Tubulin beta chain

Overview
NameTubulin beta chain
Smed IDSMED30020126
Length (bp)686
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020126

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30020126SMESG000048286.1 Contig3496_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 243.817 bits (621), Expect = 2.608e-79
Identity = 107/128 (83.59%), Postives = 125/128 (97.66%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMT 385
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+VTFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T
Sbjct:  230 ACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 357          
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 243.817 bits (621), Expect = 2.608e-79
Identity = 107/128 (83.59%), Postives = 125/128 (97.66%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMT 385
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+VTFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T
Sbjct:  230 ACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 357          
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 243.817 bits (621), Expect = 2.608e-79
Identity = 107/128 (83.59%), Postives = 125/128 (97.66%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMT 385
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+VTFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T
Sbjct:  230 ACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 357          
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 243.817 bits (621), Expect = 2.608e-79
Identity = 107/128 (83.59%), Postives = 125/128 (97.66%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMT 385
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+VTFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T
Sbjct:  230 ACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 357          
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 243.817 bits (621), Expect = 2.608e-79
Identity = 107/128 (83.59%), Postives = 125/128 (97.66%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMT 385
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+VTFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T
Sbjct:  230 ACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 357          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: tbb-2 (Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P52275])

HSP 1 Score: 240.35 bits (612), Expect = 1.562e-77
Identity = 105/129 (81.40%), Postives = 124/129 (96.12%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            ACDPRHGRYLTVAAMFRGR+SM+EVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+ TF+GN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+I+EYQ +++ T 
Sbjct:  302 ACDPRHGRYLTVAAMFRGRMSMREVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFVGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLISEYQQYQEATA 430          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: tbb-2 (Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P52275])

HSP 1 Score: 240.35 bits (612), Expect = 1.562e-77
Identity = 105/129 (81.40%), Postives = 124/129 (96.12%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            ACDPRHGRYLTVAAMFRGR+SM+EVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+ TF+GN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+I+EYQ +++ T 
Sbjct:  302 ACDPRHGRYLTVAAMFRGRMSMREVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFVGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLISEYQQYQEATA 430          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: tbb-2 (Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P52275])

HSP 1 Score: 240.35 bits (612), Expect = 1.562e-77
Identity = 105/129 (81.40%), Postives = 124/129 (96.12%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            ACDPRHGRYLTVAAMFRGR+SM+EVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+ TF+GN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+I+EYQ +++ T 
Sbjct:  302 ACDPRHGRYLTVAAMFRGRMSMREVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFVGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLISEYQQYQEATA 430          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: tbb-2 (Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P52275])

HSP 1 Score: 240.35 bits (612), Expect = 1.562e-77
Identity = 105/129 (81.40%), Postives = 124/129 (96.12%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            ACDPRHGRYLTVAAMFRGR+SM+EVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+ TF+GN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+I+EYQ +++ T 
Sbjct:  302 ACDPRHGRYLTVAAMFRGRMSMREVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFVGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLISEYQQYQEATA 430          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: tbb-4 (Tubulin beta-4 chain [Source:UniProtKB/Swiss-Prot;Acc:P41937])

HSP 1 Score: 239.965 bits (611), Expect = 2.464e-77
Identity = 105/129 (81.40%), Postives = 124/129 (96.12%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            ACDPRHGRYLTVAAMFRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+ TF+GN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ +++ T 
Sbjct:  302 ACDPRHGRYLTVAAMFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGVKMAATFVGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATA 430          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub56D (gene:FBgn0284243 transcript:FBtr0086536)

HSP 1 Score: 240.736 bits (613), Expect = 1.661e-77
Identity = 105/128 (82.03%), Postives = 124/128 (96.88%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMT 385
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLN+QNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ +++ T
Sbjct:  302 ACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNIQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEAT 429          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub56D (gene:FBgn0284243 transcript:FBtr0086537)

HSP 1 Score: 240.35 bits (612), Expect = 2.557e-77
Identity = 105/128 (82.03%), Postives = 124/128 (96.88%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMT 385
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLN+QNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ +++ T
Sbjct:  311 ACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNIQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEAT 438          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub60D (gene:FBgn0003888 transcript:FBtr0072270)

HSP 1 Score: 236.884 bits (603), Expect = 6.359e-76
Identity = 105/129 (81.40%), Postives = 122/129 (94.57%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+ML VQNKNSSYFVEWIP+NVKTAVCDI P+G+KMS TFIGN TAIQE+FKRI+EQ+SAMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ +++ T 
Sbjct:  308 ACDPRHGRYLTVAAVFRGRMSMKEVDEQMLAVQNKNSSYFVEWIPNNVKTAVCDIPPKGLKMSSTFIGNTTAIQELFKRISEQFSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATA 436          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub60D (gene:FBgn0003888 transcript:FBtr0343443)

HSP 1 Score: 236.884 bits (603), Expect = 6.399e-76
Identity = 105/129 (81.40%), Postives = 122/129 (94.57%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+ML VQNKNSSYFVEWIP+NVKTAVCDI P+G+KMS TFIGN TAIQE+FKRI+EQ+SAMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ +++ T 
Sbjct:  307 ACDPRHGRYLTVAAVFRGRMSMKEVDEQMLAVQNKNSSYFVEWIPNNVKTAVCDIPPKGLKMSSTFIGNTTAIQELFKRISEQFSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATA 435          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub85D (gene:FBgn0003889 transcript:FBtr0082046)

HSP 1 Score: 236.498 bits (602), Expect = 6.901e-76
Identity = 102/129 (79.07%), Postives = 123/129 (95.35%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLN+QNKNSS+FVEWIP+N KTAVCDI PRG+KMS TFIGN+TAIQE+FKR++EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ +++ T 
Sbjct:  302 ACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNIQNKNSSFFVEWIPNNCKTAVCDIPPRGLKMSATFIGNSTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATA 430          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: zgc:65894 (zgc:65894 [Source:ZFIN;Acc:ZDB-GENE-030131-7741])

HSP 1 Score: 242.662 bits (618), Expect = 2.919e-78
Identity = 107/128 (83.59%), Postives = 124/128 (96.88%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMT 385
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T
Sbjct:  302 ACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 429          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: tubb2b (tubulin, beta 2b [Source:ZFIN;Acc:ZDB-GENE-030131-722])

HSP 1 Score: 242.276 bits (617), Expect = 4.979e-78
Identity = 106/129 (82.17%), Postives = 124/129 (96.12%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+ TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T 
Sbjct:  302 ACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: zgc:55461 (zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879])

HSP 1 Score: 241.891 bits (616), Expect = 5.921e-78
Identity = 106/128 (82.81%), Postives = 124/128 (96.88%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMT 385
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+ TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T
Sbjct:  302 ACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 429          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: zgc:153426 (zgc:153426 [Source:ZFIN;Acc:ZDB-GENE-060929-220])

HSP 1 Score: 241.891 bits (616), Expect = 6.147e-78
Identity = 106/128 (82.81%), Postives = 124/128 (96.88%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMT 385
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+ TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T
Sbjct:  302 ACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 429          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: zgc:55461 (zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879])

HSP 1 Score: 241.891 bits (616), Expect = 6.314e-78
Identity = 106/128 (82.81%), Postives = 124/128 (96.88%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMT 385
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+ TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T
Sbjct:  302 ACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 429          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: reps2 (RALBP1 associated Eps domain containing 2 [Source:Xenbase;Acc:XB-GENE-985000])

HSP 1 Score: 243.432 bits (620), Expect = 1.041e-78
Identity = 107/129 (82.95%), Postives = 124/129 (96.12%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T 
Sbjct:  265 ACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 393          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: tubb (tubulin beta class I [Source:NCBI gene;Acc:448742])

HSP 1 Score: 243.432 bits (620), Expect = 2.532e-78
Identity = 107/128 (83.59%), Postives = 125/128 (97.66%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMT 385
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+VTFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T
Sbjct:  302 ACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 429          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: znf330 (zinc finger protein 330 [Source:Xenbase;Acc:XB-GENE-1010548])

HSP 1 Score: 243.047 bits (619), Expect = 3.192e-78
Identity = 107/129 (82.95%), Postives = 124/129 (96.12%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T 
Sbjct:  302 ACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: reps2 (RALBP1 associated Eps domain containing 2 [Source:Xenbase;Acc:XB-GENE-985000])

HSP 1 Score: 243.047 bits (619), Expect = 3.333e-78
Identity = 107/129 (82.95%), Postives = 124/129 (96.12%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T 
Sbjct:  302 ACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: ubxn11 (UBX domain protein 11 [Source:Xenbase;Acc:XB-GENE-985480])

HSP 1 Score: 240.35 bits (612), Expect = 4.188e-77
Identity = 105/126 (83.33%), Postives = 123/126 (97.62%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFED 379
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+ TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D
Sbjct:  302 ACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD 427          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb5 (tubulin, beta 5 class I [Source:MGI Symbol;Acc:MGI:107812])

HSP 1 Score: 243.432 bits (620), Expect = 1.917e-78
Identity = 107/128 (83.59%), Postives = 125/128 (97.66%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMT 385
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+VTFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T
Sbjct:  302 ACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 429          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb2a (tubulin, beta 2A class IIA [Source:MGI Symbol;Acc:MGI:107861])

HSP 1 Score: 243.432 bits (620), Expect = 1.948e-78
Identity = 107/129 (82.95%), Postives = 124/129 (96.12%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T 
Sbjct:  302 ACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb2b (tubulin, beta 2B class IIB [Source:MGI Symbol;Acc:MGI:1920960])

HSP 1 Score: 243.047 bits (619), Expect = 2.291e-78
Identity = 107/129 (82.95%), Postives = 124/129 (96.12%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T 
Sbjct:  302 ACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb4b (tubulin, beta 4B class IVB [Source:MGI Symbol;Acc:MGI:1915472])

HSP 1 Score: 241.506 bits (615), Expect = 1.220e-77
Identity = 106/126 (84.13%), Postives = 123/126 (97.62%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFED 379
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D
Sbjct:  302 ACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD 427          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb4a (tubulin, beta 4A class IVA [Source:MGI Symbol;Acc:MGI:107848])

HSP 1 Score: 236.113 bits (601), Expect = 1.127e-75
Identity = 103/126 (81.75%), Postives = 123/126 (97.62%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFED 379
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+ML+VQ+KNSSYFVEWIP+NVKTAVCDI PRG+KM+ TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D
Sbjct:  302 ACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD 427          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|P02556|TBB_LYTPI (Tubulin beta chain (Fragment) OS=Lytechinus pictus OX=7653 PE=2 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 7.070e-82
Identity = 107/129 (82.95%), Postives = 124/129 (96.12%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T 
Sbjct:   33 ACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 161          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|P18700|TBB_STRPU (Tubulin beta chain (Fragment) OS=Strongylocentrotus purpuratus OX=7668 PE=2 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 5.907e-80
Identity = 107/129 (82.95%), Postives = 124/129 (96.12%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T 
Sbjct:  147 ACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 275          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|P09244|TBB7_CHICK (Tubulin beta-7 chain OS=Gallus gallus OX=9031 PE=2 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 1.341e-77
Identity = 107/128 (83.59%), Postives = 125/128 (97.66%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMT 385
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+VTFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T
Sbjct:  302 ACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 429          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|Q6GLE7|TBB5_XENTR (Tubulin beta chain OS=Xenopus tropicalis OX=8364 GN=tubb PE=2 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 1.341e-77
Identity = 107/128 (83.59%), Postives = 125/128 (97.66%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMT 385
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+VTFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T
Sbjct:  302 ACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 429          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|Q91575|TBB5_XENLA (Tubulin beta chain OS=Xenopus laevis OX=8355 GN=tubb PE=2 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 1.341e-77
Identity = 107/128 (83.59%), Postives = 125/128 (97.66%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMT 385
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+VTFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T
Sbjct:  302 ACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 429          
BLAST of Tubulin beta chain vs. TrEMBL
Match: A9CTA5 (Beta-tubulin (Fragment) OS=Pinctada fucata OX=50426 PE=2 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 1.250e-79
Identity = 107/129 (82.95%), Postives = 124/129 (96.12%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            ACDPRHGRYLTVAAMFRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TF+GN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T 
Sbjct:   31 ACDPRHGRYLTVAAMFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFVGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 159          
BLAST of Tubulin beta chain vs. TrEMBL
Match: A0A183JKI1 (Tubulin_C domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS3212 PE=4 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 1.417e-79
Identity = 108/129 (83.72%), Postives = 126/129 (97.67%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMSVTFIGN+TAIQE+FKR++EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D TV
Sbjct:   46 ACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNSTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATV 174          
BLAST of Tubulin beta chain vs. TrEMBL
Match: A0A3S5FFD8 (Tubulin_C domain-containing protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS24608 PE=4 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 1.741e-79
Identity = 107/129 (82.95%), Postives = 125/129 (96.90%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMSVTFIGN+TAIQE+FKR++EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T 
Sbjct:   36 ACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNSTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 164          
BLAST of Tubulin beta chain vs. TrEMBL
Match: Q5BXV9 (Tubulin_C domain-containing protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 3.613e-79
Identity = 107/129 (82.95%), Postives = 125/129 (96.90%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMSVTFIGN+TAIQE+FKR++EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T 
Sbjct:   10 ACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNSTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 138          
BLAST of Tubulin beta chain vs. TrEMBL
Match: Q5BYA7 (Tubulin_C domain-containing protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 3.700e-79
Identity = 107/129 (82.95%), Postives = 125/129 (96.90%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMSVTFIGN+TAIQE+FKR++EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T 
Sbjct:   36 ACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNSTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 164          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: ENSAMXT00000019550.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000026.1:1405913:1407004:-1 gene:ENSAMXG00000018987.2 transcript:ENSAMXT00000019550.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 243.047 bits (619), Expect = 2.095e-79
Identity = 106/126 (84.13%), Postives = 124/126 (98.41%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFED 379
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+VTFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D
Sbjct:  221 ACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD 346          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: zgc:55461 (tubulin beta-4B chain [Source:NCBI gene;Acc:103024068])

HSP 1 Score: 241.891 bits (616), Expect = 5.351e-78
Identity = 106/128 (82.81%), Postives = 124/128 (96.88%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMT 385
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+ TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T
Sbjct:  302 ACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 429          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: TUBB2A (tubulin beta-2A chain [Source:NCBI gene;Acc:103041736])

HSP 1 Score: 241.506 bits (615), Expect = 6.809e-77
Identity = 105/129 (81.40%), Postives = 124/129 (96.12%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+ML+VQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+F+RI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T 
Sbjct:  379 ACDPRHGRYLTVAAIFRGRMSMKEVDEQMLSVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFRRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 507          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: TUBB1 (tubulin beta 1 class VI [Source:HGNC Symbol;Acc:HGNC:16257])

HSP 1 Score: 222.246 bits (565), Expect = 2.323e-70
Identity = 96/128 (75.00%), Postives = 115/128 (89.84%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMT 385
            ACDPR GRYLTVA +FRGR+S KEVDE+ML +Q KNS+YFV+WIP NVK AVCDI PRG+KM+ TFIGNNTAIQEIF+R+ EQ++ MFRRKAFLHWYTGEGMDE+EFTEAE+NLND+++EYQ ++D T
Sbjct:  276 ACDPRRGRYLTVAGIFRGRMSTKEVDEQMLAIQQKNSNYFVDWIPHNVKVAVCDIPPRGLKMASTFIGNNTAIQEIFRRVGEQFAMMFRRKAFLHWYTGEGMDEMEFTEAENNLNDLVSEYQQYQDAT 403          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: ENSAMXT00000019222.2 (tubulin alpha-1 chain [Source:NCBI gene;Acc:103031418])

HSP 1 Score: 104.375 bits (259), Expect = 1.012e-25
Identity = 48/136 (35.29%), Postives = 79/136 (58.09%), Query Frame = 2
Query:    5 CDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAV----CDIAPRG----MKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            CDPRHG+Y+    ++RG V  K+V+  + N++ K S  FV+W P+  K  +      + P G    ++ +V  + N TAI E + R+  ++  M+ ++AF+HWY GEGM+E EF+EA  +L  +  +Y+     TV
Sbjct:  305 CDPRHGKYMACCMLYRGDVVPKDVNAAIANIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGTDTV 440          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: tubb2 (tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GENE-050522-384])

HSP 1 Score: 177.563 bits (449), Expect = 1.545e-54
Identity = 79/91 (86.81%), Postives = 89/91 (97.80%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRK 274
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRK
Sbjct:  285 ACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRK 375          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001368.1 (pep scaffold:Pmarinus_7.0:GL476337:866089:875956:-1 gene:ENSPMAG00000001230.1 transcript:ENSPMAT00000001368.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.2781 bits (225), Expect = 1.186e-21
Identity = 48/124 (38.71%), Postives = 69/124 (55.65%), Query Frame = 2
Query:    8 DPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTG-EGMDEVEFTEAESNLNDIINEYQSFE 376
            DPR   YL  A M RG V + +V   +  +  K S +FV+W     KT +C + P G   S+  + NNT ++  F  I E+++ ++RRKA LH YT  EGM+   FTEA S+L  +I EY   +
Sbjct:  337 DPRRSLYLACALMVRGNVQLSDVRRNIERL--KPSLHFVDWNEEGWKTGLCSVPPVGYPHSLLALANNTCVKHTFADIQERFARLYRRKAHLHHYTDVEGMELSCFTEAASSLASVIEEYNQLD 458          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: tubg1 (tubulin, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-836])

HSP 1 Score: 60.4622 bits (145), Expect = 3.924e-11
Identity = 30/121 (24.79%), Postives = 65/121 (53.72%), Query Frame = 2
Query:   26 YLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAP---RGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGM---DEVEFTEAESNLNDIINEYQS 370
            Y+ +  + +G V   +V + +  ++ +  + F+ W P++++ A+   +P      ++S   + N+T+I  +F R  +QY  + +R+AFL  +  E M   D  EF ++   +  +I+EYQ+
Sbjct:  312 YIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLTSAHRVSGLMMANHTSISSLFDRTCKQYDKLRKREAFLDQFRKEDMFKEDLSEFDDSREVVQQLIDEYQA 432          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: TUBA3C (tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:12408])

HSP 1 Score: 50.0618 bits (118), Expect = 1.164e-7
Identity = 17/46 (36.96%), Postives = 29/46 (63.04%), Query Frame = 2
Query:    5 CDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSN 142
            CDPRHG+Y+    ++RG V  K+V+  +  ++ K +  FV+W P+ 
Sbjct:  305 CDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG 350          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: tubd1 (tubulin, delta 1 [Source:ZFIN;Acc:ZDB-GENE-040625-73])

HSP 1 Score: 47.3654 bits (111), Expect = 1.217e-6
Identity = 25/105 (23.81%), Postives = 47/105 (44.76%), Query Frame = 2
Query:   65 MKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCD--IAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSF 373
            ++  D     +  + +   + W+P     AV     AP G   S T + N+TA+    +    +   MF  +A++H YT  G+ E +F ++ + L  +I  Y+  
Sbjct:  345 LRGPDAHATPLGFQRTPMALPWVPPEAALAVWSERRAPTGYGKSATLLANDTAVISPVEHAVSKAWRMFVSRAYVHQYTHHGVSEEDFLDSFTLLEQVIASYRQL 449          
BLAST of Tubulin beta chain vs. Ensembl Yeast
Match: TUB2 (Beta-tubulin; associates with alpha-tubulin (Tub1p and Tub3p) to form tubulin dimer, which polymerizes to form microtubules; mutation in human ortholog is associated with congenital fibrosis of the extraocular muscles (CFEOM) with polymicrogyria [Source:SGD;Acc:S000001857])

HSP 1 Score: 206.068 bits (523), Expect = 7.290e-65
Identity = 88/129 (68.22%), Postives = 116/129 (89.92%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            A DPR+GRYLTVAA FRG+VS+KEV++EM  VQ+KNS YFVEWIP+NV+TAVC +AP+G+ M+ TFI N+T+IQE+FKR+ +Q+SAMF+RKAFLHWYT EGMDE+EF+EAESN+ND+++EYQ +++ TV
Sbjct:  302 AADPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQSKNSDYFVEWIPNNVQTAVCSVAPQGLDMAATFIANSTSIQELFKRVGDQFSAMFKRKAFLHWYTSEGMDELEFSEAESNMNDLVSEYQQYQEATV 430          
BLAST of Tubulin beta chain vs. Ensembl Yeast
Match: TUB1 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; relative distribution to nuclear foci increases upon DNA replication stress; TUB1 has a paralog, TUB3, that arose from the whole genome duplication [Source:SGD;Acc:S000004550])

HSP 1 Score: 100.523 bits (249), Expect = 3.354e-25
Identity = 46/128 (35.94%), Postives = 71/128 (55.47%), Query Frame = 2
Query:    5 CDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMS--------VTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEY 364
            CDPR G+Y+    ++RG V  ++V   +  V+NK +   V+W P+  K  +C   P     S        V  + N T+I E +KRI  ++  M+ ++AF+HWY GEGM+E EFTEA  +L  +  +Y
Sbjct:  306 CDPRDGKYMATCLLYRGDVVTRDVQRAVEQVKNKKTVQLVDWCPTGFKIGICYEPPTATPNSQLATVDRAVCMLSNTTSIAEAWKRIDRKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALERDY 433          
BLAST of Tubulin beta chain vs. Ensembl Yeast
Match: TUB3 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; expressed at lower level than Tub1p; TUB3 has a paralog, TUB1, that arose from the whole genome duplication [Source:SGD;Acc:S000004593])

HSP 1 Score: 97.0561 bits (240), Expect = 6.335e-24
Identity = 45/128 (35.16%), Postives = 72/128 (56.25%), Query Frame = 2
Query:    5 CDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMS--------VTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEY 364
            CDP  G+Y+    ++RG V  ++V   +  V+NK +   V+W P+  K  +C   P  +  S        V  + N TAI + +KRI +++  M+ ++AF+HWY GEGM+E EFTEA  +L  +  +Y
Sbjct:  306 CDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKKTVQMVDWCPTGFKIGICYEPPSVIPSSELANVDRAVCMLSNTTAIADAWKRIDQKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALERDY 433          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO36734 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHY4])

HSP 1 Score: 245.743 bits (626), Expect = 6.298e-81
Identity = 108/128 (84.38%), Postives = 124/128 (96.88%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMT 385
            ACDPRHGRYLTVAAMFRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T
Sbjct:  212 ACDPRHGRYLTVAAMFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 339          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO35958 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJX9])

HSP 1 Score: 244.588 bits (623), Expect = 1.750e-79
Identity = 108/128 (84.38%), Postives = 124/128 (96.88%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMT 385
            ACDPRHGRYLTVAAMFRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T
Sbjct:  302 ACDPRHGRYLTVAAMFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 429          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO39945 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8I3])

HSP 1 Score: 244.588 bits (623), Expect = 1.769e-79
Identity = 108/129 (83.72%), Postives = 124/129 (96.12%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            ACDPRHGRYLTVAAMFRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T 
Sbjct:  302 ACDPRHGRYLTVAAMFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO42890 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S027])

HSP 1 Score: 240.736 bits (613), Expect = 5.249e-78
Identity = 106/128 (82.81%), Postives = 123/128 (96.09%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMT 385
            ACDP HGRYLTVAAMFRGR+SMKE+DE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T
Sbjct:  298 ACDPLHGRYLTVAAMFRGRMSMKELDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 425          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO35959 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJY0])

HSP 1 Score: 235.728 bits (600), Expect = 7.067e-78
Identity = 105/128 (82.03%), Postives = 121/128 (94.53%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMT 385
            ACDPRHGRYLTVAAMFRGR+SMKEV E+MLNVQNKNSSYFVEWIP+NVKTAVCDI P  +KMS TFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T
Sbjct:  156 ACDPRHGRYLTVAAMFRGRMSMKEVFEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPLVLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 283          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: tubb5 (tubulin beta chain [Source:NCBI gene;Acc:101157969])

HSP 1 Score: 241.891 bits (616), Expect = 6.022e-78
Identity = 106/126 (84.13%), Postives = 124/126 (98.41%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFED 379
            ACDPRHGRYLTVAA+FRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KM+VTFIGN+TAIQE+FKRI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D
Sbjct:  302 ACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD 427          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: tubb2 (tubulin beta-2B chain [Source:NCBI gene;Acc:101162245])

HSP 1 Score: 240.736 bits (613), Expect = 1.913e-77
Identity = 105/129 (81.40%), Postives = 124/129 (96.12%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            ACDPRHGRYLTVAA+FRGR+SM+EVDE+MLNVQNKNSSYFVEWIP+NVKTAVCDI PRG+KMS TFIGN+TAIQE+F+RI+EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T 
Sbjct:  302 ACDPRHGRYLTVAAIFRGRMSMREVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFRRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: ENSORLT00000045809.1 (tubulin beta-6 chain [Source:NCBI gene;Acc:101166121])

HSP 1 Score: 219.55 bits (558), Expect = 6.443e-69
Identity = 94/128 (73.44%), Postives = 115/128 (89.84%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMT 385
            ACDPR GRYLTVA +FRG++S KEVDE+ML +Q KNS+YFV+WIP NVK AVCDI P+G++M+ TFIGNNTAIQEIF+R+ EQ+S MFRRKAFLHWYTGEGMDE+EFTEAESNLND+++EYQ +++ T
Sbjct:  302 ACDPRRGRYLTVAGIFRGKMSTKEVDEQMLAIQQKNSTYFVDWIPHNVKVAVCDIPPKGLRMASTFIGNNTAIQEIFRRVGEQFSLMFRRKAFLHWYTGEGMDEMEFTEAESNLNDLVSEYQQYQEAT 429          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: tuba1c (tubulin alpha-1B chain-like [Source:NCBI gene;Acc:101167538])

HSP 1 Score: 101.293 bits (251), Expect = 4.383e-25
Identity = 44/129 (34.11%), Postives = 76/129 (58.91%), Query Frame = 2
Query:    5 CDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAV----CDIAPRG----MKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQ 367
            CDPRHG+Y+    +FRG V  K+V+  +  ++ K +  FV+W P+  K  +      + P G    ++ +V  + N TAI E + R+  ++  M+ ++AF+HWY GEGM+E EF+EA  ++  +  +Y+
Sbjct:  180 CDPRHGKYMACCLLFRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYE 308          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: ENSORLT00000020049.2 (tubulin alpha-1B chain [Source:NCBI gene;Acc:101159587])

HSP 1 Score: 102.064 bits (253), Expect = 5.837e-25
Identity = 45/129 (34.88%), Postives = 76/129 (58.91%), Query Frame = 2
Query:    5 CDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAV----CDIAPRG----MKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQ 367
            CDPRHG+Y+    ++RG V  K+V+  +  ++ K S  FV+W P+  K  +      + P G    +K +V  + N TAI E + R+  ++  M+ ++AF+HWY GEGM+E EF+EA  ++  +  +Y+
Sbjct:  270 CDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVKRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYE 398          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000048286.1 (SMESG000048286.1)

HSP 1 Score: 270.781 bits (691), Expect = 1.805e-86
Identity = 128/128 (100.00%), Postives = 128/128 (100.00%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMT 385
            ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMT
Sbjct:   70 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMT 197          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000062548.1 (SMESG000062548.1)

HSP 1 Score: 252.677 bits (644), Expect = 8.105e-83
Identity = 114/129 (88.37%), Postives = 126/129 (97.67%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            ACDPRHG+YLTVAAMFRGR+S+KEVDEEMLNVQNKNS+YFVEWIPSNVKTAVCDI PRGMKM+VTFIGNNTAIQEIFKRIAEQY+AM+RRKAFLHWYTGEGMDE+EFTEAESNLND+I+EYQ F+D T+
Sbjct:  271 ACDPRHGKYLTVAAMFRGRLSVKEVDEEMLNVQNKNSAYFVEWIPSNVKTAVCDIPPRGMKMAVTFIGNNTAIQEIFKRIAEQYAAMYRRKAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDTTI 399          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000048308.1 (SMESG000048308.1)

HSP 1 Score: 248.44 bits (633), Expect = 9.086e-81
Identity = 112/129 (86.82%), Postives = 125/129 (96.90%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            ACDPRHG+YLTVAAMFRGR+SMKEVDE+MLNVQNKNS+YFVEWIP+NVKTAVCDI PRG+KMSVTFIGNNTAIQEIFKR+ EQ+SAMFRR+AFLHWYTGEGMDE+EFTEAESNLND+I+EYQ F+D TV
Sbjct:  302 ACDPRHGKYLTVAAMFRGRMSMKEVDEQMLNVQNKNSAYFVEWIPNNVKTAVCDIPPRGLKMSVTFIGNNTAIQEIFKRVCEQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNLNDLISEYQQFQDATV 430          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000035804.1 (SMESG000035804.1)

HSP 1 Score: 243.047 bits (619), Expect = 3.248e-79
Identity = 106/129 (82.17%), Postives = 126/129 (97.67%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            ACDPRHGRYLTVAA+FRGR+SMKEVD++MLNVQNKNSSYFVEWIP+NVKTAVCDIAPRG+KMS TFIGN+TAIQE+FKR++EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ +++ TV
Sbjct:  251 ACDPRHGRYLTVAAIFRGRMSMKEVDDQMLNVQNKNSSYFVEWIPNNVKTAVCDIAPRGLKMSATFIGNSTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATV 379          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000074579.1 (SMESG000074579.1)

HSP 1 Score: 243.432 bits (620), Expect = 1.198e-78
Identity = 106/129 (82.17%), Postives = 124/129 (96.12%), Query Frame = 2
Query:    2 ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKTAVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGEGMDEVEFTEAESNLNDIINEYQSFEDMTV 388
            ACDPRHGRYLTVAAMFRGR+SMKEVDE+MLNVQNKNSSYFVEWIP+N KTAVCDI PRG+KMSVTFIGN+T+IQE+FKR++EQ++AMFRRKAFLHWYTGEGMDE+EFTEAESN+ND+++EYQ ++D T 
Sbjct:  302 ACDPRHGRYLTVAAMFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNAKTAVCDIPPRGLKMSVTFIGNSTSIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
The following BLAST results are available for this feature:
BLAST of Tubulin beta chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUBB2.608e-7983.59tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
TUBB2.608e-7983.59tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
TUBB2.608e-7983.59tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
TUBB2.608e-7983.59tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
TUBB2.608e-7983.59tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbb-21.562e-7781.40Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot... [more]
tbb-21.562e-7781.40Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot... [more]
tbb-21.562e-7781.40Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot... [more]
tbb-21.562e-7781.40Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot... [more]
tbb-42.464e-7781.40Tubulin beta-4 chain [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
betaTub56D1.661e-7782.03gene:FBgn0284243 transcript:FBtr0086536[more]
betaTub56D2.557e-7782.03gene:FBgn0284243 transcript:FBtr0086537[more]
betaTub60D6.359e-7681.40gene:FBgn0003888 transcript:FBtr0072270[more]
betaTub60D6.399e-7681.40gene:FBgn0003888 transcript:FBtr0343443[more]
betaTub85D6.901e-7679.07gene:FBgn0003889 transcript:FBtr0082046[more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:658942.919e-7883.59zgc:65894 [Source:ZFIN;Acc:ZDB-GENE-030131-7741][more]
tubb2b4.979e-7882.17tubulin, beta 2b [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
zgc:554615.921e-7882.81zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879][more]
zgc:1534266.147e-7882.81zgc:153426 [Source:ZFIN;Acc:ZDB-GENE-060929-220][more]
zgc:554616.314e-7882.81zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879][more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
reps21.041e-7882.95RALBP1 associated Eps domain containing 2 [Source:... [more]
tubb2.532e-7883.59tubulin beta class I [Source:NCBI gene;Acc:448742][more]
znf3303.192e-7882.95zinc finger protein 330 [Source:Xenbase;Acc:XB-GEN... [more]
reps23.333e-7882.95RALBP1 associated Eps domain containing 2 [Source:... [more]
ubxn114.188e-7783.33UBX domain protein 11 [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tubb51.917e-7883.59tubulin, beta 5 class I [Source:MGI Symbol;Acc:MGI... [more]
Tubb2a1.948e-7882.95tubulin, beta 2A class IIA [Source:MGI Symbol;Acc:... [more]
Tubb2b2.291e-7882.95tubulin, beta 2B class IIB [Source:MGI Symbol;Acc:... [more]
Tubb4b1.220e-7784.13tubulin, beta 4B class IVB [Source:MGI Symbol;Acc:... [more]
Tubb4a1.127e-7581.75tubulin, beta 4A class IVA [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P02556|TBB_LYTPI7.070e-8282.95Tubulin beta chain (Fragment) OS=Lytechinus pictus... [more]
sp|P18700|TBB_STRPU5.907e-8082.95Tubulin beta chain (Fragment) OS=Strongylocentrotu... [more]
sp|P09244|TBB7_CHICK1.341e-7783.59Tubulin beta-7 chain OS=Gallus gallus OX=9031 PE=2... [more]
sp|Q6GLE7|TBB5_XENTR1.341e-7783.59Tubulin beta chain OS=Xenopus tropicalis OX=8364 G... [more]
sp|Q91575|TBB5_XENLA1.341e-7783.59Tubulin beta chain OS=Xenopus laevis OX=8355 GN=tu... [more]
back to top
BLAST of Tubulin beta chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A9CTA51.250e-7982.95Beta-tubulin (Fragment) OS=Pinctada fucata OX=5042... [more]
A0A183JKI11.417e-7983.72Tubulin_C domain-containing protein OS=Schistosoma... [more]
A0A3S5FFD81.741e-7982.95Tubulin_C domain-containing protein OS=Protopolyst... [more]
Q5BXV93.613e-7982.95Tubulin_C domain-containing protein OS=Schistosoma... [more]
Q5BYA73.700e-7982.95Tubulin_C domain-containing protein OS=Schistosoma... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000019550.22.095e-7984.13pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
zgc:554615.351e-7882.81tubulin beta-4B chain [Source:NCBI gene;Acc:103024... [more]
TUBB2A6.809e-7781.40tubulin beta-2A chain [Source:NCBI gene;Acc:103041... [more]
TUBB12.323e-7075.00tubulin beta 1 class VI [Source:HGNC Symbol;Acc:HG... [more]
ENSAMXT00000019222.21.012e-2535.29tubulin alpha-1 chain [Source:NCBI gene;Acc:103031... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tubb21.545e-5486.81tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000001368.11.186e-2138.71pep scaffold:Pmarinus_7.0:GL476337:866089:875956:-... [more]
tubg13.924e-1124.79tubulin, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
TUBA3C1.164e-736.96tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:1240... [more]
tubd11.217e-623.81tubulin, delta 1 [Source:ZFIN;Acc:ZDB-GENE-040625-... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
TUB27.290e-6568.22Beta-tubulin; associates with alpha-tubulin (Tub1p... [more]
TUB13.354e-2535.94Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB36.335e-2435.16Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO367346.298e-8184.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359581.750e-7984.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399451.769e-7983.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428905.249e-7882.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359597.067e-7882.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tubb56.022e-7884.13tubulin beta chain [Source:NCBI gene;Acc:101157969... [more]
tubb21.913e-7781.40tubulin beta-2B chain [Source:NCBI gene;Acc:101162... [more]
ENSORLT00000045809.16.443e-6973.44tubulin beta-6 chain [Source:NCBI gene;Acc:1011661... [more]
tuba1c4.383e-2534.11tubulin alpha-1B chain-like [Source:NCBI gene;Acc:... [more]
ENSORLT00000020049.25.837e-2534.88tubulin alpha-1B chain [Source:NCBI gene;Acc:10115... [more]
back to top
BLAST of Tubulin beta chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048286.11.805e-86100.00SMESG000048286.1[more]
SMESG000062548.18.105e-8388.37SMESG000062548.1[more]
SMESG000048308.19.086e-8186.82SMESG000048308.1[more]
SMESG000035804.13.248e-7982.17SMESG000035804.1[more]
SMESG000074579.11.198e-7882.17SMESG000074579.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020126 ID=SMED30020126|Name=Tubulin beta chain|organism=Schmidtea mediterranea sexual|type=transcript|length=686bp
TGCTTGTGATCCAAGACATGGTCGATATCTAACAGTCGCCGCAATGTTCA
GAGGGAGAGTATCAATGAAAGAGGTCGACGAAGAAATGCTCAATGTTCAA
AACAAAAACAGCTCTTACTTTGTCGAATGGATACCAAGCAATGTGAAAAC
TGCAGTCTGTGACATTGCTCCAAGAGGAATGAAGATGTCTGTGACATTTA
TTGGAAATAACACGGCAATTCAGGAAATATTCAAACGAATCGCTGAACAA
TACAGTGCGATGTTTCGTCGAAAAGCCTTTCTCCATTGGTACACTGGCGA
AGGCATGGACGAAGTGGAATTTACTGAAGCAGAGTCCAATTTAAATGACA
TCATAAATGAATACCAATCTTTCGAAGACATGACCGTAGAAGAGTTCTAA
TTCAAAATCAAGTCTTCTTTCATTTTATTTTATTTACTTTGTAGAAAATT
TCTTGGATTTAGTTTTTTTACAAAATTTTCATTCTACAATCCAATTTTGA
AATTATTTTCTTTCAATGAATCCGCTTTTTATTTGATTTTTAATTAATAT
TTATTTTCTATGATTAAAATAATATGCAATTTTATTTTGTTTTACTGTAA
CAATTGAGAAAATTTAAGTTTGATATTTTATTATCAATAATTTTCATTAT
TAAAATAAAAATGATTTTTGTTTTTTTAAAAAAAAA
back to top

protein sequence of SMED30020126-orf-1

>SMED30020126-orf-1 ID=SMED30020126-orf-1|Name=SMED30020126-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=133bp
ACDPRHGRYLTVAAMFRGRVSMKEVDEEMLNVQNKNSSYFVEWIPSNVKT
AVCDIAPRGMKMSVTFIGNNTAIQEIFKRIAEQYSAMFRRKAFLHWYTGE
GMDEVEFTEAESNLNDIINEYQSFEDMTVEEF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR037103Tubulin/FtsZ_C_sf
IPR000217Tubulin
IPR007110Ig-like_dom
IPR002453Beta_tubulin
IPR018316Tubulin/FtsZ_2-layer-sand-dom
IPR023123Tubulin_C
IPR008280Tub_FtsZ_C
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
GO:0005737cytoplasm
GO:0005856cytoskeleton
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005525GTP binding
GO:0005200structural constituent of cytoskeleton
GO:0000166nucleotide binding
GO:0003924GTPase activity
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
GO:0007010cytoskeleton organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 107..127
NoneNo IPR availablePANTHERPTHR11588:SF89coord: 1..131
IPR002453Beta tubulinPRINTSPR01163BETATUBULINcoord: 46..69
score: 69.69
coord: 76..87
score: 56.95
coord: 111..129
score: 50.14
coord: 28..42
score: 83.16
coord: 10..28
score: 72.27
IPR018316Tubulin/FtsZ, 2-layer sandwich domainPFAMPF03953Tubulin_Ccoord: 1..81
e-value: 1.8E-25
score: 89.5
IPR023123Tubulin, C-terminalGENE3DG3DSA:1.10.287.600coord: 73..129
e-value: 1.2E-29
score: 103.8
IPR037103Tubulin/FtsZ, C-terminal domain superfamilyGENE3DG3DSA:3.30.1330.20coord: 1..72
e-value: 3.1E-33
score: 115.8
IPR000217TubulinPANTHERPTHR11588TUBULINcoord: 1..131
IPR008280Tubulin/FtsZ, C-terminalSUPERFAMILYSSF55307Tubulin C-terminal domain-likecoord: 1..128