVDVTCITSMPQSSEDQTNRSDNCDFDNINL DTANRKIDNEFDRTQMIGKGLEDRELDSAMSFGTSRGVHNFYSNSRNTMNSPDAIRMLNHSPDSFMTGGTRICHTVRRLNVTQQSLLQNINVNLDKLQ SKLLLNDKLDKEILEKYEKEEERKHIQVISKEHAIHNLGSMNTEVVQVLRSSKHAPLTAVAVDNL ENNNQHLKDIEKSFKIITVHFPSFIDNVRMISDINTSTIDDITEIKTTDAEEDFSEEKSENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTSSDSGSRLGRLLQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLT VEGALTNVRHALDNLEDHLRCGITVVNFAPRIQSLELFLTEYDRLKNIFILNLSNKRSNKPDDLLESLSNFLIISGKINEEILFLCDQEQNQEDPLMESQKIFAAIIVKILAINKRWSSDFPDLLKDLYYEVDNLVLSLLYQPGTRIISHDQLIHNLYRSAQTLITCSHKLITSYHQVLLNDELSPECAEVIERSEHILVIMNSLKFYPTDDKILTAFIRDSEKLAQSCVTFCRNIHNTIPNTSDDIMIDIMAIAASQTLAECEHMEQTIKCVKPIKAHLELAAVAKMLTEHRLENLHKQFPKNTQPKLNLSQLFHISIAILEKMRNNIEQTLPRAHFSTMFEMYNFENTEPSLIINLYHHLVKMNEIIETESELDMQSRFKNVILMVYRLVALADTLLISYGQHPAIHYPLIKNVDEILSTVSSLQSKSGNVFDKFKANILNKQNIFRSKSSNILANSNMESGNSFDFYYDKANIAAKMLVENCSCCKQNYGSSKLTDDVLAVQQAFNEIAECCEWILNLAGDTRIIDEFIILSLSLLNFVLEIENSLTSSEDQLIVKRISNKFRAVSESTVKLKEILTKTFMKHRGIFHSIISKLEETKTHLRNTQLGHPVKWEKTIFVNLLMKNMTIKVNNEQLRQIVEVNQSVNFDKQLLCIMESIADICLLICEKFE FEERNQIITRSIDLSLNIINMSLKMFQTKESTNLIKKLGFYMKDLTDNISFLINCVREQIPGYKESSSALAVVAQLSYDVQEIEFSIASENETIKKTKQFNTEDEKKAAECLYKMATSVFNIQLSLENETVPDQKLPGDIEEFTNYLTELMQLVIHFAKNDSALSE+KLYVDYANQLVDYSDRYLQDVKQYFNNIGAEDVPKHSDANMTDLINYIVKFLHQFDSTIAQHILSILESRNKNVKL+ENEPTSDLANTMSGMITDDDTTILFASAGIKNCDLENYQDILSGKFLLNGEHKTVASFKNDAHCNVSNGFRNLVQKTAEALVLDTQTLVQNSGDKQKSLATNTESVILTISNLADECESGFVHETRKLSEAKMMNAIQSVKSALNNTYSDRSAEFSRLIVSNSPSLVNHDSNNGNLEVTDIYSIEETILNIQNRLERFDDKIAHQINNSKNM+TVHSRIDSLMEKL + + +V    ++L+    +  +Q P                 +      +  +   VTN KINQKIMSIGKTLSNQFIKFFQILQKIQRHPDNKFNKSSMLDVFYEIQNCIKIFLEFSEEVQKSLENQISPTRKVSFKDSSFVNLNQNCVSTPKQHMKADSLVSTKEKIVQFNKIMFDLTHSNQVT+NNKEAVFLKFFIEILVRFVKVSSDLIGLSKHCNDQKSFADLQTNFPLAINSDIAICFDQISEALRICVYVRNRNLNDQLMEIKAYIKEIASKSADLLTYYRNQAIKSSWHELLQSVALDLRNVSKEILQSNISNSTSSNIQDPNQPGQTFICKSSAVSSCK
Sbjct:    1 MKTILSGSTIVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPFRNLTNTKTSSNEKEQDKLDKMKKKLQTDDDINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTEAEQLAALQCQAELGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHRSSFQMKSLEDISREIQIAITTPTEDFSQIASVFDSSQVDVTCITSMPQSSEDQTNRSDNCDFDNINLTDTANRKIDNEFDRTQMIGKGLEDRELDSAMSFGTSRGVHNFYSNSRNTMNSPDAIRMLNHSPDSFMTGGTRICHTVRRLNVTQQSLLQNINVNLDKLQNSKLLLNDKLDKEILEKYEKEEERKHIQVISKEHAIHNLGSMNTEVVQVLRSSKHAPLTAVAVDNLNENNNQHLKDIEKSFKIITVHFPSFIDNVRMISDINTSTIDDITEIKTTDAEEDFSEEKSENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTSSDSGSRLGRLLQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTDVEGALTNVRHALDNLEDHLRCGITVVNFAPRIQSLELFLTEYDRLKNIFILNLSNKRSNKPDDLLESLSNFLIISGKINEEILFLCDQEQNQEDPLMESQKIFAAIIVKILAINKRWSSDFPDLLKDLYYEVDNLVLSLLYQPGTRIISHDQLIHNLYRSAQTLITCSHKLITSYHQVLLNDELSPECAEVIERSEHILVIMNSLKFYPTDDKILTAFIRDSEKLAQSCVTFCRNIHNTIPNTSDDIMIDIMAIAASQTLAECEHMEQTIKCVKPIKAHLELAAVAKMLTEHRLENLHKQFPKNTQPKLNLSQLFHISIAILEKMRNNIEQTLPRAHFSTMFEMYNFENTEPSLIINLYHHLVKMNEIIETESELDMQSRFKNVILMVYRLVALADTLLISYGQHPAIHYPLIKNVDEILSTVSSLQSKSGNVFDKFKANILNKQNIFRSKSSNILANSNMESGNSFDFYYDKANIAAKMLVENCSCCKQNYGSSKLTDDVLAVQQAFNEIAECCEWILNLAGDTRIIDEFIILSLSLLNFVLEIENSLTSSEDQLIVKRISNKFRAVSESTVKLKEILTKTFMKHRGIFHSIISKLEETKTHLRNTQLGHPVKWEKTIFVNLLMKNMTIKVNNEQLRQIVEVNQSVNFDKQLLCIMESIADICLLICEKFESFEERNQIITRSIDLSLNIINMSLKMFQTKESTNLIKKLGFYMKDLTDNISFLINCVREQIPGYKESSSALAVVAQLSYDVQEIEFSIASENETIKKTKQFNTEDEKKAAECLYKMATSVFNIQLSLENETVPDQKLPGDIEEFTNYLTELMQLVIHFAKNDSALSEIKLYVDYANQLVDYSDRYLQDVKQYFNNIGAEDVPKHSDANMTDLINYIVKFLHQFDSTIAQHILSILESRNKNVKLVENEPTSDLANTMSGMITDDDTTILFASAGIKNCDLENYQDILSGKFLLNGEHKTVASFKNDAHCNVSNGFRNLVQKTAEALVLDTQTLVQNSGDKQKSLATNTESVILTISNLADECESGFVHETRKLSEAKMMNAIQSVKSALNNTYSDRSAEFSRLIVSNSPSLVNHDSNNGNLEVTDIYSIEETILNIQNRLERFDDKIAHQINNSKNMQTVHSRIDSLMEKLNAISKTVSNSRTDLLN---RDEYQQP-------------MSGNVIRLSGLIRGIGISVTNSKINQKIMSIGKTLSNQFIKFFQILQKIQRHPDNKFNKSSMLDVFYEIQNCIKIFLEFSEEVQKSLENQISPTRKVSFKDSSFVNLNQNCVSTPKQHMKADSLVSTKEKIVQFNKIMFDLTHSNQVTINNKEAVFLKFFIEILVRFVKVSSDLIGLSKHCNDQKSFADLQTNFPLAINSDIAICFDQISEALRICVYVRNRNLNDQLMEIKAYIKEIASKSADLLTYYRNQAIKSSWHELLQSVALDLRNVSKEILQSNISNSTSSNIQDPNQPGQTFICKSSAVSSCK 2414          

HSP 2 Score: 60.8474 bits (146), Expect = 1.931e-8
Identity = 28/28 (100.00%), Postives = 28/28 (100.00%), Query Frame = 1
Query: 6418 NAISKTVSNSRTDLLNRDEYQQPMSGNV 6501
            NAISKTVSNSRTDLLNRDEYQQPMSGNV
Sbjct: 2082 NAISKTVSNSRTDLLNRDEYQQPMSGNV 2109          
BLAST of Talin vs. Planmine SMEST
Match: SMESG000066444.1 (SMESG000066444.1)

HSP 1 Score: 483.411 bits (1243), Expect = 2.886e-137
Identity = 258/444 (58.11%), Postives = 332/444 (74.77%), Query Frame = 2
Query:  143 SGSTIVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPS--RNVTNTKTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKN-KGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEH 1465
            S     L+IHIV A  TK +PLD  + I+ +CE IR  IREA+ ++    K YGL+LPH+  K GLWLDN K L  YILK GD IEYR R RWL IR+ D   KTL VDDSW+VSELM+ +C K+GI N++EYSL+ D     P   + ++     S  K+Q+KLDK+KKK  T+D +NWLNPSQ+LRQQ I+E EVLL++RKYFFSDMN+D+RDPIQLSLL+ Q K+A+ING HPV++ EA +LA LQCQ +LG+ +  K K   + L+EC+PK+Y KN K +EK+I   +S  +    +EAK +YC LCRS KTYGITFFLVKEK+ GK+KLIPRLLGV+++ V+++DEKTKEII TWPLTSIR+WA SFN FTMDFGEY+P+EYYTAQT+KGE+ISQLI+GY+DII+K +K+++    D  EES + E  I P++A IVEH
Sbjct:    4 SNGNFELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKS---PKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKHGISINKDQEKLDKLKKKYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEH 444          

HSP 2 Score: 132.109 bits (331), Expect = 4.652e-30
Identity = 100/316 (31.65%), Postives = 160/316 (50.63%), Query Frame = 2
Query: 2057 SKEHAIHNLGSMNTEVVQVLRSSKHAPLTAVAVDNLKENNNQHLKDIEKSFKIITVHFPSFIDNVRMXXXXXXXXXXXXXXXXXXXXXXXFSEEKSENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVS-QNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLR 3001
            S++     +G+MN  V QVLRS++   L  +  +  +E N + +  ++ SF +ITVH PS ++ +R  +       D               +   E LI AA++LADAF+ ++ A  P E+++    RK I DAAN VGEASS L +QIT  +   +           ++   D+ +++ L+ L KSVAN T  L++ VK ++ + E+ SD     ++++   T  GLA SQL++  KI+APTI Q+ C  Q++  I +V   I  V   +           + + Q+  L    V+ A   V+ ALD L  HLR
Sbjct:  576 SRQRMADEIGAMNAAVAQVLRSAQG--LATIEENEEEEMNEEMIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTD--------------EDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQ----KKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESS-----------NKATQSEELQDLTVQAA-NQVQEALDTLMKHLR 859          
BLAST of Talin vs. Planmine SMEST
Match: SMESG000066444.1 (SMESG000066444.1)

HSP 1 Score: 482.641 bits (1241), Expect = 3.891e-137
Identity = 258/444 (58.11%), Postives = 332/444 (74.77%), Query Frame = 2
Query:  143 SGSTIVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPS--RNVTNTKTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKN-KGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEH 1465
            S     L+IHIV A  TK +PLD  + I+ +CE IR  IREA+ ++    K YGL+LPH+  K GLWLDN K L  YILK GD IEYR R RWL IR+ D   KTL VDDSW+VSELM+ +C K+GI N++EYSL+ D     P   + ++     S  K+Q+KLDK+KKK  T+D +NWLNPSQ+LRQQ I+E EVLL++RKYFFSDMN+D+RDPIQLSLL+ Q K+A+ING HPV++ EA +LA LQCQ +LG+ +  K K   + L+EC+PK+Y KN K +EK+I   +S  +    +EAK +YC LCRS KTYGITFFLVKEK+ GK+KLIPRLLGV+++ V+++DEKTKEII TWPLTSIR+WA SFN FTMDFGEY+P+EYYTAQT+KGE+ISQLI+GY+DII+K +K+++    D  EES + E  I P++A IVEH
Sbjct:   14 SNGNFELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKS---PKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKHGISINKDQEKLDKLKKKYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEH 454          

HSP 2 Score: 132.109 bits (331), Expect = 4.503e-30
Identity = 100/316 (31.65%), Postives = 160/316 (50.63%), Query Frame = 2
Query: 2057 SKEHAIHNLGSMNTEVVQVLRSSKHAPLTAVAVDNLKENNNQHLKDIEKSFKIITVHFPSFIDNVRMXXXXXXXXXXXXXXXXXXXXXXXFSEEKSENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVS-QNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLR 3001
            S++     +G+MN  V QVLRS++   L  +  +  +E N + +  ++ SF +ITVH PS ++ +R  +       D               +   E LI AA++LADAF+ ++ A  P E+++    RK I DAAN VGEASS L +QIT  +   +           ++   D+ +++ L+ L KSVAN T  L++ VK ++ + E+ SD     ++++   T  GLA SQL++  KI+APTI Q+ C  Q++  I +V   I  V   +           + + Q+  L    V+ A   V+ ALD L  HLR
Sbjct:  586 SRQRMADEIGAMNAAVAQVLRSAQG--LATIEENEEEEMNEEMIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTD--------------EDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQ----KKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESS-----------NKATQSEELQDLTVQAA-NQVQEALDTLMKHLR 869          
BLAST of Talin vs. Planmine SMEST
Match: SMESG000066444.1 (SMESG000066444.1)

HSP 1 Score: 482.641 bits (1241), Expect = 4.117e-137
Identity = 258/444 (58.11%), Postives = 332/444 (74.77%), Query Frame = 2
Query:  143 SGSTIVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPS--RNVTNTKTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKN-KGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEH 1465
            S     L+IHIV A  TK +PLD  + I+ +CE IR  IREA+ ++    K YGL+LPH+  K GLWLDN K L  YILK GD IEYR R RWL IR+ D   KTL VDDSW+VSELM+ +C K+GI N++EYSL+ D     P   + ++     S  K+Q+KLDK+KKK  T+D +NWLNPSQ+LRQQ I+E EVLL++RKYFFSDMN+D+RDPIQLSLL+ Q K+A+ING HPV++ EA +LA LQCQ +LG+ +  K K   + L+EC+PK+Y KN K +EK+I   +S  +    +EAK +YC LCRS KTYGITFFLVKEK+ GK+KLIPRLLGV+++ V+++DEKTKEII TWPLTSIR+WA SFN FTMDFGEY+P+EYYTAQT+KGE+ISQLI+GY+DII+K +K+++    D  EES + E  I P++A IVEH
Sbjct:   14 SNGNFELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKS---PKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKHGISINKDQEKLDKLKKKYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEH 454          

HSP 2 Score: 132.109 bits (331), Expect = 4.638e-30
Identity = 100/316 (31.65%), Postives = 160/316 (50.63%), Query Frame = 2
Query: 2057 SKEHAIHNLGSMNTEVVQVLRSSKHAPLTAVAVDNLKENNNQHLKDIEKSFKIITVHFPSFIDNVRMXXXXXXXXXXXXXXXXXXXXXXXFSEEKSENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVS-QNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLR 3001
            S++     +G+MN  V QVLRS++   L  +  +  +E N + +  ++ SF +ITVH PS ++ +R  +       D               +   E LI AA++LADAF+ ++ A  P E+++    RK I DAAN VGEASS L +QIT  +   +           ++   D+ +++ L+ L KSVAN T  L++ VK ++ + E+ SD     ++++   T  GLA SQL++  KI+APTI Q+ C  Q++  I +V   I  V   +           + + Q+  L    V+ A   V+ ALD L  HLR
Sbjct:  586 SRQRMADEIGAMNAAVAQVLRSAQG--LATIEENEEEEMNEEMIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTD--------------EDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQ----KKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESS-----------NKATQSEELQDLTVQAA-NQVQEALDTLMKHLR 869          
BLAST of Talin vs. Planmine SMEST
Match: SMESG000066444.1 (SMESG000066444.1)

HSP 1 Score: 482.641 bits (1241), Expect = 4.140e-137
Identity = 258/444 (58.11%), Postives = 332/444 (74.77%), Query Frame = 2
Query:  143 SGSTIVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPETGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLTIRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPS--RNVTNTKTSSNXXXXXXXXXXXXXXXXXXXINWLNPSQTLRQQSIDEQEVLLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTXXXXXXXXXXXXXXGDIATQKNKLTKITLKECVPKDYVKN-KGIEKRIVKIYSTLRGKDNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLRLDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQISQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEH 1465
            S     L+IHIV A  TK +PLD  + I+ +CE IR  IREA+ ++    K YGL+LPH+  K GLWLDN K L  YILK GD IEYR R RWL IR+ D   KTL VDDSW+VSELM+ +C K+GI N++EYSL+ D     P   + ++     S  K+Q+KLDK+KKK  T+D +NWLNPSQ+LRQQ I+E EVLL++RKYFFSDMN+D+RDPIQLSLL+ Q K+A+ING HPV++ EA +LA LQCQ +LG+ +  K K   + L+EC+PK+Y KN K +EK+I   +S  +    +EAK +YC LCRS KTYGITFFLVKEK+ GK+KLIPRLLGV+++ V+++DEKTKEII TWPLTSIR+WA SFN FTMDFGEY+P+EYYTAQT+KGE+ISQLI+GY+DII+K +K+++    D  EES + E  I P++A IVEH
Sbjct:   14 SNGNFELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKS---PKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKHGISINKDQEKLDKLKKKYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEH 454          

HSP 2 Score: 132.109 bits (331), Expect = 4.518e-30
Identity = 100/316 (31.65%), Postives = 160/316 (50.63%), Query Frame = 2
Query: 2057 SKEHAIHNLGSMNTEVVQVLRSSKHAPLTAVAVDNLKENNNQHLKDIEKSFKIITVHFPSFIDNVRMXXXXXXXXXXXXXXXXXXXXXXXFSEEKSENLIDAARKLADAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSVMTXXXXXXXXXXXXQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVS-QNESASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEINEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHALDNLEDHLR 3001
            S++     +G+MN  V QVLRS++   L  +  +  +E N + +  ++ SF +ITVH PS ++ +R  +       D               +   E LI AA++LADAF+ ++ A  P E+++    RK I DAAN VGEASS L +QIT  +   +           ++   D+ +++ L+ L KSVAN T  L++ VK ++ + E+ SD     ++++   T  GLA SQL++  KI+APTI Q+ C  Q++  I +V   I  V   +           + + Q+  L    V+ A   V+ ALD L  HLR
Sbjct:  586 SRQRMADEIGAMNAAVAQVLRSAQG--LATIEENEEEEMNEEMIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTD--------------EDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQ----KKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESS-----------NKATQSEELQDLTVQAA-NQVQEALDTLMKHLR 869          
The following BLAST results are available for this feature:
BLAST of Talin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TLN28.291e-10544.75talin 2 [Source:HGNC Symbol;Acc:HGNC:15447][more]
TLN14.396e-9944.09talin 1 [Source:HGNC Symbol;Acc:HGNC:11845][more]
FERMT22.267e-832.08fermitin family member 2 [Source:HGNC Symbol;Acc:H... [more]
FERMT24.173e-725.00fermitin family member 2 [Source:HGNC Symbol;Acc:H... [more]
FERMT24.173e-725.00fermitin family member 2 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Talin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tln-11.196e-9238.12TaLiN [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUD9][more]
tln-11.640e-9038.28TaLiN [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUD9][more]
tln-13.882e-2245.92TaLiN [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUD9][more]
tln-17.571e-2245.92TaLiN [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUD9][more]
back to top
BLAST of Talin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rhea3.276e-10743.46gene:FBgn0260442 transcript:FBtr0333109[more]
rhea1.844e-10043.56gene:FBgn0260442 transcript:FBtr0305211[more]
rhea1.844e-10043.56gene:FBgn0260442 transcript:FBtr0305212[more]
rhea5.338e-10043.56gene:FBgn0260442 transcript:FBtr0333108[more]
rhea5.693e-10043.56gene:FBgn0260442 transcript:FBtr0333107[more]
back to top
BLAST of Talin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tln13.800e-10144.65talin 1 [Source:ZFIN;Acc:ZDB-GENE-031002-48][more]
tln2a9.929e-10042.40talin 2a [Source:ZFIN;Acc:ZDB-GENE-040724-263][more]
tln2a1.102e-9942.69talin 2a [Source:ZFIN;Acc:ZDB-GENE-040724-263][more]
tln11.246e-9744.19talin 1 [Source:ZFIN;Acc:ZDB-GENE-031002-48][more]
CABZ01046980.11.300e-5439.72pep chromosome:GRCz11:25:33002963:33016471:1 gene:... [more]
back to top
BLAST of Talin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TLN27.374e-10342.92talin 2 [Source:NCBI gene;Acc:100144637][more]
TLN27.519e-10342.92talin 2 [Source:NCBI gene;Acc:100144637][more]
TLN28.304e-10342.92talin 2 [Source:NCBI gene;Acc:100144637][more]
TLN21.044e-10242.92talin 2 [Source:NCBI gene;Acc:100144637][more]
TLN21.095e-10242.92talin 2 [Source:NCBI gene;Acc:100144637][more]
back to top
BLAST of Talin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tln25.790e-10544.75talin 2 [Source:MGI Symbol;Acc:MGI:1917799][more]
Tln25.790e-10544.75talin 2 [Source:MGI Symbol;Acc:MGI:1917799][more]
Tln25.850e-10544.75talin 2 [Source:MGI Symbol;Acc:MGI:1917799][more]
Tln18.003e-9943.76talin 1 [Source:MGI Symbol;Acc:MGI:1099832][more]
Tln14.668e-4640.43talin 1 [Source:MGI Symbol;Acc:MGI:1099832][more]
back to top
BLAST of Talin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y4G6|TLN2_HUMAN3.982e-10444.75Talin-2 OS=Homo sapiens OX=9606 GN=TLN2 PE=1 SV=4[more]
sp|Q71LX4|TLN2_MOUSE3.451e-10345.24Talin-2 OS=Mus musculus OX=10090 GN=Tln2 PE=1 SV=3[more]
sp|Q9Y490|TLN1_HUMAN2.111e-9844.09Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3[more]
sp|P26039|TLN1_MOUSE5.598e-9843.76Talin-1 OS=Mus musculus OX=10090 GN=Tln1 PE=1 SV=2[more]
sp|P54939|TLN1_CHICK8.850e-9843.76Talin-1 OS=Gallus gallus OX=9031 GN=TLN1 PE=1 SV=2[more]
back to top
BLAST of Talin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YNR71.694e-17734.53Talin OS=Fasciola gigantica OX=46835 GN=FGIG_00042... [more]
A0A564YWH54.813e-16534.04FERM domain-containing protein OS=Hymenolepis dimi... [more]
A0A4E0S2C91.887e-13655.30Talin OS=Fasciola hepatica OX=6192 GN=D915_001787 ... [more]
G4V6537.700e-13651.80Putative talin 2 OS=Schistosoma mansoni OX=6183 GN... [more]
H2KNJ22.667e-13556.18Talin OS=Clonorchis sinensis OX=79923 GN=CLF_10027... [more]
back to top
BLAST of Talin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tln2b3.636e-10243.31talin 2b [Source:ZFIN;Acc:ZDB-GENE-130325-1][more]
tln19.256e-10043.51talin 1 [Source:ZFIN;Acc:ZDB-GENE-031002-48][more]
tln2a3.223e-9942.33talin-2-like [Source:NCBI gene;Acc:103042966][more]
fermt26.871e-925.85fermitin family member 2 [Source:NCBI gene;Acc:553... [more]
fermt22.293e-724.48fermitin family member 2 [Source:NCBI gene;Acc:553... [more]
back to top
BLAST of Talin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000003776.12.723e-9140.85pep scaffold:Pmarinus_7.0:GL481036:4073:28398:-1 g... [more]
ENSPMAT00000007752.11.702e-4451.02pep scaffold:Pmarinus_7.0:GL478287:501:47681:-1 ge... [more]
ENSPMAT00000007037.16.157e-3941.04pep scaffold:Pmarinus_7.0:GL476737:73889:120616:-1... [more]
ENSPMAT00000010194.11.379e-727.81pep scaffold:Pmarinus_7.0:GL480176:295:15370:1 gen... [more]
back to top
BLAST of Talin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Talin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO477771.169e-9543.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492698.640e-1033.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356583.638e-825.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365655.229e-824.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Talin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tln2a1.403e-10143.61talin-2 [Source:NCBI gene;Acc:101173776][more]
tln2a1.438e-10143.61talin-2 [Source:NCBI gene;Acc:101173776][more]
tln2b9.600e-10142.89talin 2 [Source:NCBI gene;Acc:101167954][more]
tln11.052e-9943.96talin 1 [Source:NCBI gene;Acc:101157630][more]
tln2a5.355e-8445.80talin-2 [Source:NCBI gene;Acc:101173776][more]
back to top
BLAST of Talin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037841.11.931e-897.33SMESG000037841.1[more]
SMESG000066444.12.886e-13758.11SMESG000066444.1[more]
SMESG000066444.13.891e-13758.11SMESG000066444.1[more]
SMESG000066444.14.117e-13758.11SMESG000066444.1[more]
SMESG000066444.14.140e-13758.11SMESG000066444.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020158 ID=SMED30020158|Name=Talin|organism=Schmidtea mediterranea sexual|type=transcript|length=7571bp
GTCTCTGATTCAGTCGTTTACTCTTCCTGATAGCAAAATTTCGGAAATTT
CTTTCGATAATTTACTGTGGGTTGATCCTTCTATTTTATCTTTTTTTTGA
ATTTATACTTATAGATTTTTGGATCAAATGAAAACAATATTATCCGGAAG
CACAATTGTGCTTAAAATCCACATTGTCCATGCTGGAGCAACAAAGTCAA
TTCCTTTGGATTTTAATTCACCAATTTATGCGGTCTGTGAACATATTAGA
TTGATGATAAGAGAAGCCGAACCAGAGACTGGAAGAGAAAGTAAAGATTA
TGGTCTATTTCTACCACATGAAATGAGTAAAAATGGCTTGTGGCTGGACA
ACATGAAAAATCTTGTACAATATATTCTTAAACCCGGAGATTTGATTGAA
TACAGATATCGGTATAGATGGTTAACAATTCGGTCTCAAGATGACATCAA
GAAAACGCTTCTTGTTGATGACAGCTGGAGTGTATCGGAACTCATGATAT
TATTATGTGCTAAGATGGGTATTATAAATCATGAAGAATATTCCCTAATG
AAAGACAATCAATTGAATGATCCCTCCCGGAATGTGACTAACACAAAGAC
AAGTTCAAATGAAAAAGAACAAGACAAGTTGGATAAAATGAAAAAGAAAC
TCCAGACTGATGACGACATAAATTGGCTGAATCCATCTCAAACTTTGAGA
CAACAAAGTATTGATGAGCAGGAGGTCCTTCTAATTCAAAGGAAATATTT
TTTCTCAGATATGAACATAGATACTCGAGATCCTATTCAACTGAGTCTTC
TATTCATTCAGTCGAAAGAAGCAATAATTAATGGCAAGCACCCGGTTTCG
ATGACGGAGGCTGAGCAGTTGGCTGCTCTCCAATGTCAAGCAGAACTCGG
AGACATTGCCACACAGAAAAATAAATTAACTAAAATCACCCTTAAAGAAT
GTGTTCCAAAAGACTATGTTAAAAACAAGGGTATTGAAAAACGAATTGTC
AAAATTTACTCAACGCTACGGGGGAAAGATAATATCGAAGCAAAACGAGA
ATATTGCGCTTTATGTCGTTCATTGAAAACATATGGGATCACTTTCTTTT
TAGTTAAAGAAAAAATTAAAGGTAAAAGTAAACTGATTCCACGACTTCTA
GGTGTGAGCCGGGATCGAGTATTGAGACTTGATGAAAAAACAAAAGAAAT
TATAAAAACATGGCCTTTGACATCCATTAGACGATGGGCGGGATCCTTCA
ATGCTTTTACAATGGACTTTGGAGAATATGCACCAAATGAATATTATACG
GCACAAACAAACAAGGGAGAACAGATTTCACAGCTCATATCAGGCTATGT
GGACATTATAATCAAGCACCAAAAATCTCAGGAACCTCAAAACGCAGACG
GCTTTGAAGAAAGTTCTGTTGCTGAAATCAAAATCGAACCAAACCAGGCT
GAAATTGTTGAGCATAGATCAAGTTTCCAAATGAAATCGCTAGAGGATAT
TTCTAGAGAGATTCAAATAGCCATCACTACTCCAACTGAGGATTTCAGTC
AAATTGCTTCTGTGTTTGATTCCTCTCAAGTAGACGTTACTTGTATCACC
TCAATGCCACAGTCTTCAGAAGATCAGACAAATAGATCAGACAATTGTGA
CTTTGACAACATCAACCTGATCGATACAGCAAACAGAAAAATTGACAATG
AATTCGACCGGACTCAAATGATTGGTAAAGGTTTGGAAGACAGAGAGTTA
GACTCGGCAATGAGCTTTGGTACTTCAAGAGGGGTTCATAATTTCTATTC
AAACTCCAGAAATACAATGAATTCGCCAGATGCTATTCGAATGTTGAACC
ATTCTCCTGACAGCTTTATGACTGGCGGGACTCGGATTTGTCATACGGTC
CGACGGTTAAATGTCACCCAGCAGTCTTTATTGCAGAATATCAATGTCAA
CTTGGATAAATTACAAACTTCAAAACTGCTTCTTAATGATAAACTCGATA
AAGAAATCTTAGAAAAGTACGAAAAAGAAGAAGAACGAAAACATATCCAA
GTTATCTCCAAGGAGCATGCAATTCACAATTTAGGTTCAATGAATACCGA
AGTCGTTCAAGTTTTGAGATCAAGTAAGCATGCGCCTCTAACTGCCGTCG
CCGTTGATAATCTAAAAGAGAACAATAACCAACATTTAAAAGACATAGAA
AAATCCTTTAAAATTATCACGGTTCACTTCCCATCATTCATTGATAATGT
TCGAATGATTTCTGACATAAACACGTCAACAATTGATGATATCACTGAAA
TTAAAACGACAGATGCCGAAGAAGATTTCTCCGAGGAAAAATCTGAGAAT
TTAATCGACGCTGCTCGTAAACTGGCCGATGCATTTTCCGGAATGTTAAA
TGCAGTGAAACCTCAAGAAGAAGAAAGAGACATTGATTTTCGAAAAGCCA
TTCTTGATGCTGCAAATAAAGTTGGCGAAGCCAGTAGTCAGCTGTTTCGA
CAAATTACGTTTTCTGATAGATCTGTTATGACCTCATCTGATAGTGGGAG
TCGGTTGGGACGACTGTTGCAGAATTCTGATCGGGACTTTGAAGACAGTT
TAATTTATTTGGTCAAGTCTGTTGCTAATGCCACGGCTCAACTTGTGCAA
GCTGTTAAAACAGTTTCTCAGAATGAAAGTGCTTCAGACGTTATTATCGG
ATGTCAACGATTGATCAGTCCGGTTACGCACGCTGGACTGGCAACCAGTC
AGCTGGTGACCTGCGTAAAGATTTTGGCTCCAACAATAAATCAGGCCAAT
TGCACCAGCCAAATCCTGGCAGAAATCAACGAAGTCAGATGTACAATTGA
TAACGTGGCTGCCGTGACGTCTGGTATTATTAATAACAATCGGGGCAATA
TGGACAATTCTCCACAAGCAAATAATTTATTGCTCACTCATGTCGAGGGG
GCTCTAACGAATGTTCGTCACGCCCTCGACAATCTGGAGGATCATTTAAG
ATGCGGAATTACAGTAGTCAATTTTGCTCCGAGAATCCAGAGCTTGGAGT
TGTTTTTGACGGAATACGACAGGTTGAAAAACATTTTCATTTTGAATTTA
TCCAACAAAAGAAGCAATAAACCGGACGATCTATTGGAGTCGCTGTCCAA
TTTTCTGATAATATCTGGGAAAATAAATGAAGAGATTCTGTTCCTCTGTG
ATCAAGAGCAAAACCAAGAAGATCCATTAATGGAGTCTCAAAAAATATTC
GCTGCGATTATCGTGAAAATTTTAGCAATCAATAAAAGATGGTCATCGGA
CTTTCCAGACCTTTTGAAAGATCTCTATTATGAAGTGGATAATCTAGTTC
TCAGCCTCCTTTACCAACCGGGAACGAGAATCATATCTCATGATCAATTA
ATCCACAACCTCTATAGGTCTGCACAAACGTTAATAACCTGTAGCCATAA
ACTGATAACAAGTTATCACCAAGTTTTATTGAATGACGAGCTGTCTCCTG
AATGCGCCGAAGTCATCGAAAGATCAGAACACATTCTAGTCATAATGAAT
AGTTTGAAATTCTATCCAACCGATGACAAAATATTGACAGCATTTATTAG
AGATTCAGAAAAATTGGCTCAGTCATGTGTAACATTCTGTCGGAATATCC
ACAATACGATACCGAACACGAGCGATGACATCATGATTGACATAATGGCC
ATTGCTGCCAGTCAAACTCTAGCCGAATGCGAGCACATGGAACAAACGAT
CAAGTGCGTCAAGCCGATCAAAGCCCATCTAGAGTTGGCAGCGGTAGCAA
AAATGTTGACTGAACACCGATTGGAAAATCTTCATAAGCAATTTCCAAAA
AATACTCAGCCCAAATTGAATTTATCCCAATTGTTTCATATTTCAATTGC
TATTCTTGAGAAAATGAGAAATAATATTGAACAAACTCTTCCTCGAGCTC
ATTTTTCCACGATGTTTGAAATGTACAATTTTGAGAATACAGAGCCATCG
CTTATCATAAATTTGTATCACCACCTGGTAAAGATGAATGAAATTATTGA
AACTGAGTCGGAACTTGATATGCAGTCGAGGTTCAAAAACGTTATTTTGA
TGGTTTATAGACTAGTGGCTCTTGCTGACACTTTACTGATTTCCTATGGC
CAGCATCCTGCTATTCATTATCCATTAATCAAGAATGTCGATGAAATTCT
CTCAACTGTGTCAAGCCTCCAATCAAAATCGGGAAATGTTTTCGATAAAT
TTAAGGCGAATATATTGAATAAACAAAATATTTTCCGATCAAAATCATCA
AATATTCTGGCAAACTCCAACATGGAATCGGGGAATTCGTTCGATTTCTA
TTACGACAAGGCAAACATAGCTGCAAAGATGCTTGTAGAAAATTGTTCAT
GTTGTAAGCAGAACTATGGAAGTTCTAAACTTACAGACGACGTGCTTGCA
GTGCAACAGGCATTCAATGAAATCGCAGAATGCTGCGAATGGATCCTAAA
TTTGGCGGGAGACACTCGGATCATCGATGAGTTCATCATTTTGTCTCTGT
CTTTATTGAATTTTGTGCTGGAAATTGAAAATTCATTGACATCGAGTGAA
GATCAATTGATAGTGAAAAGAATTAGTAATAAATTCAGAGCTGTGTCAGA
GTCAACAGTGAAACTGAAAGAGATACTCACAAAAACGTTTATGAAGCACC
GTGGAATATTCCACAGCATCATCTCGAAACTGGAAGAAACGAAAACCCAT
TTGAGAAACACTCAACTGGGCCACCCAGTAAAATGGGAGAAAACAATATT
TGTCAATTTGCTGATGAAAAATATGACAATCAAAGTAAACAATGAGCAGT
TGAGGCAAATCGTCGAAGTCAATCAGTCGGTAAATTTTGATAAACAATTG
TTGTGCATTATGGAATCAATCGCAGATATTTGTTTACTGATTTGTGAGAA
ATTCGAACCATTTGAAGAGAGAAATCAAATAATTACTCGCTCTATCGATT
TGTCTTTAAATATTATCAATATGTCTTTGAAAATGTTCCAAACGAAAGAA
TCGACAAATTTGATAAAGAAACTCGGATTTTATATGAAAGATTTGACGGA
TAATATTTCATTCCTGATTAATTGCGTCAGGGAGCAAATTCCAGGATATA
AAGAAAGCTCGAGTGCTTTAGCAGTTGTGGCTCAGCTGTCATATGATGTA
CAAGAAATAGAGTTTAGTATAGCTTCTGAAAATGAAACTATTAAAAAAAC
AAAACAATTTAATACTGAAGATGAAAAGAAAGCTGCAGAATGTTTATATA
AAATGGCCACCTCGGTATTTAATATTCAACTCTCTTTAGAGAATGAAACA
GTACCCGATCAAAAGCTTCCTGGTGATATCGAAGAATTTACTAATTATCT
TACTGAATTAATGCAACTAGTAATTCATTTTGCTAAGAACGATTCTGCGT
TGTCCGAAGTCAAACTGTATGTAGACTATGCAAATCAACTGGTAGATTAT
TCTGACAGATATTTGCAAGATGTAAAGCAATATTTCAACAATATTGGGGC
CGAAGATGTTCCAAAACACAGTGATGCCAATATGACAGACCTGATCAATT
ATATTGTGAAATTTCTACATCAATTCGACAGCACCATTGCACAGCATATC
TTATCAATCCTCGAATCCAGGAACAAAAATGTGAAACTGATTGAAAATGA
ACCGACTTCTGATTTAGCTAACACTATGAGCGGCATGATTACGGATGATG
ATACAACGATTTTGTTTGCAAGTGCTGGAATCAAGAATTGTGATTTAGAA
AATTACCAGGACATTCTCTCGGGAAAATTCTTGTTGAATGGCGAGCATAA
GACCGTGGCTTCGTTCAAAAATGATGCTCACTGCAACGTCTCAAACGGAT
TTCGAAATCTTGTCCAGAAAACTGCCGAAGCTCTCGTCCTTGACACCCAA
ACGCTGGTACAAAATAGTGGGGACAAGCAGAAATCTTTGGCAACCAACAC
TGAGTCCGTCATTTTGACAATTTCCAATTTAGCGGATGAATGTGAAAGCG
GATTTGTCCACGAAACACGAAAATTATCTGAAGCAAAAATGATGAACGCA
ATTCAGAGTGTGAAATCGGCTTTGAACAATACCTACAGCGACCGCAGTGC
AGAATTTTCAAGACTTATCGTATCTAACTCCCCATCTCTGGTGAATCATG
ACAGCAATAATGGAAACCTGGAAGTGACTGATATTTACTCAATTGAGGAA
ACAATACTCAACATCCAAAATCGCCTTGAAAGATTCGACGATAAGATCGC
TCATCAAATTAACAATTCAAAAAATATGGAAACAGTCCATTCAAGAATTG
ATAGTCTAATGGAGAAACTGGTCAGTCACGCCTCATCAGTTCTTGCGTTG
TCATCTGAACTGATGAGAATGCCATTTCAAAAACTGTTTCAAACTCCCGA
ACAGACCTGCTCAATCGTGACGAATATCAGCAACCAATGTCAGGCAACGT
TATTCGATTATCTGGACTCATTAGAGGAATTGGCATTTCGGGTGACGAAC
AGAAAAATCAATCAGAAAATCATGTCGATTGGAAAAACTTTATCGAATCA
ATTCATAAAATTTTTTCAAATCTTACAAAAAATTCAGAGACATCCCGATA
ACAAATTCAACAAATCTTCAATGCTCGATGTGTTCTATGAGATACAGAAT
TGTATCAAAATATTTTTGGAATTCTCCGAAGAAGTTCAAAAATCGTTGGA
AAACCAAATCTCGCCGACTAGAAAGGTTTCATTCAAGGATTCATCGTTTG
TAAATTTGAATCAAAATTGTGTGTCTACTCCGAAACAACATATGAAAGCA
GATTCCTTAGTGTCAACAAAAGAAAAAATCGTCCAATTTAACAAAATTAT
GTTTGATTTGACCCATTCAAATCAGGTTACCGTTAATAATAAAGAAGCCG
TATTCCTGAAGTTTTTCATCGAAATCCTTGTTAGGTTTGTCAAAGTTTCA
AGCGACTTAATTGGGTTATCAAAACATTGCAATGACCAAAAGAGTTTTGC
TGACCTTCAAACAAATTTTCCATTAGCAATTAATAGCGACATAGCCATTT
GTTTCGATCAAATCTCTGAAGCCTTGAGAATCTGTGTTTATGTTAGAAAC
AGAAATCTAAACGATCAACTGATGGAAATCAAGGCATATATAAAGGAGAT
AGCTAGCAAATCAGCTGATTTACTCACTTACTACAGAAATCAAGCGATTA
AATCATCGTGGCATGAGTTGCTTCAGTCAGTGGCACTTGATCTCAGAAAT
GTCAGCAAAGAAATCCTACAATCCAATATCTCAAACAGCACTTCATCGAA
CATCCAGGATCCAAACCAACCTGGCCAGACCTTCATCTGCAAATCCTCAG
CAGTTAGTTCTTGCAAATGATTTCATTGGGACAATATATTGCCAAAATTA
TTCGACATGTGCCTTTGTAAAATTTTTCTATAAAAATTGTTTCAATAGAC
ATAGAAAAGATAGATCTCACTTGGAGTTATACTTAATTATTTATAAATTG
TCACTAATAAATGGACATTTG
back to top

protein sequence of SMED30020158-orf-1

>SMED30020158-orf-1 ID=SMED30020158-orf-1|Name=SMED30020158-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=103bp
MSCFSQWHLISEMSAKKSYNPISQTALHRTSRIQTNLARPSSANPQQLVL
ANDFIGTIYCQNYSTCAFVKFFYKNCFNRHRKDRSHLELYLIIYKLSLIN
GHL
back to top

protein sequence of SMED30020158-orf-2

>SMED30020158-orf-2 ID=SMED30020158-orf-2|Name=SMED30020158-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2431bp
MKTILSGSTIVLKIHIVHAGATKSIPLDFNSPIYAVCEHIRLMIREAEPE
TGRESKDYGLFLPHEMSKNGLWLDNMKNLVQYILKPGDLIEYRYRYRWLT
IRSQDDIKKTLLVDDSWSVSELMILLCAKMGIINHEEYSLMKDNQLNDPS
RNVTNTKTSSNEKEQDKLDKMKKKLQTDDDINWLNPSQTLRQQSIDEQEV
LLIQRKYFFSDMNIDTRDPIQLSLLFIQSKEAIINGKHPVSMTEAEQLAA
LQCQAELGDIATQKNKLTKITLKECVPKDYVKNKGIEKRIVKIYSTLRGK
DNIEAKREYCALCRSLKTYGITFFLVKEKIKGKSKLIPRLLGVSRDRVLR
LDEKTKEIIKTWPLTSIRRWAGSFNAFTMDFGEYAPNEYYTAQTNKGEQI
SQLISGYVDIIIKHQKSQEPQNADGFEESSVAEIKIEPNQAEIVEHRSSF
QMKSLEDISREIQIAITTPTEDFSQIASVFDSSQVDVTCITSMPQSSEDQ
TNRSDNCDFDNINLIDTANRKIDNEFDRTQMIGKGLEDRELDSAMSFGTS
RGVHNFYSNSRNTMNSPDAIRMLNHSPDSFMTGGTRICHTVRRLNVTQQS
LLQNINVNLDKLQTSKLLLNDKLDKEILEKYEKEEERKHIQVISKEHAIH
NLGSMNTEVVQVLRSSKHAPLTAVAVDNLKENNNQHLKDIEKSFKIITVH
FPSFIDNVRMISDINTSTIDDITEIKTTDAEEDFSEEKSENLIDAARKLA
DAFSGMLNAVKPQEEERDIDFRKAILDAANKVGEASSQLFRQITFSDRSV
MTSSDSGSRLGRLLQNSDRDFEDSLIYLVKSVANATAQLVQAVKTVSQNE
SASDVIIGCQRLISPVTHAGLATSQLVTCVKILAPTINQANCTSQILAEI
NEVRCTIDNVAAVTSGIINNNRGNMDNSPQANNLLLTHVEGALTNVRHAL
DNLEDHLRCGITVVNFAPRIQSLELFLTEYDRLKNIFILNLSNKRSNKPD
DLLESLSNFLIISGKINEEILFLCDQEQNQEDPLMESQKIFAAIIVKILA
INKRWSSDFPDLLKDLYYEVDNLVLSLLYQPGTRIISHDQLIHNLYRSAQ
TLITCSHKLITSYHQVLLNDELSPECAEVIERSEHILVIMNSLKFYPTDD
KILTAFIRDSEKLAQSCVTFCRNIHNTIPNTSDDIMIDIMAIAASQTLAE
CEHMEQTIKCVKPIKAHLELAAVAKMLTEHRLENLHKQFPKNTQPKLNLS
QLFHISIAILEKMRNNIEQTLPRAHFSTMFEMYNFENTEPSLIINLYHHL
VKMNEIIETESELDMQSRFKNVILMVYRLVALADTLLISYGQHPAIHYPL
IKNVDEILSTVSSLQSKSGNVFDKFKANILNKQNIFRSKSSNILANSNME
SGNSFDFYYDKANIAAKMLVENCSCCKQNYGSSKLTDDVLAVQQAFNEIA
ECCEWILNLAGDTRIIDEFIILSLSLLNFVLEIENSLTSSEDQLIVKRIS
NKFRAVSESTVKLKEILTKTFMKHRGIFHSIISKLEETKTHLRNTQLGHP
VKWEKTIFVNLLMKNMTIKVNNEQLRQIVEVNQSVNFDKQLLCIMESIAD
ICLLICEKFEPFEERNQIITRSIDLSLNIINMSLKMFQTKESTNLIKKLG
FYMKDLTDNISFLINCVREQIPGYKESSSALAVVAQLSYDVQEIEFSIAS
ENETIKKTKQFNTEDEKKAAECLYKMATSVFNIQLSLENETVPDQKLPGD
IEEFTNYLTELMQLVIHFAKNDSALSEVKLYVDYANQLVDYSDRYLQDVK
QYFNNIGAEDVPKHSDANMTDLINYIVKFLHQFDSTIAQHILSILESRNK
NVKLIENEPTSDLANTMSGMITDDDTTILFASAGIKNCDLENYQDILSGK
FLLNGEHKTVASFKNDAHCNVSNGFRNLVQKTAEALVLDTQTLVQNSGDK
QKSLATNTESVILTISNLADECESGFVHETRKLSEAKMMNAIQSVKSALN
NTYSDRSAEFSRLIVSNSPSLVNHDSNNGNLEVTDIYSIEETILNIQNRL
ERFDDKIAHQINNSKNMETVHSRIDSLMEKLVSHASSVLALSSELMRMPF
QKLFQTPEQTCSIVTNISNQCQATLFDYLDSLEELAFRVTNRKINQKIMS
IGKTLSNQFIKFFQILQKIQRHPDNKFNKSSMLDVFYEIQNCIKIFLEFS
EEVQKSLENQISPTRKVSFKDSSFVNLNQNCVSTPKQHMKADSLVSTKEK
IVQFNKIMFDLTHSNQVTVNNKEAVFLKFFIEILVRFVKVSSDLIGLSKH
CNDQKSFADLQTNFPLAINSDIAICFDQISEALRICVYVRNRNLNDQLME
IKAYIKEIASKSADLLTYYRNQAIKSSWHELLQSVALDLRNVSKEILQSN
ISNSTSSNIQDPNQPGQTFICKSSAVSSCK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000101muscle cell
PLANA:0003104enteric muscle cell
PLANA:0003116parenchymal cell
Vocabulary: biological process
TermDefinition
GO:0006897endocytosis
GO:0007016cytoskeletal anchoring at plasma membrane
GO:0007155cell adhesion
Vocabulary: molecular function
TermDefinition
GO:0030276clathrin binding
GO:0005200structural constituent of cytoskeleton
GO:0003779actin binding
GO:0051015actin filament binding
Vocabulary: INTERPRO
TermDefinition
IPR019749Band_41_domain
IPR014352FERM/acyl-CoA-bd_prot_sf
IPR018979FERM_N
IPR019748FERM_central
IPR015224Talin_cent
IPR032425FERM_f0
IPR011993PH-like_dom_sf
IPR002558ILWEQ_dom
IPR000299FERM_domain
Vocabulary: cellular component
TermDefinition
GO:0001726ruffle
GO:0005925focal adhesion
GO:0005856cytoskeleton