Ribosome biogenesis regulatory protein

Overview
NameRibosome biogenesis regulatory protein
Smed IDSMED30020124
Length (bp)788
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ribosome biogenesis regulatory protein (SMED30020124) t-SNE clustered cells

Violin plots show distribution of expression levels for Ribosome biogenesis regulatory protein (SMED30020124) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ribosome biogenesis regulatory protein (SMED30020124) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ribosome biogenesis regulatory protein (SMED30020124) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020124

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30020124SMESG000071880.1 SmedASXL_005331SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30020124SMESG000071880.1 dd_Smed_v4_2458_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30020124SMESG000071880.1 dd_Smed_v4_2458_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30020124SMESG000071880.1 dd_Smed_v4_2458_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020124SMESG000071880.1 dd_Smed_v4_2458_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020124SMESG000071880.1 dd_Smed_v4_2458_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30020124SMESG000071880.1 dd_Smed_v4_2458_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020124SMESG000071880.1 dd_Smed_v4_2458_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30020124SMESG000071880.1 dd_Smed_v4_2458_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020124SMESG000071880.1 dd_Smed_v4_2458_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020124SMESG000071880.1 Contig31151newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020124SMESG000071880.1 Contig31151uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30020124SMESG000071880.1 dd_Smed_v6_2458_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30020124SMESG000071880.1 dd_Smed_v6_2458_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30020124SMESG000071880.1 dd_Smed_v4_2458_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ribosome biogenesis regulatory protein vs. Ensembl Human
Match: RRS1 (ribosome biogenesis regulator 1 homolog [Source:HGNC Symbol;Acc:HGNC:17083])

HSP 1 Score: 110.923 bits (276), Expect = 7.400e-28
Identity = 78/226 (34.51%), Postives = 129/226 (57.08%), Query Frame = 3
Query:   48 EISFDLGNLLVEDDT------LYDPTKETKLERI-KNCCQAMIDELSKLQPKVVDQVTVVELPEPTFLLPREKRVPKENVPTRWESFAXXXXXXXXXXXXFAYDEEKGKYMPTYG-KGSKD--KQWVMEVSEHGDVFENKFAKVNELKKQRIEENETRRLKNLGRQVDVTMNKMHL-----------ERKKDSLKSVKIANMSDASMGKFSREIDPTKLKKEVAKK 662
            E+ FDLGNLL  D           PT E +L+ + ++  Q +I++L +L  + V++  V  LPEPT  LPREK +P+    TRW+ FA+LK I+ KKK    +DE  G++   +G + ++D  K+W++EV  + D  E++FAK  + KK+R+ +NE  RL+NL R      +KM L           + K++  +++++A +S AS+G+F   +   K+ +   KK
Sbjct:   31 ELQFDLGNLLASDRNPPTGLRCAGPTPEAELQALARDNTQLLINQLWQLPTERVEEAIVARLPEPTTRLPREKPLPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQWRRRWGYQRARDDTKEWLIEVPGNADPLEDQFAKRIQAKKERVAKNELNRLRNLAR-----AHKMQLPSAAGLHPTGHQSKEELGRAMQVAKVSTASVGRFQERLPKEKVPRGSGKK 251          
BLAST of Ribosome biogenesis regulatory protein vs. Ensembl Celegans
Match: rrbs-1 (Ribosome biogenesis regulatory protein homolog [Source:UniProtKB/Swiss-Prot;Acc:Q9XVT0])

HSP 1 Score: 99.7525 bits (247), Expect = 2.728e-24
Identity = 71/204 (34.80%), Postives = 120/204 (58.82%), Query Frame = 3
Query:   57 FDLGNLL-VEDDTLYDPTKETKLERIKNCCQAMIDELSKLQPKVVDQVTVVELPEPTFLLPREKRVPKENVPTRWESFAXXXXXXXXXXXXFAYDEEKGKYMPTYG--KGSKD-KQWVMEVSEHG-DVFENKFAKVNELKKQRIEENETRRLKNLGRQVDVT---------MNKMHLERKKDSLKSVKI----ANMSDASMGKF 614
             DLGNLL ++ + +     E   ER +   Q + + + +L+ K V++  +V LP  T+ LPREKR+P++  PT+WE +A  K I+K+KK K  +DE   ++ PTYG  +G+ D K W++E+ ++  D  ++ FA+  E KK+R+ +N+ +R+KNL RQ+  T         M  + ++ K+ S + V+     A ++ AS GKF
Sbjct:   16 IDLGNLLFIDREPIQGDASEGLEERARKNTQLLFNNIWQLEQKRVEEAIIVTLPPATYRLPREKRLPEKKEPTKWEKYAAEKGIEKRKKDKKVFDEATKEWKPTYGYRRGNDDTKDWLIEIPDNAEDPNKDFFAERREKKKERVAKNDMQRMKNLARQMKTTVKSGPSTEKMIGVGVDAKEKSKQQVRFAVDRAKLATASAGKF 219          
BLAST of Ribosome biogenesis regulatory protein vs. Ensembl Fly
Match: CG32409 (gene:FBgn0052409 transcript:FBtr0077030)

HSP 1 Score: 96.6709 bits (239), Expect = 5.664e-23
Identity = 81/241 (33.61%), Postives = 129/241 (53.53%), Query Frame = 3
Query:   48 EISFDLGNLLVEDDTLYDP-----TKETKLERI-KNCCQAMIDELSKLQPKVVDQVTVVELPEPTFLLPREKRVPKENVPTRWESFAXXXXXXXXXXXXFAYDEEKGKYMPTYG----KGSKDKQWVMEVSEHGDVFENKFAKVNELKKQRIEENETRRLKNLGRQVDVTMNK---MHLERKKDS--LKSVKIANMSDASMGKFSREIDPTKLKKEVAKKFNKNVPMPKSKKSTIKRKPMK 725
            E   D+G+LL+ D   +D       KE  L  + +   Q +++ + +L  + VD+  V +LPEPT +LPR ++ P     T+WE FAK K I KKKK K  YDE   K++PTYG    +  K K WV+EV ++ D   + F K  +L+ +++ +NE +R+KN+ R   + M +   +  E    S  L +V +A  S AS+GKF  ++   K  + +     + +P  K K+S I + P K
Sbjct:   28 ECRLDVGSLLITDPNDFDDRELRDNKEEYLTALTRENTQLLVNAIWELPTERVDESIVAKLPEPTTVLPRLRKPPGPRPLTKWEKFAKEKGISKKKKDKKTYDETMDKWVPTYGFKRAEAEKAKDWVLEVPQNADPNTDMFQKKIDLRNEKVAKNEIQRMKNIVRAKKIDMPRSGYLGPEAASSSQLLTAVTVAKSSTASVGKFQNKLPKEKEARGLG--IKELIPGGKRKQSHITQTPEK 266          
BLAST of Ribosome biogenesis regulatory protein vs. Ensembl Zebrafish
Match: rrs1 (ribosome biogenesis regulator 1 homolog [Source:ZFIN;Acc:ZDB-GENE-030131-9345])

HSP 1 Score: 87.8113 bits (216), Expect = 1.225e-19
Identity = 85/221 (38.46%), Postives = 125/221 (56.56%), Query Frame = 3
Query:   48 EISFDLGNLLVEDDTLYDPTKETKLERIKNC--------CQAMIDELSKLQPKVVDQVTVVELPEPTFLLPREKRVPKENVPTRWESFAXXXXXXXXXXXXFAYDEEKGKYMPTYG-KGSKD--KQWVMEVSEHGDVFENKFAKVNELKKQRIEENETRRLKNLGRQVDVTMNKMHL-----ERKKDSLKSVKIANMSDASMGKFSREIDPTKLKKEVAKK 662
            ++ FD G LL  D    D T++ K  + ++C         Q +I+E+ KL  + VD+V V +LPEPT  LPREK  PK   PT+WE FAKLK I+KKKK    +DE   ++   +G K +KD  K+W++EV    D  E++FAK N+ KK+R+  NE  RLKN+ R   V +    L     + K +  ++V +A +S AS+GKF  ++   K  +   KK
Sbjct:   31 DLEFDPGLLLAFDKNRLD-TRDFKGNKREDCLRSLARDNTQLLINEIWKLPTERVDEVIVAKLPEPTTKLPREKPAPKPKPPTKWEQFAKLKGIQKKKKTNLVWDEVHKEWKRRWGYKRAKDDTKEWLIEVPATADPNEDQFAKRNKAKKERVARNEYNRLKNIARAQKVKVPGTGLLPTSQQTKAELAQAVSLAKISTASVGKFQEKLPKEKPARNTGKK 250          
BLAST of Ribosome biogenesis regulatory protein vs. Ensembl Mouse
Match: Rrs1 (ribosome biogenesis regulator 1 [Source:MGI Symbol;Acc:MGI:1929721])

HSP 1 Score: 110.153 bits (274), Expect = 9.886e-28
Identity = 76/221 (34.39%), Postives = 125/221 (56.56%), Query Frame = 3
Query:   48 EISFDLGNLLVEDDT------LYDPTKETKLERI-KNCCQAMIDELSKLQPKVVDQVTVVELPEPTFLLPREKRVPKENVPTRWESFAXXXXXXXXXXXXFAYDEEKGKYMPTYG-KGSKD--KQWVMEVSEHGDVFENKFAKVNELKKQRIEENETRRLKNLGRQVDVTM---NKMH---LERKKDSLKSVKIANMSDASMGKFSREIDPTKLKKEVAKK 662
            E+ FDLGNLL  D           P+ E +L  + ++  Q +I++L +L  + V++  V  LPEP   LPREK +P+    TRW+ FA+LK I+ KKK    +DE  G++   +G K ++D  K+W++EV    D  E++FAK  + KK+R+ +NE  RL+NL R   + M     +H    + K++  +++++A +S AS+G+F   +   K  +   KK
Sbjct:   31 ELEFDLGNLLASDRNPPTVLRQAGPSPEAELRALARDNTQLLINQLWRLPTERVEEAVVARLPEPATRLPREKPLPRPRPLTRWQQFARLKGIRPKKKTNLVWDEASGQWRRRWGYKRARDDTKEWLIEVPGSADPMEDQFAKRTQAKKERVAKNELNRLRNLARAHKMQMPSSAGLHPTGHQSKEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKK 251          
BLAST of Ribosome biogenesis regulatory protein vs. UniProt/SwissProt
Match: sp|Q15050|RRS1_HUMAN (Ribosome biogenesis regulatory protein homolog OS=Homo sapiens OX=9606 GN=RRS1 PE=1 SV=2)

HSP 1 Score: 110.923 bits (276), Expect = 3.554e-27
Identity = 78/226 (34.51%), Postives = 129/226 (57.08%), Query Frame = 3
Query:   48 EISFDLGNLLVEDDT------LYDPTKETKLERI-KNCCQAMIDELSKLQPKVVDQVTVVELPEPTFLLPREKRVPKENVPTRWESFAXXXXXXXXXXXXFAYDEEKGKYMPTYG-KGSKD--KQWVMEVSEHGDVFENKFAKVNELKKQRIEENETRRLKNLGRQVDVTMNKMHL-----------ERKKDSLKSVKIANMSDASMGKFSREIDPTKLKKEVAKK 662
            E+ FDLGNLL  D           PT E +L+ + ++  Q +I++L +L  + V++  V  LPEPT  LPREK +P+    TRW+ FA+LK I+ KKK    +DE  G++   +G + ++D  K+W++EV  + D  E++FAK  + KK+R+ +NE  RL+NL R      +KM L           + K++  +++++A +S AS+G+F   +   K+ +   KK
Sbjct:   31 ELQFDLGNLLASDRNPPTGLRCAGPTPEAELQALARDNTQLLINQLWQLPTERVEEAIVARLPEPTTRLPREKPLPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQWRRRWGYQRARDDTKEWLIEVPGNADPLEDQFAKRIQAKKERVAKNELNRLRNLAR-----AHKMQLPSAAGLHPTGHQSKEELGRAMQVAKVSTASVGRFQERLPKEKVPRGSGKK 251          
BLAST of Ribosome biogenesis regulatory protein vs. UniProt/SwissProt
Match: sp|Q2KIH4|RRS1_BOVIN (Ribosome biogenesis regulatory protein homolog OS=Bos taurus OX=9913 GN=RRS1 PE=2 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 4.144e-27
Identity = 76/221 (34.39%), Postives = 126/221 (57.01%), Query Frame = 3
Query:   48 EISFDLGNLLVEDDT------LYDPTKETKLERI-KNCCQAMIDELSKLQPKVVDQVTVVELPEPTFLLPREKRVPKENVPTRWESFAXXXXXXXXXXXXFAYDEEKGKYMPTYG-KGSKD--KQWVMEVSEHGDVFENKFAKVNELKKQRIEENETRRLKNLGRQ------VDVTMNKMHLERKKDSLKSVKIANMSDASMGKFSREIDPTKLKKEVAKK 662
            E+ FDLGNLL  D           PT+E +L  + ++  Q +I++L +L  + V++  V  LPEP+  LPREK VP+    TRW+ FA+LK I+ KKK    +DE  G++   +G + ++D  K+W++EV  + D  E++FAK  + KK+R+ +NE  RL+NL R           M+    + K++  +++++A +S AS+G+F   +   K  +   KK
Sbjct:   31 ELEFDLGNLLASDRNPPTGLRHAGPTQEAELRALARDNTQLLINQLWQLPTERVEEALVARLPEPSTRLPREKPVPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGRWRRRWGYQRARDDTKEWLIEVPGNADPMEDQFAKRIQAKKERVAKNELNRLRNLARAHKMQLPSAAGMHPTGHQSKEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKK 251          
BLAST of Ribosome biogenesis regulatory protein vs. UniProt/SwissProt
Match: sp|Q9CYH6|RRS1_MOUSE (Ribosome biogenesis regulatory protein homolog OS=Mus musculus OX=10090 GN=Rrs1 PE=1 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 6.916e-27
Identity = 76/221 (34.39%), Postives = 125/221 (56.56%), Query Frame = 3
Query:   48 EISFDLGNLLVEDDT------LYDPTKETKLERI-KNCCQAMIDELSKLQPKVVDQVTVVELPEPTFLLPREKRVPKENVPTRWESFAXXXXXXXXXXXXFAYDEEKGKYMPTYG-KGSKD--KQWVMEVSEHGDVFENKFAKVNELKKQRIEENETRRLKNLGRQVDVTM---NKMH---LERKKDSLKSVKIANMSDASMGKFSREIDPTKLKKEVAKK 662
            E+ FDLGNLL  D           P+ E +L  + ++  Q +I++L +L  + V++  V  LPEP   LPREK +P+    TRW+ FA+LK I+ KKK    +DE  G++   +G K ++D  K+W++EV    D  E++FAK  + KK+R+ +NE  RL+NL R   + M     +H    + K++  +++++A +S AS+G+F   +   K  +   KK
Sbjct:   31 ELEFDLGNLLASDRNPPTVLRQAGPSPEAELRALARDNTQLLINQLWRLPTERVEEAVVARLPEPATRLPREKPLPRPRPLTRWQQFARLKGIRPKKKTNLVWDEASGQWRRRWGYKRARDDTKEWLIEVPGSADPMEDQFAKRTQAKKERVAKNELNRLRNLARAHKMQMPSSAGLHPTGHQSKEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKK 251          
BLAST of Ribosome biogenesis regulatory protein vs. UniProt/SwissProt
Match: sp|A1A5P2|RRS1_RAT (Ribosome biogenesis regulatory protein homolog OS=Rattus norvegicus OX=10116 GN=Rrs1 PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.391e-25
Identity = 75/221 (33.94%), Postives = 124/221 (56.11%), Query Frame = 3
Query:   48 EISFDLGNLLVEDDT------LYDPTKETKLERI-KNCCQAMIDELSKLQPKVVDQVTVVELPEPTFLLPREKRVPKENVPTRWESFAXXXXXXXXXXXXFAYDEEKGKYMPTYG-KGSKD--KQWVMEVSEHGDVFENKFAKVNELKKQRIEENETRRLKNLGRQVDVTM---NKMH---LERKKDSLKSVKIANMSDASMGKFSREIDPTKLKKEVAKK 662
            E+ FDLGNLL  D           P+ E +L  + ++  Q ++++L +L  + V++  V  LPEP   LPREK +P+    TRW+ FA+LK I+ KKK    +DE  G++   +G K ++D  K+W++EV    D  E++FAK    KK+R+ +NE  RL+NL R   + M     +H    + K++  +++++A +S AS+G+F   +   K  +   KK
Sbjct:   31 ELEFDLGNLLASDRNPPTVLRQAGPSPEAELRALARDNTQLLVNQLWQLPTERVEEAVVARLPEPATRLPREKPLPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQWRRRWGYKRARDDTKEWLIEVPGSADPMEDQFAKRIRAKKERVAKNELNRLRNLARAHKMQMPSSAGLHPTGHQSKEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKK 251          
BLAST of Ribosome biogenesis regulatory protein vs. UniProt/SwissProt
Match: sp|Q9XVT0|RRS1_CAEEL (Ribosome biogenesis regulatory protein homolog OS=Caenorhabditis elegans OX=6239 GN=rrbs-1 PE=3 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 3.470e-23
Identity = 71/204 (34.80%), Postives = 120/204 (58.82%), Query Frame = 3
Query:   57 FDLGNLL-VEDDTLYDPTKETKLERIKNCCQAMIDELSKLQPKVVDQVTVVELPEPTFLLPREKRVPKENVPTRWESFAXXXXXXXXXXXXFAYDEEKGKYMPTYG--KGSKD-KQWVMEVSEHG-DVFENKFAKVNELKKQRIEENETRRLKNLGRQVDVT---------MNKMHLERKKDSLKSVKI----ANMSDASMGKF 614
             DLGNLL ++ + +     E   ER +   Q + + + +L+ K V++  +V LP  T+ LPREKR+P++  PT+WE +A  K I+K+KK K  +DE   ++ PTYG  +G+ D K W++E+ ++  D  ++ FA+  E KK+R+ +N+ +R+KNL RQ+  T         M  + ++ K+ S + V+     A ++ AS GKF
Sbjct:   16 IDLGNLLFIDREPIQGDASEGLEERARKNTQLLFNNIWQLEQKRVEEAIIVTLPPATYRLPREKRLPEKKEPTKWEKYAAEKGIEKRKKDKKVFDEATKEWKPTYGYRRGNDDTKDWLIEIPDNAEDPNKDFFAERREKKKERVAKNDMQRMKNLARQMKTTVKSGPSTEKMIGVGVDAKEKSKQQVRFAVDRAKLATASAGKF 219          
BLAST of Ribosome biogenesis regulatory protein vs. TrEMBL
Match: A0A4E0QXR7 (Ribosome biogenesis regulatory protein OS=Fasciola hepatica OX=6192 GN=D915_008994 PE=3 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 1.795e-30
Identity = 92/265 (34.72%), Postives = 143/265 (53.96%), Query Frame = 3
Query:   57 FDLGNLLVEDDTLYDPTKETK-----LERIKNCCQAMIDELSKLQP-KVVDQVTVVELPEPTFLLPREKRVPKENVPTRWESFAXXXXXXXXXXXXFAYDEEKGKYMPTYGKGSKDK---QWVMEVSEHGDVFENKFAKVNELKKQRIEENETRRLKNLGRQVD------VTMNKMHLERKKDSLKSVKIANMSDASMGKFSREIDPTKLKKEVAKKFNKNVPM--------------------PKSKKSTIKRKPMKNKGSRTG 746
            FDLG+LL ED T  D  ++++     L  I + C     +L   QP +  D V V +LP+PTF LPREKR+P +   TRWE FA+LK I+ KK+ +  ++ +   + P +GK   D    +WV+EV ++ D +E++FAK+ + + +R  +NE +RL+N+ R V       + +       K +  +++ IA +SDASMG+FS  +D  K+ K+  +K    +                       K+K  T KRKP+K KGSRTG
Sbjct:   11 FDLGSLLCEDKTPLDTDRKSEAIDDHLRDIAHECTQQFFKLLWSQPVESTDSVKVTQLPKPTFRLPREKRIPSQRNLTRWERFARLKGIQNKKRSRKVWNSDSQTWRPRWGKDRVDSVKDKWVIEVPDNADPYEDQFAKLTKERNERRAKNELQRLRNIQRAVRPGQAPPIGVLTESQGSKNELTRALSIAKVSDASMGRFSTPLDTRKISKKTEQKERMKLSQVVDARSVQDLKRQKQKLKSNKKNKIKTPKRKPLKKKGSRTG 275          
BLAST of Ribosome biogenesis regulatory protein vs. TrEMBL
Match: G4LX62 (Ribosome biogenesis regulatory protein OS=Schistosoma mansoni OX=6183 GN=Smp_058680.2 PE=3 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 2.062e-26
Identity = 83/236 (35.17%), Postives = 127/236 (53.81%), Query Frame = 3
Query:   60 DLGNLLVEDDTLYDPTKET-------KLERIK-NCCQAMIDELSKLQPKVVDQVTVVELPEPTFLLPREKRVPKENVPTRWESFAXXXXXXXXXXXXFAYDEEKGKYMPTYGKGSKD---KQWVMEVSEHGDVFENKFAKVNELKKQRIEENETRRLKNLGRQVD------VTMNKMHLERKKDSLKSVKIANMSDASMGKFSREIDPTKLKKEVAKKFNKNVPMPKSKKSTIKRK 716
            DLGNLL+ED    +   E            I  +C         +L  ++ D V+V  LP+PTF LPREK++P     TRW+ FA+LK I+ +KK +  +D     + P +GK   D    +WV+EV ++ D +E++FAK+ + KK+R  +NE +RL+N+ R V       + +       K +  ++  IA  SDASMG+FS  +D  KL K V K+  K +P+ +  +ST K K
Sbjct:   11 DLGNLLIEDKCPLNQFNEAVSSLDDDHYRTISLDCTYHFFKLFFELPTELNDSVSVSILPKPTFRLPREKKIPSAKELTRWDRFARLKGIQNRKKSRKVWDPVSESWKPRWGKDRIDDVKDKWVLEVPDNADPYEDQFAKLIQAKKERRAKNELQRLRNIARTVKAGQAPPIGVLTESQSSKTELSRAFAIAQNSDASMGRFSAPVDNRKLSKNVEKRSKKRIPLSQVVQSTKKSK 246          
BLAST of Ribosome biogenesis regulatory protein vs. TrEMBL
Match: A0A016U359 (Ribosome biogenesis regulatory protein OS=Ancylostoma ceylanicum OX=53326 GN=Acey_s0059.g3022 PE=3 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 2.160e-26
Identity = 78/204 (38.24%), Postives = 122/204 (59.80%), Query Frame = 3
Query:   60 DLGNLLVED-DTLYDPTKETKLERIKNCCQAMIDELSKLQPKVVDQVTVVELPEPTFLLPREKRVPKENVPTRWESFAXXXXXXXXXXXXFAYDEEKGKYMPTYG--KGSKD-KQWVMEVSEHGDVFENKFAKVNELKKQRIEENETRRLKNLGRQVDVTMNK------------MHLERKKDSLK-SVKIANMSDASMGKFSR 620
            DLG+L++ D DT+     E  L R +N  Q + +++ +L  K V++  + ELP+  F+LPREK++P++  PT+WE +A  K I KKKK K  +DE   ++ PTYG  +G+ D K W++E+ +  D  ++ FA+  E KK+R+ +NET+RLKNL RQV  T+ K               E+ K+ L+ +V  A  + AS GK+ R
Sbjct:   22 DLGHLVIVDRDTIEGDACENLLSRARNNAQYLYNKIWELNRKHVEEAVMAELPKSCFILPREKKIPEKKEPTKWEKYAAAKGITKKKKSKKVFDEATKEWKPTYGYRRGNDDTKDWLIEIPDGADPNKDYFAERVEKKKERVAKNETQRLKNLARQVGSTVRKGPSVDASIGVGIAPEEKSKEQLRFAVDRAKAATASAGKYQR 225          
BLAST of Ribosome biogenesis regulatory protein vs. TrEMBL
Match: A0A5K3FS74 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 2.251e-26
Identity = 76/216 (35.19%), Postives = 118/216 (54.63%), Query Frame = 3
Query:   60 DLGNLLVEDDTLYDPTKETKL---ERIKNCCQAMIDELSKLQPKVVDQVTVVELPEPTFLLPREKRVPKENVPTRWESFAXXXXXXXXXXXXFAYDEEKGKYMPTYGKGSKDK---QWVMEVSEHGDVFENKFAKVNELKKQRIEENETRRLKNLGRQVDVTMNK-----MHLERKKDSL-KSVKIANMSDASMGKFSREIDPTKLKKEVAKKFNK 671
            DLGNLL ED    DP    K    +   +C +  + +   L     D +++  LPEP F LPREK+ P+    TRWE FA++K I K KK +  +D+    + P +GK   D    +WV+EV E+ D +E++F K+ + + +R  +NE  RLKN+ R +              E  K++L ++++I   SDASMG+FS +I+ TK+  +  KK +K
Sbjct:   13 DLGNLLYEDKAPLDPKDVNKCFLRDLTLSCTRDFLRQFWNLPTDQTDGISLSILPEPKFRLPREKQAPRARTLTRWERFAQMKGINKHKKSRKVWDDASQSWKPAWGKNRVDSVKDKWVLEVPENSDPYEDQFEKLTKARNERKAKNEFARLKNIARSIKKGQAPPVGVLTESEASKNALTRALEITKRSDASMGRFSEDINETKIANKTEKKQSK 228          
BLAST of Ribosome biogenesis regulatory protein vs. TrEMBL
Match: A0A0T6AXH7 (Ribosome biogenesis regulatory protein OS=Oryctes borbonicus OX=1629725 GN=AMK59_6673 PE=3 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 3.469e-26
Identity = 81/218 (37.16%), Postives = 132/218 (60.55%), Query Frame = 3
Query:   48 EISFDLGNLLVED-----DTLYDPTKETKLERI-KNCCQAMIDELSKLQPKVVDQVTVVELPEPTFLLPREKRVPKENVPTRWESFAXXXXXXXXXXXXFAYDEEKGKYMPTYG----KGSKDKQWVMEVSEHGDVFENKFAKVNELKKQRIEENETRRLKNLGRQVDVTMNKMHL-----ERKKDSLKSVKIANMSDASMGKFSREIDPTKLKKEVA 656
            E+ +DLG LL  D       L    KE  ++ + ++  Q +++++  L  + VD V VV+LP+PT++LPR KRVPK   PT+W+ +AKLK I+KKKK K ++DE+  K++P YG    + ++DK W++EV ++ D  E++FAK  E+K +R+ +NE +RL+N+ +  +V + +M L        KD   +V +   S AS+GKF   +   K  + VA
Sbjct:   28 ELDYDLGTLLCVDKNELDSGLLSKNKEDYVQNLTRDNVQLLMNQIWSLPTEKVDDVVVVKLPKPTYILPRAKRVPKPKPPTKWQEYAKLKGIQKKKKSKLSWDEQLQKWLPLYGFKRAQAARDKDWLLEVPQNADPLEDQFAKKFEVKSERVAKNELQRLRNIAKSKNVKVPRMGLLNPDVSSAKDLQTAVTVTKSSTASIGKFQSSLPKEKEARGVA 245          
BLAST of Ribosome biogenesis regulatory protein vs. Ensembl Cavefish
Match: rrs1 (ribosome biogenesis regulator 1 homolog [Source:ZFIN;Acc:ZDB-GENE-030131-9345])

HSP 1 Score: 105.916 bits (263), Expect = 3.353e-26
Identity = 81/219 (36.99%), Postives = 124/219 (56.62%), Query Frame = 3
Query:   48 EISFDLGNLLVEDDTLYD-----PTKETKLERI-KNCCQAMIDELSKLQPKVVDQVTVVELPEPTFLLPREKRVPKENVPTRWESFAXXXXXXXXXXXXFAYDEEKGKYMPTYG-KGSKD--KQWVMEVSEHGDVFENKFAKVNELKKQRIEENETRRLKNLGRQVDVTMNKMHL-----ERKKDSLKSVKIANMSDASMGKFSREIDPTKLKKEVAKK 662
            E+ FD+GNLL  D    +       +E  L  + ++  Q +++E+ KL  +  D V VV+LPE +  LPREK +PK   PT+WE FAKLK I+KKKK    +DE   ++   +G K +KD  K+W++EV E  D  E++FAK N+ KK+R+ +NE  RL+N+ R     +  + L     + K +  ++V +A  S AS+GKF   +   K  +   KK
Sbjct:   64 ELEFDVGNLLALDKNPVELRGRSQDREELLRALARDNVQLLVNEIWKLPAERTDDVLVVKLPEASTKLPREKPLPKVRPPTKWEQFAKLKGIQKKKKTNLVWDEVHKEWRRRWGYKRAKDDTKEWLIEVPETADPSEDQFAKRNKAKKERVAKNEFNRLRNIARASKTPVAGLGLAPRAQQSKSELAQAVSVARTSTASVGKFQDRLPKEKAPRNTGKK 282          
BLAST of Ribosome biogenesis regulatory protein vs. Ensembl Sea Lamprey
Match: rrs1 (ribosome biogenesis regulator 1 homolog [Source:ZFIN;Acc:ZDB-GENE-030131-9345])

HSP 1 Score: 103.99 bits (258), Expect = 3.157e-26
Identity = 77/222 (34.68%), Postives = 121/222 (54.50%), Query Frame = 3
Query:   48 EISFDLGNLLVEDDTLYDPTKETKLER---------IKNCCQAMIDELSKLQPKVVDQVTVVELPEPTFLLPREKRVPKENVPTRWESFAXXXXXXXXXXXXFAYDEEKGKYMPTYG-KGSKD--KQWVMEVSEHGDVFENKFAKVNELKKQRIEENETRRLKNLGRQVDVTMNKMHLE-----RKKDSLKSVKIANMSDASMGKFSREIDPTKLKKEVAKK 662
            E+ FDLGNL   D    +P   ++L R          ++  Q +I+E+ KL  + VD V + +LP PT  +PRE+ +PK    TRWE FA LK IK +KK +  +DEEK ++ P +G K + D  + W++EV +H D  E++FAK    KK+R+ +NE  RL+N+ R    + +           + D  K++ +A  + AS+GKF  ++   K  +   KK
Sbjct:   37 EVEFDLGNLTAVDK---NPLDLSELRRDSAGYLMALARDNTQLLINEIWKLPTERVDDVIIAKLPSPTTPVPRERPIPKARPATRWEEFASLKGIKNRKKSRRVWDEEKKEWRPRWGYKRANDNTQDWLIEVPDHVDPNEDQFAKRINAKKERVAKNELNRLRNIARGQKRSASAAGATPPEKPSRDDLGKAIYVAKRATASVGKFQNKLPKEKEDRNYGKK 255          
BLAST of Ribosome biogenesis regulatory protein vs. Ensembl Yeast
Match: RRS1 (Essential protein that binds ribosomal protein L11; required for nuclear export of the 60S pre-ribosomal subunit during ribosome biogenesis; localizes to the nucleolus and in foci along nuclear periphery; cooperates with Ebp2p and Mps3p to mediate telomere clustering by binding Sir4p, but is not involved in telomere tethering; mouse homolog shows altered expression in Huntington's disease model mice [Source:SGD;Acc:S000005820])

HSP 1 Score: 64.3142 bits (155), Expect = 4.905e-13
Identity = 56/181 (30.94%), Postives = 95/181 (52.49%), Query Frame = 3
Query:   51 ISFDLGNLLVEDDTLYD-----PTKETKLERIKNC----CQAMIDELSKLQPKVVDQ-----------VTVVELPEPTFLLPREKRVPKENVPTRWESFAXXXXXX-XXXXXXFAYDEEKGKYMPTYG-KGSK---DKQWVMEVSEHGDVFENKFAKVNEL----KKQRIEENETRRLKNL 506
            + +DLGNL   D  + D      +   + E+IK+      Q +I++L  L  K   +           +T+++LP+PT  LPREK +PK    T+WE FA  K IK K++  K  YDE  G+++P +G KG+    D QW++EV +     +N+      L    +K+ +++NE ++ +N+
Sbjct:   19 VVYDLGNLAAFDSNVLDKNDLDSSNARREEKIKSLTRDNVQLLINQLLSLPMKTTTESVGGTGGQSSVMTLLQLPDPTTDLPREKPLPKAKAMTKWEKFAAKKGIKPKERAGKMIYDEASGEWVPKWGYKGANKKLDDQWLVEVDDKVKGTDNELIDPRTLNRAERKRLVKKNEKQQRRNM 199          
BLAST of Ribosome biogenesis regulatory protein vs. Ensembl Nematostella
Match: EDO40046 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8D3])

HSP 1 Score: 93.5893 bits (231), Expect = 5.174e-23
Identity = 68/179 (37.99%), Postives = 110/179 (61.45%), Query Frame = 3
Query:  141 CQAMIDELSKLQPKVVDQVTVVELPEPTFLLPREKRVPKENVPTRWESFAXXXXXXXXXXXXFAYDEEKGKYMPTYG--KGSKD-KQWVMEVSEHGDVFENKFAKVNELKKQRIEENETRRLKNLGRQVDVTMN----KMHLERKKDSL-KSVKIANMSDASMGKFSREIDPTKLKKEV 653
             Q + +E+ KL  +  + V + +LP PT ++PREK VPK    TRWE +AKLK IKKKK+ +  +DEEK K++P YG  +G+ + K W+  V ++ D FE++F K  E KK+RI +NE +RL+N+ +   V +     K  L++ KD +  ++     + AS+GKF+ ++   K+ K+ 
Sbjct:   27 TQLLFNEIWKLPTERFEGVILAQLPAPTTVIPREKPVPKPKPLTRWEEYAKLKGIKKKKRERKVWDEEKQKWLPRYGYERGNDNTKDWLAVVPDNADPFEDQFEKRLEKKKERIAKNEYQRLRNIAKHKKVKVADRNLKPSLKQSKDQIMAAIGATRKATASVGKFTEKLAKEKVPKKA 205          
BLAST of Ribosome biogenesis regulatory protein vs. Planmine SMEST
Match: SMESG000071880.1 (SMESG000071880.1)

HSP 1 Score: 452.595 bits (1163), Expect = 2.161e-163
Identity = 236/236 (100.00%), Postives = 236/236 (100.00%), Query Frame = 3
Query:   42 MGEISFDLGNLLVEDDTLYDPTKETKLERIKNCCQAMIDELSKLQPKVVDQVTVVELPEPTFLLPREKRVPKENVPTRWESFAXXXXXXXXXXXXFAYDEEKGKYMPTYGKGSKDKQWVMEVSEHGDVFENKFAKVNELKKQRIEENETRRLKNLGRQVDVTMNKMHLERKKDSLKSVKIANMSDASMGKFSREIDPTKLKKEVAKKFNKNVPMPKSKKSTIKRKPMKNKGSRTGN 749
            MGEISFDLGNLLVEDDTLYDPTKETKLERIKNCCQAMIDELSKLQPKVVDQVTVVELPEPTFLLPREKRVPKENVPTRWESFAKLKNIKKKKKPKFAYDEEKGKYMPTYGKGSKDKQWVMEVSEHGDVFENKFAKVNELKKQRIEENETRRLKNLGRQVDVTMNKMHLERKKDSLKSVKIANMSDASMGKFSREIDPTKLKKEVAKKFNKNVPMPKSKKSTIKRKPMKNKGSRTGN
Sbjct:    1 MGEISFDLGNLLVEDDTLYDPTKETKLERIKNCCQAMIDELSKLQPKVVDQVTVVELPEPTFLLPREKRVPKENVPTRWESFAKLKNIKKKKKPKFAYDEEKGKYMPTYGKGSKDKQWVMEVSEHGDVFENKFAKVNELKKQRIEENETRRLKNLGRQVDVTMNKMHLERKKDSLKSVKIANMSDASMGKFSREIDPTKLKKEVAKKFNKNVPMPKSKKSTIKRKPMKNKGSRTGN 236          
The following BLAST results are available for this feature:
BLAST of Ribosome biogenesis regulatory protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RRS17.400e-2834.51ribosome biogenesis regulator 1 homolog [Source:HG... [more]
back to top
BLAST of Ribosome biogenesis regulatory protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rrbs-12.728e-2434.80Ribosome biogenesis regulatory protein homolog [S... [more]
back to top
BLAST of Ribosome biogenesis regulatory protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG324095.664e-2333.61gene:FBgn0052409 transcript:FBtr0077030[more]
back to top
BLAST of Ribosome biogenesis regulatory protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rrs11.225e-1938.46ribosome biogenesis regulator 1 homolog [Source:ZF... [more]
back to top
BLAST of Ribosome biogenesis regulatory protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribosome biogenesis regulatory protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Rrs19.886e-2834.39ribosome biogenesis regulator 1 [Source:MGI Symbol... [more]
back to top
BLAST of Ribosome biogenesis regulatory protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q15050|RRS1_HUMAN3.554e-2734.51Ribosome biogenesis regulatory protein homolog OS=... [more]
sp|Q2KIH4|RRS1_BOVIN4.144e-2734.39Ribosome biogenesis regulatory protein homolog OS=... [more]
sp|Q9CYH6|RRS1_MOUSE6.916e-2734.39Ribosome biogenesis regulatory protein homolog OS=... [more]
sp|A1A5P2|RRS1_RAT2.391e-2533.94Ribosome biogenesis regulatory protein homolog OS=... [more]
sp|Q9XVT0|RRS1_CAEEL3.470e-2334.80Ribosome biogenesis regulatory protein homolog OS=... [more]
back to top
BLAST of Ribosome biogenesis regulatory protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0QXR71.795e-3034.72Ribosome biogenesis regulatory protein OS=Fasciola... [more]
G4LX622.062e-2635.17Ribosome biogenesis regulatory protein OS=Schistos... [more]
A0A016U3592.160e-2638.24Ribosome biogenesis regulatory protein OS=Ancylost... [more]
A0A5K3FS742.251e-2635.19Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0T6AXH73.469e-2637.16Ribosome biogenesis regulatory protein OS=Oryctes ... [more]
back to top
BLAST of Ribosome biogenesis regulatory protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rrs13.353e-2636.99ribosome biogenesis regulator 1 homolog [Source:ZF... [more]
back to top
BLAST of Ribosome biogenesis regulatory protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rrs13.157e-2634.68ribosome biogenesis regulator 1 homolog [Source:ZF... [more]
back to top
BLAST of Ribosome biogenesis regulatory protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RRS14.905e-1330.94Essential protein that binds ribosomal protein L11... [more]
back to top
BLAST of Ribosome biogenesis regulatory protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO400465.174e-2337.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ribosome biogenesis regulatory protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribosome biogenesis regulatory protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000071880.12.161e-163100.00SMESG000071880.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020124 ID=SMED30020124|Name=Ribosome biogenesis regulatory protein|organism=Schmidtea mediterranea sexual|type=transcript|length=788bp
GTTTGTTTAAATATTAAAAATTAAAAGTTTATTTGAAGAGCATGGGTGAA
ATTTCATTTGATTTAGGCAATCTATTAGTAGAAGATGATACTTTATATGA
CCCAACAAAGGAAACAAAATTGGAACGCATTAAGAACTGTTGTCAAGCTA
TGATTGATGAATTATCAAAATTACAACCTAAAGTAGTCGATCAAGTTACA
GTTGTTGAATTACCCGAACCGACATTTTTGTTACCCAGAGAAAAACGGGT
TCCAAAAGAAAATGTTCCTACCAGATGGGAATCATTTGCTAAGTTGAAAA
ATATAAAGAAAAAGAAAAAACCGAAGTTTGCTTATGACGAAGAGAAAGGT
AAATATATGCCAACTTATGGAAAAGGTAGCAAAGATAAGCAATGGGTTAT
GGAAGTTTCTGAACATGGTGATGTATTTGAAAATAAATTCGCTAAAGTTA
ACGAGCTAAAGAAACAAAGAATAGAAGAAAATGAAACAAGAAGATTGAAA
AATCTTGGTAGACAAGTCGATGTGACCATGAACAAAATGCACCTCGAACG
AAAGAAGGATTCATTGAAATCTGTGAAGATCGCAAATATGTCCGATGCTT
CAATGGGTAAATTTTCTCGGGAAATCGATCCTACCAAATTAAAGAAAGAA
GTTGCTAAGAAGTTTAATAAAAATGTTCCAATGCCAAAATCAAAGAAATC
AACAATTAAACGTAAACCAATGAAAAATAAAGGATCGAGAACTGGAAATA
AGAAAAAATAAATATATATTTATCTTTTTAAAAAAAAA
back to top

protein sequence of SMED30020124-orf-1

>SMED30020124-orf-1 ID=SMED30020124-orf-1|Name=SMED30020124-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=240bp
MGEISFDLGNLLVEDDTLYDPTKETKLERIKNCCQAMIDELSKLQPKVVD
QVTVVELPEPTFLLPREKRVPKENVPTRWESFAKLKNIKKKKKPKFAYDE
EKGKYMPTYGKGSKDKQWVMEVSEHGDVFENKFAKVNELKKQRIEENETR
RLKNLGRQVDVTMNKMHLERKKDSLKSVKIANMSDASMGKFSREIDPTKL
KKEVAKKFNKNVPMPKSKKSTIKRKPMKNKGSRTGNKKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR007023Ribosom_reg
Vocabulary: biological process
TermDefinition
GO:0042254ribosome biogenesis
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007023Ribosomal biogenesis regulatory proteinPFAMPF04939RRS1coord: 4..155
e-value: 1.5E-35
score: 122.5
IPR007023Ribosomal biogenesis regulatory proteinPANTHERPTHR17602RIBOSOME BIOGENESIS REGULATORY PROTEINcoord: 3..218
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 205..239
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 217..239