R3H domain containing-like

Overview
NameR3H domain containing-like
Smed IDSMED30020109
Length (bp)976
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of R3H domain containing-like (SMED30020109) t-SNE clustered cells

Violin plots show distribution of expression levels for R3H domain containing-like (SMED30020109) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of R3H domain containing-like (SMED30020109) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for R3H domain containing-like (SMED30020109) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020109

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30020109SMESG000044056.1 Contig5845_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of R3H domain containing-like vs. Ensembl Human
Match: R3HDML (R3H domain containing like [Source:HGNC Symbol;Acc:HGNC:16249])

HSP 1 Score: 120.939 bits (302), Expect = 8.813e-32
Identity = 65/193 (33.68%), Postives = 95/193 (49.22%), Query Frame = 2
Query:  158 RKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYPI----------TCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTS----KLFVTCQYYPRGNYINTAPYETGTPCSKCPETHK-FCNKNLC 691
            RK  +S  ++  ++ YHN  R++V PPA NM    W  +LAR A+ W+ QCIW H       Y   GQNL  +     ++    K   SWS+E   + +P            C G  C HYTQ +WA +  +GC    C   S   +      ++ C Y  +GN+I  +PY+ G PCS CP +++  CN N+C
Sbjct:   54 RKRHISVRDMNALLDYHNHIRASVYPPAANMEYMVWDKRLARAAEAWATQCIWAHGPSQLMRYV--GQNLSIHSGQYRSVVDLMK---SWSEEKWHYLFPAPRDCNPHCPWRCDGPTCSHYTQMVWASSNRLGCAIHTCSSISVWGNTWHRAAYLVCNYAIKGNWIGESPYKMGKPCSSCPPSYQGSCNSNMC 241          
BLAST of R3H domain containing-like vs. Ensembl Human
Match: GLIPR1L1 (GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392])

HSP 1 Score: 120.553 bits (301), Expect = 9.367e-32
Identity = 74/214 (34.58%), Postives = 104/214 (48.60%), Query Frame = 2
Query:  185 ITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALG-----TAEKAVISWSDEIQFFTYPITCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETHKFCNKNLCSVTGLPSSSNHNP--PNDGELTKGNIINNFTLITAIFIVF 805
            I   I+ HN+ R  V PPA +M+   W   LA++A  W+ QC +EH    +K Y  Y    Y  E     LG     T   A+ +W +E QF+ +       +CGHYTQ +WA+++ VGC  A+C     +++ +FV C Y P GN+ N  PY  G  CS C +  K C KNLC    L    N NP     G   +    N F+L   +  +F
Sbjct:   34 IDNCIEAHNEWRGKVNPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENI--WLGGIKSFTPRHAITAWYNETQFYDFDSLSCSRVCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFV-CNYGPAGNFANMPPYVRGESCSLCSKEEK-CVKNLCRTPQL-IIPNQNPFLKPTGRAPQQTAFNPFSLGFLLLRIF 242          
BLAST of R3H domain containing-like vs. Ensembl Human
Match: PI15 (peptidase inhibitor 15 [Source:HGNC Symbol;Acc:HGNC:8946])

HSP 1 Score: 119.783 bits (299), Expect = 1.955e-31
Identity = 63/193 (32.64%), Postives = 94/193 (48.70%), Query Frame = 2
Query:  158 RKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTY----------PITCSGGICGHYTQNIWADTYEVGCGKAICKGQ----SASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETH-KFCNKNLC 691
            RK  +S +++  ++ YHN  R  V PPA NM    W   LA+ A+ W+  CIW+H       +   GQNL           +  + V  W DE++ + +          P+ C G +C HYTQ +WA +  +GC    C+      S     +++ C Y P+GN+I  APY+ G PCS CP ++   C  NLC
Sbjct:   58 RKRYISQNDMIAILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYLLRF--LGQNL---SVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYGGSCTDNLC 245          
BLAST of R3H domain containing-like vs. Ensembl Human
Match: PI15 (peptidase inhibitor 15 [Source:HGNC Symbol;Acc:HGNC:8946])

HSP 1 Score: 119.783 bits (299), Expect = 1.955e-31
Identity = 63/193 (32.64%), Postives = 94/193 (48.70%), Query Frame = 2
Query:  158 RKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTY----------PITCSGGICGHYTQNIWADTYEVGCGKAICKGQ----SASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETH-KFCNKNLC 691
            RK  +S +++  ++ YHN  R  V PPA NM    W   LA+ A+ W+  CIW+H       +   GQNL           +  + V  W DE++ + +          P+ C G +C HYTQ +WA +  +GC    C+      S     +++ C Y P+GN+I  APY+ G PCS CP ++   C  NLC
Sbjct:   58 RKRYISQNDMIAILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYLLRF--LGQNL---SVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYGGSCTDNLC 245          
BLAST of R3H domain containing-like vs. Ensembl Human
Match: PI15 (peptidase inhibitor 15 [Source:HGNC Symbol;Acc:HGNC:8946])

HSP 1 Score: 119.783 bits (299), Expect = 1.955e-31
Identity = 63/193 (32.64%), Postives = 94/193 (48.70%), Query Frame = 2
Query:  158 RKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTY----------PITCSGGICGHYTQNIWADTYEVGCGKAICKGQ----SASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETH-KFCNKNLC 691
            RK  +S +++  ++ YHN  R  V PPA NM    W   LA+ A+ W+  CIW+H       +   GQNL           +  + V  W DE++ + +          P+ C G +C HYTQ +WA +  +GC    C+      S     +++ C Y P+GN+I  APY+ G PCS CP ++   C  NLC
Sbjct:   58 RKRYISQNDMIAILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYLLRF--LGQNL---SVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYGGSCTDNLC 245          
BLAST of R3H domain containing-like vs. Ensembl Celegans
Match: scl-12 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q9N5N3])

HSP 1 Score: 90.8929 bits (224), Expect = 1.557e-21
Identity = 65/206 (31.55%), Postives = 98/206 (47.57%), Query Frame = 2
Query:  125 LCVFFMIQFQMRKSQLSDDEITKMIQYHNDNRS-----------TVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYY-----YETSPNALGTAEKAVISWSDEIQFFTYPIT------CSGGICGHYTQNIWADTYEVGCGKAICKGQSASTS--KLFVTCQYYPRGNYINTAPYETGTPCSKCPETHK 670
              ++ +  F    +Q S    T +++ HND RS           T++PPA NMR+ KW + +A  A +++  C  +H   +      YG+NLY+       TS +  G A  A  SW  E Q + +  T         GI GH TQ  WA+T ++GCG   C   S+  +  K+ V CQY   GN +++  Y++G  CS CP   K
Sbjct:    3 FALYLIAIFGCATAQFSSTAQTAIVKAHNDLRSAIALGNYDAAGTIEPPAANMRKIKWDSTVASSAQQYANTCPDDHSGTE------YGENLYWSWSSSAPTSLDKFGVA--ASNSWEKEFQDYGWESTYMDADLFDSGI-GHATQMAWAETNKIGCGVKNCGKDSSMNNMYKVAVVCQYDQAGNMMDSDIYQSGDTCSFCPSGSK 199          
BLAST of R3H domain containing-like vs. Ensembl Celegans
Match: scl-5 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q18543])

HSP 1 Score: 86.6557 bits (213), Expect = 6.638e-20
Identity = 61/190 (32.11%), Postives = 86/190 (45.26%), Query Frame = 2
Query:  164 SQLSDDEITKMIQYHNDNRS-----------TVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSP--------NALGTAEKAVISWSDEIQFF-----TYPITCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPE 661
            +Q S +    ++  HN  RS           T KP A++M + KW   +A  A  ++ +C   H        A  G+NLY+Y TS          A G+A     +W  E Q +     T  ++      GH TQ  WA T  +GCG   C   +   +K+ V CQY P+GNY+N   Y +GT CSKCP 
Sbjct:   17 AQFSANGQAAILNVHNTLRSRIAKGTYVAKGTAKPAASDMLKMKWDATVAASAQAYANKCPTGHSGA-----AGLGENLYWYWTSATITNIDQFGATGSA-----AWEKEFQDYGWSSNTLSMSLFNTGIGHATQMAWAKTNLIGCGVKNCGKDTNGFNKVTVVCQYKPQGNYLNQNIYTSGTTCSKCPS 196          
BLAST of R3H domain containing-like vs. Ensembl Celegans
Match: scl-2 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q20603])

HSP 1 Score: 84.3445 bits (207), Expect = 3.857e-19
Identity = 56/160 (35.00%), Postives = 76/160 (47.50%), Query Frame = 2
Query:  218 RSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSP-----NALGTAEKAVISWSDEIQ-------FFTYPITCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPE 661
            + T K P TN+ + KW + +A  A  ++  C   H  +     A  G+NLY+Y TS      N  G+A  A  SW  E Q         T  +  +G   GH TQ  WA +  +GCG   C   S   +K+ V CQY P+GN+IN   Y +G  CS CP 
Sbjct:   45 KGTQKSPGTNLLKMKWDSAVAASAQNYANGCPTGHSGD-----AGLGENLYWYWTSGSLGDLNQYGSAASA--SWEKEFQDYGWKSNLMTIDLFNTG--IGHATQMAWAKSNLIGCGVKDCGRDSNGLNKVTVVCQYKPQGNFINQYIYVSGATCSGCPS 195          
BLAST of R3H domain containing-like vs. Ensembl Celegans
Match: scl-2 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q20603])

HSP 1 Score: 84.3445 bits (207), Expect = 3.857e-19
Identity = 56/160 (35.00%), Postives = 76/160 (47.50%), Query Frame = 2
Query:  218 RSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSP-----NALGTAEKAVISWSDEIQ-------FFTYPITCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPE 661
            + T K P TN+ + KW + +A  A  ++  C   H  +     A  G+NLY+Y TS      N  G+A  A  SW  E Q         T  +  +G   GH TQ  WA +  +GCG   C   S   +K+ V CQY P+GN+IN   Y +G  CS CP 
Sbjct:   45 KGTQKSPGTNLLKMKWDSAVAASAQNYANGCPTGHSGD-----AGLGENLYWYWTSGSLGDLNQYGSAASA--SWEKEFQDYGWKSNLMTIDLFNTG--IGHATQMAWAKSNLIGCGVKDCGRDSNGLNKVTVVCQYKPQGNFINQYIYVSGATCSGCPS 195          
BLAST of R3H domain containing-like vs. Ensembl Celegans
Match: scl-7 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q18539])

HSP 1 Score: 82.8037 bits (203), Expect = 1.551e-18
Identity = 60/187 (32.09%), Postives = 86/187 (45.99%), Query Frame = 2
Query:  164 SQLSDDEITKMIQYHNDNRSTV-----------KPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYY-YETSP--NALGTAEKAVISWSDEIQFFTY------PITCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTS--KLFVTCQYYPRGNYINTAPYETGTPCSKCP 658
            +Q S+     M+  HN  RS++           K  ATNM + KW N LA+ A  ++  C  +H  + +     YG+NL++ Y +SP  +     + AV +W  E Q F +          + GI GH TQ  W+ T +VGCG   C   S      K  + CQY   GNY+    Y +G  CS CP
Sbjct:   16 AQFSEGGKQSMVNAHNAVRSSIAKGEYVAKGTKKDSATNMLKMKWDNSLAQSAQNYANGCPMQHSPDKS-----YGENLFWAYSSSPITDLDKYVQSAVDTWVSEFQMFGWNSNKFTTALWNTGI-GHATQVAWSATGQVGCGAKNCGADSVRVGSYKATIVCQYKVPGNYLFKNIYNSGAKCSACP 196          
BLAST of R3H domain containing-like vs. Ensembl Fly
Match: CG8483 (gene:FBgn0038126 transcript:FBtr0082782)

HSP 1 Score: 87.0409 bits (214), Expect = 7.987e-19
Identity = 67/220 (30.45%), Postives = 104/220 (47.27%), Query Frame = 2
Query:   95 ILNLNMKLYNLCVFFMIQFQMRKSQLSDDEITKMIQYHNDNRSTV-------KPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNL-YYYETSPNAL--GTAEKAVISWSDEIQFFTYPITCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTSKLFVTCQYYPRGNYINTAPYETGTP-CSKCPETHKFCNKNLCSVTGLPSSSN 721
            +L   + + +  V F    ++  S ++ +E + ++Q HN  R  V       +P A NMRE  W ++LA  A KW+  C + H           GQNL   + T+P     G     + SW +E+Q +++    S    GHY+Q +W +T  VGCG A  K  ++  +KL+V C Y P GN +   PYE G P CS          + LC+  G   ++N
Sbjct:    7 VLLTTIMIISCEVAFACNGKIIASGITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTINRFTMGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSFGDAWSPK-TGHYSQLVWGETSLVGCGYAEYK-DTSKYNKLYV-CNYGPGGNVVGYNPYEVGKPSCSTYGMKPSSRYQGLCAAPGSSPAAN 223          
BLAST of R3H domain containing-like vs. Ensembl Fly
Match: CG32679 (gene:FBgn0052679 transcript:FBtr0071469)

HSP 1 Score: 54.6842 bits (130), Expect = 2.335e-8
Identity = 50/188 (26.60%), Postives = 74/188 (39.36%), Query Frame = 2
Query:  176 DDEITKMIQYHNDNRSTVK-------PPATNMREFKWSNKLARLADKWSKQCIWEHPK-EDNKEYAPYGQNL-YYYETSPNALGTAEKAVISWSDEIQFFT------YPITCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETHKFCNKNLCS 694
            D  I  ++Q HN+ R+ +        P A  M    W   LA+LA   + QC   H +  +   Y   GQNL   +  S +      + + +W DE +  T      Y +   G   GH+T  +      VGC  AI +   A+  +  +    Y   N +N   Y  GT  S+C         NLCS
Sbjct:   58 DAHIPLILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAGQNLSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMR-GGPAIGHFTTMVNERNNRVGC--AIARFTDANNVQATLLACNYAVTNVVNNPVYRAGTAASECTTGRNSNYPNLCS 242          
BLAST of R3H domain containing-like vs. Ensembl Fly
Match: CG16995 (gene:FBgn0031412 transcript:FBtr0077758)

HSP 1 Score: 49.2914 bits (116), Expect = 4.612e-7
Identity = 34/107 (31.78%), Postives = 56/107 (52.34%), Query Frame = 2
Query:  266 SNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYPITCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTSKLFVTC 586
            S KL RLA +W+   +    + ++++ + YG+N+Y    S   L  A+ AV SW +EI+ + +      G  GH+TQ +W  + E+G G A       S S ++V C
Sbjct:   29 SPKLNRLATEWANYLL-SRNRMEHRQNSGYGENIYM--ASGGNLKGAD-AVRSWYEEIRQYNWNSPSFQGNTGHFTQVVWKSSTELGVGFA------KSGSTIYVVC 125          
BLAST of R3H domain containing-like vs. Ensembl Fly
Match: CG9400 (gene:FBgn0030562 transcript:FBtr0073920)

HSP 1 Score: 47.3654 bits (111), Expect = 9.704e-6
Identity = 46/198 (23.23%), Postives = 78/198 (39.39%), Query Frame = 2
Query:  140 MIQFQMRKSQLSDDEITKMIQYHNDNRSTVKP-------PATNMREFKWSNKLARLADKWSKQCIWEHPK-EDNKEYAPYGQNLYYYETSPNALGTAEKA---VISWSDEIQ------FFTYPITCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETHKFCNK 682
            +++   R+ QL       ++  HN  RS +          A +M   +W  +L ++A   +K+C + H K  +   +   GQN+ Y+         + +    VI+W  E Q         Y     G   GH+T  +      VGC         ++  +  +TC  Y   N  N   Y++G   SKCP+ H+   K
Sbjct:   88 LLEMSERRRQL-------LLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDRYHPHPQGKKIGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTCN-YDYNNIFNEPIYQSGPAGSKCPQ-HRISEK 276          
BLAST of R3H domain containing-like vs. Ensembl Zebrafish
Match: r3hdml (R3H domain containing-like [Source:ZFIN;Acc:ZDB-GENE-090313-275])

HSP 1 Score: 131.724 bits (330), Expect = 3.214e-36
Identity = 72/188 (38.30%), Postives = 102/188 (54.26%), Query Frame = 2
Query:  149 FQMRKSQ-LSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYPITCSGGICGHYTQNIWADTYEVGCGKAICK-----GQSASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETH-KFCNKNLC 691
            F++R+ + +S  ++T ++ YHN  RS V PPA NM    W  +LA+ A+ W+ QCIWEH      ++   GQNL        ++    K   SW DE   F+YP  CSG +C HYTQ +WA + ++GC    C      G     + L V C Y  +GN++  APY+ G PCS CP ++   CNKN C
Sbjct:   53 FRVRRRRFISGKDMTALLDYHNRVRSQVFPPAANMEYMVWDERLAKSAEFWASQCIWEHGPHHFLQH--IGQNLSIISGRYKSIIDLVK---SWYDERHSFSYPSRCSGSVCTHYTQMVWAASNKIGCAIKKCSDIFVFGSMWKQATLLV-CNYAIKGNWVGEAPYKIGRPCSACPSSYGGSCNKNQC 234          
BLAST of R3H domain containing-like vs. Ensembl Zebrafish
Match: r3hdml (R3H domain containing-like [Source:ZFIN;Acc:ZDB-GENE-090313-275])

HSP 1 Score: 131.724 bits (330), Expect = 3.214e-36
Identity = 72/188 (38.30%), Postives = 102/188 (54.26%), Query Frame = 2
Query:  149 FQMRKSQ-LSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYPITCSGGICGHYTQNIWADTYEVGCGKAICK-----GQSASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETH-KFCNKNLC 691
            F++R+ + +S  ++T ++ YHN  RS V PPA NM    W  +LA+ A+ W+ QCIWEH      ++   GQNL        ++    K   SW DE   F+YP  CSG +C HYTQ +WA + ++GC    C      G     + L V C Y  +GN++  APY+ G PCS CP ++   CNKN C
Sbjct:   53 FRVRRRRFISGKDMTALLDYHNRVRSQVFPPAANMEYMVWDERLAKSAEFWASQCIWEHGPHHFLQH--IGQNLSIISGRYKSIIDLVK---SWYDERHSFSYPSRCSGSVCTHYTQMVWAASNKIGCAIKKCSDIFVFGSMWKQATLLV-CNYAIKGNWVGEAPYKIGRPCSACPSSYGGSCNKNQC 234          
BLAST of R3H domain containing-like vs. Ensembl Zebrafish
Match: pi15a (peptidase inhibitor 15a [Source:NCBI gene;Acc:561978])

HSP 1 Score: 123.25 bits (308), Expect = 6.405e-33
Identity = 64/193 (33.16%), Postives = 100/193 (51.81%), Query Frame = 2
Query:  158 RKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTY----------PITCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTS----KLFVTCQYYPRGNYINTAPYETGTPCSKCPETH-KFCNKNLC 691
            RK  +S +++  ++ YHN  R  V PPA+NM    W + LA+ A++W+  CIWEH   +   +   GQNL           +  + V  W DE++ +++          P+ C G +C HYTQ +WA + +VGC    C   +   S      ++ C Y P+GN+I  APY+ G PCS CP ++   C+ N+C
Sbjct:   60 RKRYISQNDMLAILDYHNKVRGKVFPPASNMEYMVWDDTLAKTAEQWASTCIWEHGPRNLLRF--LGQNL---SVRTGRYRSILQLVKPWHDEVKDYSFPYPRDCNPRCPLKCYGPMCTHYTQMVWATSNKVGCAINTCHNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSMCPPSYGGSCSNNMC 247          
BLAST of R3H domain containing-like vs. Ensembl Zebrafish
Match: pi15b (peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-070912-590])

HSP 1 Score: 120.168 bits (300), Expect = 7.348e-32
Identity = 65/193 (33.68%), Postives = 93/193 (48.19%), Query Frame = 2
Query:  158 RKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTY----------PITCSGGICGHYTQNIWADTYEVGCGKAICKGQ----SASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETH-KFCNKNLC 691
            RK  +S  ++  ++ YHN  R+ V PPA NM    W + LAR A+ W+  CIWEH       Y   GQNL           +  + V  W DE++ + +          P+ C G +C HYTQ +WA +  VGC    C       +      ++ C Y P+GN+I  APY  G PCS CP ++   C+ N+C
Sbjct:   42 RKRYISQSDMIAILDYHNKVRANVFPPAANMEYMLWDDGLARSAEAWAATCIWEHGPPYLLRYL--GQNL---SVRTGNYRSILQLVKPWYDEVRDYMFPYPRDCNPHCPMRCYGPMCTHYTQMVWASSNRVGCAIQTCFNMVVWGAVWREATYLVCNYSPKGNWIGEAPYRVGVPCSACPPSYGGSCSNNMC 229          
BLAST of R3H domain containing-like vs. Ensembl Zebrafish
Match: pi15b (peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-070912-590])

HSP 1 Score: 120.553 bits (301), Expect = 7.358e-32
Identity = 65/193 (33.68%), Postives = 93/193 (48.19%), Query Frame = 2
Query:  158 RKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTY----------PITCSGGICGHYTQNIWADTYEVGCGKAICKGQ----SASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETH-KFCNKNLC 691
            RK  +S  ++  ++ YHN  R+ V PPA NM    W + LAR A+ W+  CIWEH       Y   GQNL           +  + V  W DE++ + +          P+ C G +C HYTQ +WA +  VGC    C       +      ++ C Y P+GN+I  APY  G PCS CP ++   C+ N+C
Sbjct:   57 RKRYISQSDMIAILDYHNKVRANVFPPAANMEYMLWDDGLARSAEAWAATCIWEHGPPYLLRYL--GQNL---SVRTGNYRSILQLVKPWYDEVRDYMFPYPRDCNPHCPMRCYGPMCTHYTQMVWASSNRVGCAIQTCFNMVVWGAVWREATYLVCNYSPKGNWIGEAPYRVGVPCSACPPSYGGSCSNNMC 244          
BLAST of R3H domain containing-like vs. Ensembl Xenopus
Match: R3HDML (R3H domain containing-like [Source:NCBI gene;Acc:100492715])

HSP 1 Score: 121.324 bits (303), Expect = 4.936e-32
Identity = 65/193 (33.68%), Postives = 97/193 (50.26%), Query Frame = 2
Query:  158 RKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYPI----------TCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTSKL----FVTCQYYPRGNYINTAPYETGTPCSKCPETH-KFCNKNLC 691
            RK  +S  +++ ++ YHN  RS V PPA NM    W  +LA+ A+ W+ QC W+H       Y   GQNL  +     ++    K    W DE Q +++P            C+G +C HYTQ +WA +  +GC   IC   +   S      ++ C Y  +GN+I  APY+ G PCS CP ++   C+ N+C
Sbjct:   54 RKRYISPRDMSALLDYHNQVRSKVFPPAANMEYMVWDERLAKSAESWANQCKWDHGPNQLMRYI--GQNLSVHSGRYRSIVDLVKG---WYDERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNWIGEAPYKLGRPCSACPPSYGGVCSNNMC 241          
BLAST of R3H domain containing-like vs. Ensembl Xenopus
Match: R3HDML (R3H domain containing-like [Source:NCBI gene;Acc:100492715])

HSP 1 Score: 120.939 bits (302), Expect = 6.061e-32
Identity = 65/193 (33.68%), Postives = 97/193 (50.26%), Query Frame = 2
Query:  158 RKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYPI----------TCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTSKL----FVTCQYYPRGNYINTAPYETGTPCSKCPETH-KFCNKNLC 691
            RK  +S  +++ ++ YHN  RS V PPA NM    W  +LA+ A+ W+ QC W+H       Y   GQNL  +     ++    K    W DE Q +++P            C+G +C HYTQ +WA +  +GC   IC   +   S      ++ C Y  +GN+I  APY+ G PCS CP ++   C+ N+C
Sbjct:   49 RKRYISPRDMSALLDYHNQVRSKVFPPAANMEYMVWDERLAKSAESWANQCKWDHGPNQLMRYI--GQNLSVHSGRYRSIVDLVKG---WYDERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNWIGEAPYKLGRPCSACPPSYGGVCSNNMC 236          
BLAST of R3H domain containing-like vs. Ensembl Xenopus
Match: pi15 (peptidase inhibitor 15 [Source:NCBI gene;Acc:100489915])

HSP 1 Score: 120.553 bits (301), Expect = 1.131e-31
Identity = 63/193 (32.64%), Postives = 95/193 (49.22%), Query Frame = 2
Query:  158 RKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTY----------PITCSGGICGHYTQNIWADTYEVGCGKAICKGQ----SASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETH-KFCNKNLC 691
            RK  +S +++  +++YHN  R  V PPA NM    W   LA+LA+ W+  CIW+H      ++   GQNL           +  + V  W DE++ + +          P+ C G +C HYTQ +WA T  +GC    C       +     +++ C Y P+GN+I  APY  G PCS CP ++   C+ N C
Sbjct:   58 RKRYISQNDMIAIVEYHNQVRGKVFPPAANMEYMVWDENLAKLAEAWAATCIWDHGPSYLLKF--LGQNL---SVRTGRYKSILQLVKPWYDEVKDYAFPYPQECNPRCPLRCYGPMCTHYTQMVWATTNRIGCAIHTCHNMNVWGAVWRRAVYLVCNYSPKGNWIGEAPYTIGVPCSACPPSYGGSCSDNQC 245          
BLAST of R3H domain containing-like vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 119.013 bits (297), Expect = 1.372e-29
Identity = 69/195 (35.38%), Postives = 102/195 (52.31%), Query Frame = 2
Query:  152 QMRKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYPI----------TCSGGICGHYTQNIWADTYEVGCGKAICKGQSA----STSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETHKF-CNKNLC 691
            + R++ L  D+  ++IQ HN  R  V P A+NM    W ++L + A+ W+++CIWEH           GQNL  +             V SW DE++ +TYP            CSG +C HYTQ +WA T +VGC   +CK  +       + +++ C Y P+GN+I  APY+ G PCS+CP ++   C  NLC
Sbjct:   47 RTRRAILRTDK-EEIIQLHNKLRGQVHPSASNMEYMTWDDELEKSAEAWAEECIWEH--GPTALLMSIGQNLAVHW---GRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGNCQNNLC 235          
BLAST of R3H domain containing-like vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 119.013 bits (297), Expect = 1.701e-29
Identity = 69/195 (35.38%), Postives = 102/195 (52.31%), Query Frame = 2
Query:  152 QMRKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYPI----------TCSGGICGHYTQNIWADTYEVGCGKAICKGQSA----STSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETHKF-CNKNLC 691
            + R++ L  D+  ++IQ HN  R  V P A+NM    W ++L + A+ W+++CIWEH           GQNL  +             V SW DE++ +TYP            CSG +C HYTQ +WA T +VGC   +CK  +       + +++ C Y P+GN+I  APY+ G PCS+CP ++   C  NLC
Sbjct:   47 RTRRAILRTDK-EEIIQLHNKLRGQVHPSASNMEYMTWDDELEKSAEAWAEECIWEH--GPTALLMSIGQNLAVHW---GRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGNCQNNLC 235          
BLAST of R3H domain containing-like vs. Ensembl Mouse
Match: R3hdml (R3H domain containing-like [Source:MGI Symbol;Acc:MGI:3650937])

HSP 1 Score: 129.028 bits (323), Expect = 4.017e-35
Identity = 69/200 (34.50%), Postives = 104/200 (52.00%), Query Frame = 2
Query:  158 RKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYPI----------TCSGGICGHYTQNIWADTYEVGCGKAICKGQSA----STSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETHKF-CNKNLCSVTGLPS 712
            RK  +S  +++ ++ YHN  R++V PPA NM    W  +LAR A+ W+ QCIW H      +Y   GQNL  +        +    V SWS+E + +++P            CSG +C HYTQ +WA +  +GC    C   +         +++ C Y  +GN+I  APY+ G PCS CP +++  CN N+C  +GL S
Sbjct:   54 RKRHISARDMSALLDYHNHIRASVHPPAANMEYMVWDEQLARSAEAWATQCIWTHGPSQLMKYV--GQNLSIHS---GRFRSVVDLVRSWSEEKRHYSFPAPKDCTPHCPWLCSGPVCSHYTQMVWASSSRLGCAINTCSSINVWGNTWQQAVYLVCNYAIKGNWIGEAPYKAGKPCSACPPSYQGNCNSNMC-FSGLKS 247          
BLAST of R3H domain containing-like vs. Ensembl Mouse
Match: Pi15 (peptidase inhibitor 15 [Source:MGI Symbol;Acc:MGI:1934659])

HSP 1 Score: 119.783 bits (299), Expect = 1.801e-31
Identity = 63/193 (32.64%), Postives = 94/193 (48.70%), Query Frame = 2
Query:  158 RKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTY----------PITCSGGICGHYTQNIWADTYEVGCGKAICKGQ----SASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETH-KFCNKNLC 691
            RK  +S +++  ++ YHN  R  V PPA NM    W   LA+ A+ W+  CIW+H       +   GQNL           +  + V  W DE++ + +          P+ C G +C HYTQ +WA +  +GC    C+      S     +++ C Y P+GN+I  APY+ G PCS CP ++   C  NLC
Sbjct:   69 RKRYISQNDMIAILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYLLRF--LGQNL---SVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYGGACTDNLC 256          
BLAST of R3H domain containing-like vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 119.398 bits (298), Expect = 2.488e-31
Identity = 67/200 (33.50%), Postives = 105/200 (52.50%), Query Frame = 2
Query:  164 SQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYPI-TCS-GGICGHYTQNIWADTYEVGCGKAIC---KGQSASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETHKFCNKNLCSVTGLPSSSNHNPPNDGEL 748
            + L++DE   M+  HN  R+ V PPA++M + +W ++LA  A  ++++C+W H    NKE    G+NL+        +     AV +W +E +++ +   TC    +CGHYTQ +W+ T  +GCG   C   +G   +   L V C Y P GN     PY+ GTPCS+CP  +  C  +LC     P  +  +PP   E+
Sbjct:   28 TALTEDEKQTMVDLHNQYRAQVSPPASDMLQMRWDDELAAFAKAYAQKCVWGH----NKERGRRGENLFAITDEGMDVPL---AVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLV-CNYEPPGNVKGRKPYQEGTPCSQCPLGYS-CENSLCEPMRNPEKAQDSPPRVTEV 218          
BLAST of R3H domain containing-like vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 119.398 bits (298), Expect = 2.488e-31
Identity = 67/200 (33.50%), Postives = 105/200 (52.50%), Query Frame = 2
Query:  164 SQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYPI-TCS-GGICGHYTQNIWADTYEVGCGKAIC---KGQSASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETHKFCNKNLCSVTGLPSSSNHNPPNDGEL 748
            + L++DE   M+  HN  R+ V PPA++M + +W ++LA  A  ++++C+W H    NKE    G+NL+        +     AV +W +E +++ +   TC    +CGHYTQ +W+ T  +GCG   C   +G   +   L V C Y P GN     PY+ GTPCS+CP  +  C  +LC     P  +  +PP   E+
Sbjct:   28 TALTEDEKQTMVDLHNQYRAQVSPPASDMLQMRWDDELAAFAKAYAQKCVWGH----NKERGRRGENLFAITDEGMDVPL---AVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLV-CNYEPPGNVKGRKPYQEGTPCSQCPLGYS-CENSLCEPMRNPEKAQDSPPRVTEV 218          
BLAST of R3H domain containing-like vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 120.168 bits (300), Expect = 5.389e-30
Identity = 67/198 (33.84%), Postives = 104/198 (52.53%), Query Frame = 2
Query:  170 LSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYPI-TCS-GGICGHYTQNIWADTYEVGCGKAIC---KGQSASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETHKFCNKNLCSVTGLPSSSNHNPPNDGEL 748
            L++DE   M+  HN  R+ V PPA++M + +W ++LA  A  ++++C+W H    NKE    G+NL+      +       AV +W +E +++ +   TC    +CGHYTQ +W+ T  +GCG   C   +G   +   L V C Y P GN     PY+ GTPCS+CP  +  C  +LC     P  +  +PP   E+
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVSPPASDMLQMRWDDELAAFAKAYAQKCVWGH----NKERGRRGENLFAIT---DEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLV-CNYEPPGNVKGRKPYQEGTPCSQCPLGYS-CENSLCEPMRNPEKAQDSPPRVTEV 218          
BLAST of R3H domain containing-like vs. UniProt/SwissProt
Match: sp|A2A5I3|CRSPL_MOUSE (Peptidase inhibitor R3HDML OS=Mus musculus OX=10090 GN=R3hdml PE=3 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.810e-34
Identity = 69/200 (34.50%), Postives = 104/200 (52.00%), Query Frame = 2
Query:  158 RKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYPI----------TCSGGICGHYTQNIWADTYEVGCGKAICKGQSA----STSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETHKF-CNKNLCSVTGLPS 712
            RK  +S  +++ ++ YHN  R++V PPA NM    W  +LAR A+ W+ QCIW H      +Y   GQNL  +        +    V SWS+E + +++P            CSG +C HYTQ +WA +  +GC    C   +         +++ C Y  +GN+I  APY+ G PCS CP +++  CN N+C  +GL S
Sbjct:   54 RKRHISARDMSALLDYHNHIRASVHPPAANMEYMVWDEQLARSAEAWATQCIWTHGPSQLMKYV--GQNLSIHS---GRFRSVVDLVRSWSEEKRHYSFPAPKDCTPHCPWLCSGPVCSHYTQMVWASSSRLGCAINTCSSINVWGNTWQQAVYLVCNYAIKGNWIGEAPYKAGKPCSACPPSYQGNCNSNMC-FSGLKS 247          
BLAST of R3H domain containing-like vs. UniProt/SwissProt
Match: sp|Q32LB5|GPRL1_BOVIN (GLIPR1-like protein 1 OS=Bos taurus OX=9913 GN=GLIPR1L1 PE=1 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 1.159e-33
Identity = 80/247 (32.39%), Postives = 118/247 (47.77%), Query Frame = 2
Query:   83 NYLWILNLNMKLYNLCVFFMIQFQMRKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPY------GQNLYYYETSPNALGTAEKAVISWSDEIQFFTYPITCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETHKFCNKNLCSVTGLPSSS---NHNPPNDGELTKGNIINNFTLITAIF 796
            +YLW L L       C+          S  +D  I + ++ HN+ R+ V PPA +M+   W   LA+ A+ W+K+C + H    +K +  +      G+NL+     P  +  A+ A+  W DE +F+ +       +CGHYTQ +WA +Y+VGC  A+C    +  S L V C Y P GNY N +PY  GTPCS C      C  NLC       S    N NP    +L   N +   +++  IF
Sbjct:    8 SYLWTLGL-------CLVASKSPPKAPSITNDRFIEECLRLHNEARTNVSPPAADMKYMSWDEALAKTAEAWAKKCKFIHNSCSSKSFKCHPTFQYAGENLWL---GPLTISAAKFAINMWYDERKFYDFNTRSCSQVCGHYTQVVWAYSYKVGCAVAVCPNLGSPDSALLV-CNYAPAGNYPNMSPYTNGTPCSMC--QGDTCENNLCRNKERDKSQRYPNWNPSGTRQLIACNPLYLISVLLTIF 241          
BLAST of R3H domain containing-like vs. UniProt/SwissProt
Match: sp|Q7T141|PI15A_DANRE (Peptidase inhibitor 15-A OS=Danio rerio OX=7955 GN=pi15a PE=3 SV=2)

HSP 1 Score: 123.25 bits (308), Expect = 4.835e-32
Identity = 64/193 (33.16%), Postives = 100/193 (51.81%), Query Frame = 2
Query:  158 RKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTY----------PITCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTS----KLFVTCQYYPRGNYINTAPYETGTPCSKCPETH-KFCNKNLC 691
            RK  +S +++  ++ YHN  R  V PPA+NM    W + LA+ A++W+  CIWEH   +   +   GQNL           +  + V  W DE++ +++          P+ C G +C HYTQ +WA + +VGC    C   +   S      ++ C Y P+GN+I  APY+ G PCS CP ++   C+ N+C
Sbjct:   60 RKRYISQNDMLAILDYHNKVRGKVFPPASNMEYMVWDDTLAKTAEQWASTCIWEHGPRNLLRF--LGQNL---SVRTGRYRSILQLVKPWHDEVKDYSFPYPRDCNPRCPLKCYGPMCTHYTQMVWATSNKVGCAINTCHNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSMCPPSYGGSCSNNMC 247          
BLAST of R3H domain containing-like vs. UniProt/SwissProt
Match: sp|Q9H3Y0|CRSPL_HUMAN (Peptidase inhibitor R3HDML OS=Homo sapiens OX=9606 GN=R3HDML PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 4.232e-31
Identity = 65/193 (33.68%), Postives = 95/193 (49.22%), Query Frame = 2
Query:  158 RKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYPI----------TCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTS----KLFVTCQYYPRGNYINTAPYETGTPCSKCPETHK-FCNKNLC 691
            RK  +S  ++  ++ YHN  R++V PPA NM    W  +LAR A+ W+ QCIW H       Y   GQNL  +     ++    K   SWS+E   + +P            C G  C HYTQ +WA +  +GC    C   S   +      ++ C Y  +GN+I  +PY+ G PCS CP +++  CN N+C
Sbjct:   54 RKRHISVRDMNALLDYHNHIRASVYPPAANMEYMVWDKRLARAAEAWATQCIWAHGPSQLMRYV--GQNLSIHSGQYRSVVDLMK---SWSEEKWHYLFPAPRDCNPHCPWRCDGPTCSHYTQMVWASSNRLGCAIHTCSSISVWGNTWHRAAYLVCNYAIKGNWIGESPYKMGKPCSSCPPSYQGSCNSNMC 241          
BLAST of R3H domain containing-like vs. UniProt/SwissProt
Match: sp|Q3KPV7|PI15_XENLA (Peptidase inhibitor 15 OS=Xenopus laevis OX=8355 GN=pi15 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 4.470e-31
Identity = 63/193 (32.64%), Postives = 97/193 (50.26%), Query Frame = 2
Query:  158 RKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTY----------PITCSGGICGHYTQNIWADTYEVGCGKAICKG----QSASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETH-KFCNKNLC 691
            RK  +S +++ ++++YHN  R  V PPA NM    W + LA+LA+ W+  CIW+H      ++   GQNL           +  + V  W DE++ + +          P+ C G +C HYTQ +WA T  +GC    C       +     +++ C Y P+GN+I  APY  G PCS CP ++   C+ N C
Sbjct:   58 RKRYISQNDMIEIVEYHNQVRGKVFPPAANMEYMVWDDNLAKLAEAWAATCIWDHGPSYLLKF--LGQNL---SVRTGRYKSILQLVKPWYDEVKDYAFPYPQECNPRCPLRCYGPMCTHYTQMVWATTNRIGCAIHTCHNINVWGAVWRRAVYLVCNYSPKGNWIGEAPYTIGVPCSACPPSYGGSCSDNQC 245          
BLAST of R3H domain containing-like vs. TrEMBL
Match: A0A564YKT8 (SCP domain-containing protein (Fragment) OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS7413 PE=4 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 8.835e-39
Identity = 82/211 (38.86%), Postives = 108/211 (51.18%), Query Frame = 2
Query:  116 LYNLCVFFMIQFQMRKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYPITCSGGICGHYTQNIWADTYEVGCGKAICK----GQSASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETHKFCNKNLCSVTGLPSSSNHNPPN 736
            +Y  C+  +I +    + L+D E T+++  HN  RS V P A+NM +  ++  L  LA KW   C+W+HP   + EY+ YGQNL     S   L T    V  W  E   +TY        CGHYTQ +WA + ++GC    C     G        F+ CQY P GNYI   PYE GTPCS CP  ++ C  NLC+    P SSN NP N
Sbjct:    2 IYAFCIVSLIIWPCSLA-LNDTERTQILSDHNGFRSIVSPSASNMLQMSYNTTLESLAQKWVNYCVWKHPGTSDVEYSGYGQNLGMTTASSLNLQT---IVDMWDKEKADYTYSTNTCSKTCGHYTQVVWAKSLQIGCAYQTCTNFSIGSKTYPKAFFIACQYSPPGNYIGQKPYENGTPCSHCPSGYESCVNNLCA----PQSSNVNPTN 204          
BLAST of R3H domain containing-like vs. TrEMBL
Match: A0A3Q3WXU0 (R3H domain containing-like OS=Mola mola OX=94237 PE=4 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 5.923e-37
Identity = 75/192 (39.06%), Postives = 100/192 (52.08%), Query Frame = 2
Query:  134 FFMIQFQMRKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYPITCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTS----KLFVTCQYYPRGNYINTAPYETGTPCSKCPETHK-FCNKNLCS 694
            F+M+     K  +S  E+  +++YHN  RS V PPA NM    W  +LA  AD W+ QCIW+H      +Y   GQNL     S     +  + V SW  E   F+YP  CSG +C HYTQ +WA T  VGC    C   +   S       + C Y  +GN++  APY +GTPCS CP ++   C +NLCS
Sbjct:   44 FWMLPRVRYKRAISSGEMNALLEYHNQVRSQVFPPAANMELMLWDERLATSADSWASQCIWDHGPPQAMKY--MGQNL---SVSTGRYLSITELVRSWYVERHHFSYPNRCSGSVCSHYTQMVWASTNRVGCAIRRCPSMNVFGSTWREATLLVCNYATKGNWVGEAPYRSGTPCSVCPSSYSGSCWRNLCS 230          
BLAST of R3H domain containing-like vs. TrEMBL
Match: A0A3B1JQ09 (R3H domain containing-like OS=Astyanax mexicanus OX=7994 PE=4 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.247e-36
Identity = 75/187 (40.11%), Postives = 102/187 (54.55%), Query Frame = 2
Query:  158 RKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYPITCSGGICGHYTQNIWADTYEVGCGKAICK-----GQSASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETH-KFCNKNLCSVT 700
            RK  +S  ++T +++YHN  RS V PPA NM    W  +LA+ A+ W+ QCIW+H      +Y   GQNL     S     +  + V SW DE   F+YP  C+G +C HYTQ +WA T  +GC    C      G +   + L V C Y  +GN++  APY+TG PCS CP  +   CNKN CS +
Sbjct:   58 RKRYVSSRDMTALLEYHNRVRSQVFPPAANMEYMVWDERLAKSAESWASQCIWDHGPSHVMKY--MGQNL---SISSGRYRSVIELVRSWHDEKNSFSYPNRCTGSVCSHYTQMVWASTNRIGCAINRCSNMYVFGSTWKQATLLV-CNYSIKGNWVGEAPYKTGKPCSACPSVYGGSCNKNQCSTS 238          
BLAST of R3H domain containing-like vs. TrEMBL
Match: A0A1S3MHR2 (peptidase inhibitor R3HDML-like isoform X1 OS=Salmo salar OX=8030 GN=LOC106572611 PE=4 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.423e-35
Identity = 74/199 (37.19%), Postives = 109/199 (54.77%), Query Frame = 2
Query:  122 NLCVFFMIQFQMRKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYPITCSGGICGHYTQNIWADTYEVGCGKAICKGQ----SASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETH-KFCNKNLCSVTG 703
            NL    +   ++R++ +S  E+  ++ YHN  RS V P A NM    W  +LA+ AD W+ +CIW+H       Y   GQNL     +     +  + V SW DE   F+YP TCSG +C HYTQ +WA+T ++GC    C       S+  + +F+ C Y  +GN++  APY++G PCS CP  +   CN+N CS +G
Sbjct:   78 NLTSISVPHIRIRRA-ISSREMNSLLDYHNRVRSQVFPQAANMEIMLWDEQLAKSADSWASRCIWDHGPSQTMRY--MGQNL---SINSGRYWSIIELVRSWQDEKNSFSYPNTCSGPVCSHYTQMVWANTNKMGCAINKCSNMNVYGSSWRTAVFLVCNYSIKGNWVGEAPYKSGKPCSACPSKYGGSCNRNQCSFSG 270          
BLAST of R3H domain containing-like vs. TrEMBL
Match: A0A1S3LKG2 (peptidase inhibitor R3HDML-like OS=Salmo salar OX=8030 GN=LOC106567097 PE=4 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 1.729e-35
Identity = 71/179 (39.66%), Postives = 98/179 (54.75%), Query Frame = 2
Query:  182 EITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYPITCSGGICGHYTQNIWADTYEVGCGKAICKGQ----SASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETH-KFCNKNLCSVTG 703
            E+  ++ YHN  RS V P A NM    W  KLA+ AD W+ +CIW+H       Y   GQNL     +     +  + V SW DE   F+YP TCSG +C HYTQ +WA+T  +GC  + C       S+  + +F+ C Y  +GN++  APY++G PCS CP  +   CN+N CS  G
Sbjct:   84 EMNALLDYHNSVRSQVFPQAANMEIMVWDGKLAKSADSWASRCIWDHGPSQTMRY--MGQNL---SINSGRYRSVIELVRSWQDEKNSFSYPNTCSGPVCSHYTQMVWANTNRMGCAISKCSNMNVYGSSWRTAVFLVCNYSIKGNWVGEAPYKSGKPCSACPSKYGGSCNRNQCSSAG 257          
BLAST of R3H domain containing-like vs. Ensembl Cavefish
Match: r3hdml (R3H domain containing like [Source:NCBI gene;Acc:103046222])

HSP 1 Score: 141.739 bits (356), Expect = 4.722e-40
Identity = 75/187 (40.11%), Postives = 102/187 (54.55%), Query Frame = 2
Query:  158 RKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYPITCSGGICGHYTQNIWADTYEVGCGKAICK-----GQSASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETH-KFCNKNLCSVT 700
            RK  +S  ++T +++YHN  RS V PPA NM    W  +LA+ A+ W+ QCIW+H      +Y   GQNL     S     +  + V SW DE   F+YP  C+G +C HYTQ +WA T  +GC    C      G +   + L V C Y  +GN++  APY+TG PCS CP  +   CNKN CS +
Sbjct:   58 RKRYVSSRDMTALLEYHNRVRSQVFPPAANMEYMVWDERLAKSAESWASQCIWDHGPSHVMKY--MGQNL---SISSGRYRSVIELVRSWHDEKNSFSYPNRCTGSVCSHYTQMVWASTNRIGCAINRCSNMYVFGSTWKQATLLV-CNYSIKGNWVGEAPYKTGKPCSACPSVYGGSCNKNQCSTS 238          
BLAST of R3H domain containing-like vs. Ensembl Cavefish
Match: ENSAMXT00000031557.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 130.183 bits (326), Expect = 1.321e-35
Identity = 76/207 (36.71%), Postives = 109/207 (52.66%), Query Frame = 2
Query:  125 LCVFFMIQFQMRKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEH-PKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYP-ITCS-GGICGHYTQNIWADTYEVGCGKAICKGQSASTSK--LFVTCQYYPRGNYINTAPYETGTPCSKCPETHKFCNKNLCSVTGLPSSSNHNP 730
            +C    +     + Q   ++  +++  HN +RSTV+PPA +M   KWS +LA +A +++ +CIWEH P   N      G+NL +  T P  +   EKA+  W  E + ++Y   TC+   +CGHYTQ +WA T EVGCG  +C+   A   K    + C Y P GNY+   PY+ G  CSKCP+  K C    C  T     S  NP
Sbjct:   10 ICAGLWMLLAPGRGQFPKEDQQRIVNLHNHHRSTVEPPAADMIHMKWSGELALIAKEYATKCIWEHNPDSQNI----MGENL-FITTGPLDI---EKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKCPDDLKNCVDQACDSTDHDELSTVNP 208          
BLAST of R3H domain containing-like vs. Ensembl Cavefish
Match: ENSAMXT00000036030.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 127.487 bits (319), Expect = 9.463e-35
Identity = 76/204 (37.25%), Postives = 109/204 (53.43%), Query Frame = 2
Query:  125 LCVFFMIQFQMRKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEH-PKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYP-ITCS-GGICGHYTQNIWADTYEVGCGKAICKGQSASTSK--LFVTCQYYPRGNYINTAPYETGTPCSKCPETHKFCNKNLCSVTG---LPS 712
            +C    +     + Q   ++  +++  HN +RSTV+PPA +M   KWS +LA +A +++ +CIWEH P   N      G+NL +  T P  +   EKA+  W  E + ++Y   TC+   +CGHYTQ +WA T EVGCG  +C+   A   K    + C Y P GNY+   PY+ G  CSKCP+  K C    C  T    LPS
Sbjct:   10 ICAGLWMLLAPGRGQFPKEDQQRIVNLHNHHRSTVEPPAADMIHMKWSGELALIAKEYATKCIWEHNPDSQNI----MGENL-FITTGPLDI---EKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKCPDDLKNCVDQACDSTDRDELPS 205          
BLAST of R3H domain containing-like vs. Ensembl Cavefish
Match: ENSAMXT00000029824.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 127.872 bits (320), Expect = 1.745e-34
Identity = 76/206 (36.89%), Postives = 110/206 (53.40%), Query Frame = 2
Query:  125 LCVFFMIQFQMRKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEH-PKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYP-ITCS-GGICGHYTQNIWADTYEVGCGKAICKGQSASTSK--LFVTCQYYPRGNYINTAPYETGTPCSKCPETHKFCNKNLCSVTG---LPSSS 718
            +C    +     + Q   ++  +++  HN +RSTV+PPA +M   KWS +LA +A +++ +CIWEH P   N      G+NL +  T P  +   EKA+  W  E + ++Y   TC+   +CGHYTQ +WA T EVGCG  +C+   A   K    + C Y P GNY+   PY+ G  CSKCP+  K C    C  T    LP+ S
Sbjct:   10 ICAGLWMLLAPGRGQFPKEDQQRIVNLHNHHRSTVEPPAADMIHMKWSGELALIAKEYATKCIWEHNPDSQNI----MGENL-FITTGPLDI---EKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKCPDDLKNCVDQACDSTDPDELPTVS 207          
BLAST of R3H domain containing-like vs. Ensembl Cavefish
Match: pi15a (peptidase inhibitor 15-A-like [Source:NCBI gene;Acc:103031459])

HSP 1 Score: 121.709 bits (304), Expect = 2.801e-32
Identity = 61/193 (31.61%), Postives = 101/193 (52.33%), Query Frame = 2
Query:  158 RKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTY----------PITCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTS----KLFVTCQYYPRGNYINTAPYETGTPCSKCPETHK-FCNKNLC 691
            ++  +S +++  ++QYHN  R  V PPA+NM    W + LA+ A++W+  C+WEH   +   +   GQNL           +  + V  W DE++ +++          P+ C G +C HYTQ +WA + ++GC    C   +   S      ++ C Y P+GN+I  APY+ G PCS CP ++   C+ N+C
Sbjct:   59 KRRAISQEDMLAILQYHNKVRGKVFPPASNMEYMVWDDSLAKRAEEWASTCLWEHGPRNLLRF--LGQNL---SVRTGRYRSILQLVKPWYDEVKDYSFPYPRDCNPRCPLKCYGPMCTHYTQMVWATSNKIGCAIHTCYNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSMCPPSYAGSCSNNMC 246          
BLAST of R3H domain containing-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000374.1 (pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 gene:ENSPMAG00000000334.1 transcript:ENSPMAT00000000374.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 128.257 bits (321), Expect = 2.022e-34
Identity = 71/189 (37.57%), Postives = 97/189 (51.32%), Query Frame = 2
Query:  170 LSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTY----------PITCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTS----KLFVTCQYYPRGNYINTAPYETGTPCSKCPETH-KFCNKNLC 691
            ++DDE   + +YHN  R++V P A +M    W  +LA +A+ W+KQC W H   D  +    GQNL  Y  S   L    +A   W DE +++ Y          P TC G IC HYTQ +WA++  VGC    C   S   +     L++ C Y P+GN+I  APY  GTPCS+CP  +   C   LC
Sbjct:    1 IADDERRALTEYHNRLRASVHPQAADMEHMSWDWELAGMAEAWAKQCKWGHGPSDQLD--AIGQNLAVYVGSERPLAYHVQA---WFDEEEWYQYPEEKECSPECPHTCRGPICTHYTQLVWAESRRVGCAVHTCLDISVWDAVWPYALYLVCNYSPKGNWIGEAPYRQGTPCSRCPPRYGGSCRGGLC 184          
BLAST of R3H domain containing-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002250.1 (pep scaffold:Pmarinus_7.0:GL477299:1626:22672:-1 gene:ENSPMAG00000002049.1 transcript:ENSPMAT00000002250.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.4261 bits (215), Expect = 4.459e-21
Identity = 54/188 (28.72%), Postives = 87/188 (46.28%), Query Frame = 2
Query:  200 QYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKA--VISWSDEIQFFTYP----------ITCSGGICGHYTQNIWADTYEVGCGKAICKGQSAS----TSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETH-KFCNKNLCSVTGLPS 712
            + HN  R  V PP++NM    W  KL + A ++  +C+        +   P    + ++   P+ L     +  V +W DE + + YP            C+G +C HYTQ +WA T  VGC    C   +         +++ C Y P+GN+I  +PY++G  CS+CP ++   C  NLC     P+
Sbjct:    1 ELHNKLRGEVHPPSSNMEYMAWVKKLIKEAARYPGRCL--------RLMQPMA--MIHFLGQPHWLSHRPPSFHVQAWYDEAKDYQYPYEQECNPWCPFRCNGAVCTHYTQLVWATTNRVGCAINTCYNMNVWGQIWEKAVYLVCNYSPKGNWIGLSPYKSGRACSECPPSYGGSCRNNLCYRGKFPN 178          
BLAST of R3H domain containing-like vs. Ensembl Sea Lamprey
Match: CRISP3 (cysteine rich secretory protein 3 [Source:HGNC Symbol;Acc:HGNC:16904])

HSP 1 Score: 78.9518 bits (193), Expect = 2.113e-17
Identity = 55/176 (31.25%), Postives = 85/176 (48.30%), Query Frame = 2
Query:  188 TKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPY--GQNLYYYETSPNALGTAEKAVISWSDEI--QFFTYPI-TCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTSKLFVTCQYYPRGNYINT---APYETGTPCSKCPETHKFCNKNLC 691
            T ++  HND R  V P A NM +  W  +    A  W+  C + H  +  ++   +  G+N++      +A  T   A+  W +E+    F Y + + + G  GHYTQ +W +++++GC    C         L+V C Y P GN +NT    PY+ GT C+ CP   K C  NLC
Sbjct:   45 TFIVDLHNDLRRNVTPSAGNMLQMMWKKEAYLNALSWANNCTFGHSPDARRKTTQWTCGENIFM----SSAPFTWNYAIRDWYNEVISPGFQYDVGSTTTGAVGHYTQLVWYNSFQLGCAVNYCPKNPGVAKYLYV-CHYCPMGN-LNTRINRPYDLGTSCASCP---KNCVNNLC 211          
BLAST of R3H domain containing-like vs. Ensembl Sea Lamprey
Match: CLEC18A (C-type lectin domain family 18 member A [Source:HGNC Symbol;Acc:HGNC:30388])

HSP 1 Score: 56.9954 bits (136), Expect = 2.243e-9
Identity = 45/176 (25.57%), Postives = 69/176 (39.20%), Query Frame = 2
Query:  182 EITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQ---------------------NLYYYETSPNALGTAEKAVISWSDEIQFFTY--PITCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTSKLFVTCQYYPRGNYINTAPYETGT 640
            E   +   HN  R+TV+P A NM + +W + LA++A +W+     E+P+      A   +                     NL+    +P+   +    + SW  E Q + Y  P       C HYTQ +WA    VGC K  C+   +        C Y P GN +  +     T
Sbjct:   49 EAFALESLHNKLRATVQPSAANMEKMEWDDSLAQVAHEWAAVAC-ENPRAAEGTSAEIPEKPGIQGTGAGGRGGGQRRLGVNLH---RAPHGATSFASVLASWFSEGQNYDYARPGCAHNRTCRHYTQMVWASASRVGCAKRWCRDPGSRVEAF--ACVYLP-GNDVRLSLRSLAT 217          
BLAST of R3H domain containing-like vs. Ensembl Sea Lamprey
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 52.373 bits (124), Expect = 1.825e-8
Identity = 40/107 (37.38%), Postives = 51/107 (47.66%), Query Frame = 2
Query:  389 NALGTAEKAVISWSDEIQF--FTYPITCSG-GICGHYTQNIWADTYEVGCGKAICKGQSASTSKLFVTCQYYPRGNYIN--TAPYETGTPCSKCPETHKFCNKNLCS 694
            N L + ++A+  W DE     F Y       GI GHYTQ IW  TY+VGC    C  ++    K    C Y P GN+ N  T PY+ G  C  CP     C+  LC+
Sbjct:   55 NTLYSWDEAIKVWVDEANSPGFDYGKGPRNPGIVGHYTQIIWYSTYQVGCTINYCPEEA---YKYMYLCAYCPVGNWNNRLTKPYDEGPSCQDCPND---CDDKLCT 155          
BLAST of R3H domain containing-like vs. Ensembl Yeast
Match: PRY3 (Cell wall-associated protein involved in export of acetylated sterols; member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); role in mating efficiency; expression of full-length transcript is daughter cell-specific; in response to alpha factor, a short transcript starting at +452 is expressed and the long form is repressed by Ste12p [Source:SGD;Acc:S000003614])

HSP 1 Score: 55.0694 bits (131), Expect = 6.589e-9
Identity = 41/122 (33.61%), Postives = 54/122 (44.26%), Query Frame = 2
Query:  257 FKWSNKLARLADKWSKQ--CIWEHPKEDNKEYAPYGQNLYYYETSPNALG-TAEKAVISWSDEIQFFTYPITCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTSKLFVTCQYYPRGNYI 613
              WS+ LA  A  ++ Q  C       D     PYG+NL        ALG T   AV +W  EI  + Y         GH+TQ +W  T E+GCG   C     +T   ++ C Y P GNY+
Sbjct:   46 LTWSDTLATYAQNYADQYDCSGVLTHSD----GPYGENL--------ALGYTDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYC----GTTWNNYIVCSYNPPGNYL 151          
BLAST of R3H domain containing-like vs. Ensembl Yeast
Match: PRY1 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY2; may be involved in detoxification of hydrophobic compounds; PRY1 has a paralog, PRY2, that arose from the whole genome duplication [Source:SGD;Acc:S000003615])

HSP 1 Score: 53.1434 bits (126), Expect = 1.503e-8
Identity = 41/140 (29.29%), Postives = 59/140 (42.14%), Query Frame = 2
Query:  194 MIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALG-TAEKAVISWSDEIQFFTYPITCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTSKLFVTCQYYPRGNY 610
            ++  HN  R+  K    +     WS+ LA  A  ++    ++          PYG+NL        ALG     AV +W +EI  + +         GH+TQ +W  T +VGCG   C G        +V C Y P GNY
Sbjct:  166 VLAEHNKKRALHK----DTPALSWSDTLASYAQDYADN--YDCSGTLTHSGGPYGENL--------ALGYDGPAAVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGD----YVICSYDPAGNY 287          
BLAST of R3H domain containing-like vs. Ensembl Yeast
Match: PRY2 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY1; may be involved in detoxification of hydrophobic compounds; PRY2 has a paralog, PRY1, that arose from the whole genome duplication [Source:SGD;Acc:S000001721])

HSP 1 Score: 52.7582 bits (125), Expect = 2.019e-8
Identity = 43/146 (29.45%), Postives = 61/146 (41.78%), Query Frame = 2
Query:  179 DEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALG-TAEKAVISWSDEIQFFTYPITCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTSKLFVTCQYYPRGNYI 613
            D  T M+  HN  R+  K    +     WS+ LA  A  ++    ++          PYG+NL        ALG     +V +W +EI  + Y         GH+TQ +W  T EVGCG   C G+       ++ C Y   GN I
Sbjct:  191 DFSTSMVNEHNTKRALHK----DTGSLTWSDTLATYAQNYADS--YDCSGNLVHSGGPYGENL--------ALGYGTTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGD----YIICSYKAAGNVI 318          
BLAST of R3H domain containing-like vs. Ensembl Nematostella
Match: EDO48880 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHM7])

HSP 1 Score: 60.4622 bits (145), Expect = 2.234e-11
Identity = 43/128 (33.59%), Postives = 59/128 (46.09%), Query Frame = 2
Query:  257 FKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYY---YETSPNALGTAEKAVISWSDEIQFFTY--PITCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTSKLFVTCQYYPRGNYINTAP 625
             KWS KLA   DKW+K     +  + +K    YG+NL +   YE S        +    W DEIQ + +  P   SG   GH+TQ +W  + E+G  KA+ K         +   +YYP GN I   P
Sbjct:   25 LKWSAKLASDCDKWAKDLARRNTMQHSK--GEYGENLAFASGYELS------GGRTTEMWYDEIQKYRFNNPGFSSG--TGHFTQVVWVGSQEMGVAKAVSK-----NGAHYAVARYYPAGNVIGQFP 137          
BLAST of R3H domain containing-like vs. Ensembl Nematostella
Match: EDO41919 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S310])

HSP 1 Score: 58.9214 bits (141), Expect = 1.053e-10
Identity = 48/150 (32.00%), Postives = 66/150 (44.00%), Query Frame = 2
Query:  197 IQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAP---YGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYPIT--------CSGGICGHYTQNIWADTYEVGCGKA-ICKGQSASTSKLFVTCQYYPRGNY 610
            ++ HN  R+         R   W N LAR A KWS          +  ++AP    G+NLYY      +  T  +AV +W DE+    YP           SG   GH+TQ +W DT  +G   A I +G   ST   ++  +Y P GNY
Sbjct:    5 LKAHNTKRAL-----HGARPLTWDNSLARDAGKWSLLL----ANSNTFKHAPNSDEGENLYYISKVSASPVTCVEAVKAWYDEV--VDYPFNNPPESVFQVSGAPIGHFTQIVWKDTRRLGVAIARIKRGLWYST---YIVARYSPPGNY 140          
BLAST of R3H domain containing-like vs. Ensembl Nematostella
Match: EDO30770 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZU6])

HSP 1 Score: 59.3066 bits (142), Expect = 1.388e-10
Identity = 47/165 (28.48%), Postives = 74/165 (44.85%), Query Frame = 2
Query:  125 LCVFFMIQFQMRKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCI-WEHPKEDNKEYAP-YGQNLYYY-ETSPNALGTAEKAVISWSDEIQFFTYPITCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTSKLFVTCQYYPRGNY 610
            L    +  F +  S    D   + +Q HN+ R T   P       + S+ L+R A  ++++     + K  +K+  P  G+NL Y   + P  +  AEKAV  W DEI  + +         GH+T  +W DT E+G G A  K      + L+V  +Y   GN+
Sbjct:    3 LVALILAAFAVSASA---DFAKEALQVHNELRDTHNAPP-----LRLSSALSRGAQSYARKLAQMGYLKHSDKKTRPGIGENLIYRCSSGPGEVLPAEKAVTDWYDEICMYNFKQPGYYSRTGHFTALVWKDTKELGIGTATSK--KGRMNCLWVVARYRSGGNF 157          
BLAST of R3H domain containing-like vs. Ensembl Nematostella
Match: EDO49310 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH92])

HSP 1 Score: 60.077 bits (144), Expect = 2.531e-10
Identity = 41/144 (28.47%), Postives = 64/144 (44.44%), Query Frame = 2
Query:  191 KMIQYHNDNRSTVK-PPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYPITCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTSKLFVTCQYYPRGNYINT 619
            K +  HN  R+    PP T      WSN +AR A KW+ +   E     +K  +  G+N+ +  +  N     E A  SW  E++ + +         GH+TQ +W  + E+G  +A  K        +FV  +Y P GN +N 
Sbjct:    7 KSLDAHNRYRAMHNVPPLT------WSNSIAREAQKWANKLAKEGKLIHDKSRSGQGENV-FMSSGANFDDAGEAACESWYQEVERYNFQRGGHQSGTGHFTQVVWKSSEELGVARAKSK-----KGAVFVVARYSPGGNDLNA 138          
BLAST of R3H domain containing-like vs. Ensembl Nematostella
Match: EDO48881 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHM8])

HSP 1 Score: 56.6102 bits (135), Expect = 5.032e-10
Identity = 38/144 (26.39%), Postives = 66/144 (45.83%), Query Frame = 2
Query:  194 MIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYPITCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTSKLFVTCQYYPRGNYINTAP 625
            +++ HND R+         +  KW+ +LA  A  W++     +  + +     YG+++ Y      A+ T  KA   W  E+  + +         GH+TQ +WA + E+G GKA     ++S+   FV  +Y P GN +   P
Sbjct:    6 ILKTHNDYRAQ-----HGTKALKWNARLASEAQSWAENLAQRNAIQHSSSR-EYGESIAYMS---GAVLTGRKATDMWYGEVDKYRFENPGFSTSSGHFTQVVWAGSTEMGAGKA-----TSSSGAHFVVARYTPPGNVMGQFP 135          
BLAST of R3H domain containing-like vs. Ensembl Medaka
Match: pi15a (peptidase inhibitor 15 [Source:NCBI gene;Acc:101173911])

HSP 1 Score: 118.627 bits (296), Expect = 3.162e-31
Identity = 62/193 (32.12%), Postives = 96/193 (49.74%), Query Frame = 2
Query:  158 RKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTY----------PITCSGGICGHYTQNIWADTYEVGCGKAICKGQ----SASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETH-KFCNKNLC 691
            R+  +S +++  ++ YHN  R  V PPA+NM    W   LA+ A+ W+  C+WEH       +   GQNL           +  + V  W DE++ +++          P+ C G +C HYTQ +WA + +VGC    C       S      ++ C Y P+GN+I  APY+ G PCS CP ++   C+ N+C
Sbjct:   57 RRRYISQNDMLAILDYHNKVRGKVFPPASNMEYMVWDETLAKTAEDWAHACLWEHGPSHLLRF--LGQNL---SVRTGRYRSILQLVKPWYDEVKDYSFPYPRDCNPRCPLRCYGPMCTHYTQMVWATSNKVGCAIHTCYNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSACPPSYGGSCSNNMC 244          
BLAST of R3H domain containing-like vs. Ensembl Medaka
Match: crispld1b (cysteine-rich secretory protein LCCL domain-containing 1 [Source:NCBI gene;Acc:101169145])

HSP 1 Score: 115.546 bits (288), Expect = 1.785e-28
Identity = 71/219 (32.42%), Postives = 105/219 (47.95%), Query Frame = 2
Query:  161 KSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNL--YYYETSPNALGTAEKAVISWSDEIQFFTY----------PITCSGGICGHYTQNIWADTYEVGCGKAICKGQSA----STSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETHK-FCNKNLCSVTGLPSSSNHNPPNDGELTKGNII 766
            +  +S +++  ++  HN  R  V PPA+NM    W  +L R A+ W+  C WEH    N      GQNL  ++    P         V +W DE++ ++Y          P+ CSG +C HYTQ +WA +  +GC   +C   +         +++ C Y P GN+   APY+ GTPCS CP ++   C  NLC   G     N  PP   E+ K N+I
Sbjct:   58 RRAISQEDMHLIVDLHNKLRGQVYPPASNMEYMMWDYELERSAEYWAHMCRWEH--GPNHMLTQIGQNLGVHWGRDRPPTY-----HVQAWYDEVRHYSYPYSQECNPHCPLRCSGPVCTHYTQLVWATSNRIGCAINVCYNMNVWGMIWAKAVYLVCNYSPPGNWWGHAPYKYGTPCSACPASYAGGCRDNLCYKDG---GVNRRPPP--EIEKTNLI 264          
BLAST of R3H domain containing-like vs. Ensembl Medaka
Match: crispld1b (cysteine-rich secretory protein LCCL domain-containing 1 [Source:NCBI gene;Acc:101169145])

HSP 1 Score: 115.546 bits (288), Expect = 2.174e-28
Identity = 71/219 (32.42%), Postives = 105/219 (47.95%), Query Frame = 2
Query:  161 KSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNL--YYYETSPNALGTAEKAVISWSDEIQFFTY----------PITCSGGICGHYTQNIWADTYEVGCGKAICKGQSA----STSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETHK-FCNKNLCSVTGLPSSSNHNPPNDGELTKGNII 766
            +  +S +++  ++  HN  R  V PPA+NM    W  +L R A+ W+  C WEH    N      GQNL  ++    P         V +W DE++ ++Y          P+ CSG +C HYTQ +WA +  +GC   +C   +         +++ C Y P GN+   APY+ GTPCS CP ++   C  NLC   G     N  PP   E+ K N+I
Sbjct:  109 RRAISQEDMHLIVDLHNKLRGQVYPPASNMEYMMWDYELERSAEYWAHMCRWEH--GPNHMLTQIGQNLGVHWGRDRPPTY-----HVQAWYDEVRHYSYPYSQECNPHCPLRCSGPVCTHYTQLVWATSNRIGCAINVCYNMNVWGMIWAKAVYLVCNYSPPGNWWGHAPYKYGTPCSACPASYAGGCRDNLCYKDG---GVNRRPPP--EIEKTNLI 315          
BLAST of R3H domain containing-like vs. Ensembl Medaka
Match: crispld1a (cysteine rich secretory protein LCCL domain containing 1 [Source:NCBI gene;Acc:101172850])

HSP 1 Score: 115.161 bits (287), Expect = 2.470e-28
Identity = 66/208 (31.73%), Postives = 100/208 (48.08%), Query Frame = 2
Query:  152 QMRKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNL--YYYETSPNALGTAEKAVISWSDEIQFFTY----------PITCSGGICGHYTQNIWADTYEVGCGKAICKGQSA----STSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETH-KFCNKNLCSVTGLPSSSNH 724
            Q  K  ++D +   ++  HN  R  V PPA+NM    W  +L R A++W++ C+WEH           GQNL  ++    P         V +W DE++ +++          P  CSG +C HYTQ +WA +  +GC   +C             +++ C Y P+GN+   APY+ GTPCS CP ++   C  NLC     P S N+
Sbjct:   50 QRGKRAITDSDAQLILDLHNKLRGQVYPPASNMEYMMWDTELERSAEEWAETCLWEHGPA--SLLPQIGQNLGAHWGRYQPPTF-----HVQAWYDEVKDYSFPYPQECNPYCPFRCSGPVCTHYTQLVWATSSRIGCAINLCHNMDVWGQIWAKAVYLVCNYSPKGNWWGHAPYKHGTPCSACPPSYGGGCRDNLCYKDDRPYSENN 250          
BLAST of R3H domain containing-like vs. Ensembl Medaka
Match: crispld1a (cysteine rich secretory protein LCCL domain containing 1 [Source:NCBI gene;Acc:101172850])

HSP 1 Score: 115.161 bits (287), Expect = 2.670e-28
Identity = 66/207 (31.88%), Postives = 99/207 (47.83%), Query Frame = 2
Query:  152 QMRKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNL--YYYETSPNALGTAEKAVISWSDEIQFFTY----------PITCSGGICGHYTQNIWADTYEVGCGKAICKGQSA----STSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETH-KFCNKNLCSVTGLPSSSN 721
            Q  K  ++D +   ++  HN  R  V PPA+NM    W  +L R A++W++ C+WEH           GQNL  ++    P         V +W DE++ +++          P  CSG +C HYTQ +WA +  +GC   +C             +++ C Y P+GN+   APY+ GTPCS CP ++   C  NLC     P S N
Sbjct:   78 QRGKRAITDSDAQLILDLHNKLRGQVYPPASNMEYMMWDTELERSAEEWAETCLWEHGPAS--LLPQIGQNLGAHWGRYQPPTF-----HVQAWYDEVKDYSFPYPQECNPYCPFRCSGPVCTHYTQLVWATSSRIGCAINLCHNMDVWGQIWAKAVYLVCNYSPKGNWWGHAPYKHGTPCSACPPSYGGGCRDNLCYKDDRPYSEN 277          
BLAST of R3H domain containing-like vs. Planmine SMEST
Match: SMESG000044056.1 (SMESG000044056.1)

HSP 1 Score: 437.958 bits (1125), Expect = 8.497e-157
Identity = 210/239 (87.87%), Postives = 217/239 (90.79%), Query Frame = 2
Query:  110 MKLYNLCVFFMIQFQMRKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYPITCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETHKFCNKNLCSVTGLPSSSNHNPPNDGELTKGNIINNFTLITAIFIVFDMIFKQI 826
            MKLYNLCVFFMIQFQMRKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSP+ALGTAEKAVISWS+EIQ+FTYPITCSGG+CGHYTQNIWADTYEVGCGKAICKGQSA+TSKLFVTCQYYPRGNY +TAPYETGTPCSKCPETHK C KNLCS                   KGNIINNFTLIT+IFIVFDMIFKQI
Sbjct:    1 MKLYNLCVFFMIQFQMRKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPDALGTAEKAVISWSEEIQYFTYPITCSGGVCGHYTQNIWADTYEVGCGKAICKGQSAATSKLFVTCQYYPRGNYKDTAPYETGTPCSKCPETHKVCKKNLCS-------------------KGNIINNFTLITSIFIVFDMIFKQI 220          
BLAST of R3H domain containing-like vs. Planmine SMEST
Match: SMESG000044056.1 (SMESG000044056.1)

HSP 1 Score: 416.772 bits (1070), Expect = 1.497e-148
Identity = 200/229 (87.34%), Postives = 207/229 (90.39%), Query Frame = 2
Query:  140 MIQFQMRKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYPITCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETHKFCNKNLCSVTGLPSSSNHNPPNDGELTKGNIINNFTLITAIFIVFDMIFKQI 826
            MIQFQMRKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSP+ALGTAEKAVISWS+EIQ+FTYPITCSGG+CGHYTQNIWADTYEVGCGKAICKGQSA+TSKLFVTCQYYPRGNY +TAPYETGTPCSKCPETHK C KNLCS                   KGNIINNFTLIT+IFIVFDMIFKQI
Sbjct:    1 MIQFQMRKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPDALGTAEKAVISWSEEIQYFTYPITCSGGVCGHYTQNIWADTYEVGCGKAICKGQSAATSKLFVTCQYYPRGNYKDTAPYETGTPCSKCPETHKVCKKNLCS-------------------KGNIINNFTLITSIFIVFDMIFKQI 210          
BLAST of R3H domain containing-like vs. Planmine SMEST
Match: SMESG000044056.1 (SMESG000044056.1)

HSP 1 Score: 405.986 bits (1042), Expect = 2.008e-144
Identity = 195/224 (87.05%), Postives = 202/224 (90.18%), Query Frame = 2
Query:  155 MRKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYPITCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETHKFCNKNLCSVTGLPSSSNHNPPNDGELTKGNIINNFTLITAIFIVFDMIFKQI 826
            MRKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSP+ALGTAEKAVISWS+EIQ+FTYPITCSGG+CGHYTQNIWADTYEVGCGKAICKGQSA+TSKLFVTCQYYPRGNY +TAPYETGTPCSKCPETHK C KNLCS                   KGNIINNFTLIT+IFIVFDMIFKQI
Sbjct:    1 MRKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPDALGTAEKAVISWSEEIQYFTYPITCSGGVCGHYTQNIWADTYEVGCGKAICKGQSAATSKLFVTCQYYPRGNYKDTAPYETGTPCSKCPETHKVCKKNLCS-------------------KGNIINNFTLITSIFIVFDMIFKQI 205          
BLAST of R3H domain containing-like vs. Planmine SMEST
Match: SMESG000044051.1 (SMESG000044051.1)

HSP 1 Score: 155.221 bits (391), Expect = 6.946e-46
Identity = 72/169 (42.60%), Postives = 100/169 (59.17%), Query Frame = 2
Query:  194 MIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALG--TAEKAVISWSDEIQFFTYPITCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETHKFCNKNLCS 694
            M+  HN NRS V P ATNM + +W+  L  LA+ WS  C+++HP EDN  Y+ YGQNLY   T P ++     + AV++W  E Q F YP +C+G  CGH TQ +WA T  +GCG+A C     +   + +TCQY+ RGN +    Y++G  CS CP  +  C   LC+
Sbjct:    1 MLNIHNQNRSMVNPTATNMIKLQWNQTLEALAENWSSLCVFQHPAEDNAAYSSYGQNLYL-ATRPKSITPYDVDLAVLAWIKESQGFVYPSSCTG-TCGHATQILWATTSSIGCGRATCNATDPNNENILITCQYWLRGNILGQTLYQSGVSCSNCPTPYPDCENKLCT 167          
BLAST of R3H domain containing-like vs. Planmine SMEST
Match: SMESG000044054.1 (SMESG000044054.1)

HSP 1 Score: 149.058 bits (375), Expect = 2.722e-43
Identity = 84/242 (34.71%), Postives = 123/242 (50.83%), Query Frame = 2
Query:  104 LNMKLYNLCVFFMIQFQMRKSQLSDDEITKMIQYHNDNRSTVKPPATNMREFKWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAEKAVISWSDEIQFFTYPITCSGGICGHYTQNIWADTYEVGCGKAICKGQSASTSKLFVTCQYYPRGNYINTA-PYETGTPCSKCPETHKFCNKNLCSVTGLPSSSNHNPPNDGELTKGNIINNFTLITAIFIVFDMIFKQI 826
            +N K     +FF+I  + +       EI  +++  N  R  VKP A++M + + +  L  LADKWSK C + +P E+NK Y  YG N++      +    A  AV  WS E   +TYP  C  GIC HY Q IWA +  +GCGKA C  Q  +     +TC ++P+   I+T+ PY TG  C+KCPET  FC  NLCS  G+    +                    ++ +F V+D++F+ I
Sbjct:    1 MNCKFCEFLIFFIIGIRHKSLTEDSSEIENVLKAINWKRDIVKPSASDMTKMRLNESLNSLADKWSKYCSYGYPPENNKAYLEYGINIFDITKKLSDTFEASDAVDFWSKEYFNYTYPSICY-GICVHYLQVIWAASINLGCGKASCPSQDPANVHYMITCLFWPKPENISTSPPYRTGKSCTKCPETFVFCESNLCSSNGIKYRYSLA----------------VALSVLFSVYDLLFRLI 225          
The following BLAST results are available for this feature:
BLAST of R3H domain containing-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
R3HDML8.813e-3233.68R3H domain containing like [Source:HGNC Symbol;Acc... [more]
GLIPR1L19.367e-3234.58GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392][more]
PI151.955e-3132.64peptidase inhibitor 15 [Source:HGNC Symbol;Acc:HGN... [more]
PI151.955e-3132.64peptidase inhibitor 15 [Source:HGNC Symbol;Acc:HGN... [more]
PI151.955e-3132.64peptidase inhibitor 15 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of R3H domain containing-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scl-121.557e-2131.55SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-56.638e-2032.11SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-23.857e-1935.00SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-23.857e-1935.00SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-71.551e-1832.09SCP-Like extracellular protein [Source:UniProtKB/... [more]
back to top
BLAST of R3H domain containing-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG84837.987e-1930.45gene:FBgn0038126 transcript:FBtr0082782[more]
CG326792.335e-826.60gene:FBgn0052679 transcript:FBtr0071469[more]
CG169954.612e-731.78gene:FBgn0031412 transcript:FBtr0077758[more]
CG94009.704e-623.23gene:FBgn0030562 transcript:FBtr0073920[more]
back to top
BLAST of R3H domain containing-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
r3hdml3.214e-3638.30R3H domain containing-like [Source:ZFIN;Acc:ZDB-GE... [more]
r3hdml3.214e-3638.30R3H domain containing-like [Source:ZFIN;Acc:ZDB-GE... [more]
pi15a6.405e-3333.16peptidase inhibitor 15a [Source:NCBI gene;Acc:5619... [more]
pi15b7.348e-3233.68peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-... [more]
pi15b7.358e-3233.68peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of R3H domain containing-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
R3HDML4.936e-3233.68R3H domain containing-like [Source:NCBI gene;Acc:1... [more]
R3HDML6.061e-3233.68R3H domain containing-like [Source:NCBI gene;Acc:1... [more]
pi151.131e-3132.64peptidase inhibitor 15 [Source:NCBI gene;Acc:10048... [more]
crispld21.372e-2935.38cysteine-rich secretory protein LCCL domain contai... [more]
crispld21.701e-2935.38cysteine-rich secretory protein LCCL domain contai... [more]
back to top
BLAST of R3H domain containing-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
R3hdml4.017e-3534.50R3H domain containing-like [Source:MGI Symbol;Acc:... [more]
Pi151.801e-3132.64peptidase inhibitor 15 [Source:MGI Symbol;Acc:MGI:... [more]
Pi162.488e-3133.50peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi162.488e-3133.50peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi165.389e-3033.84peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of R3H domain containing-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A2A5I3|CRSPL_MOUSE2.810e-3434.50Peptidase inhibitor R3HDML OS=Mus musculus OX=1009... [more]
sp|Q32LB5|GPRL1_BOVIN1.159e-3332.39GLIPR1-like protein 1 OS=Bos taurus OX=9913 GN=GLI... [more]
sp|Q7T141|PI15A_DANRE4.835e-3233.16Peptidase inhibitor 15-A OS=Danio rerio OX=7955 GN... [more]
sp|Q9H3Y0|CRSPL_HUMAN4.232e-3133.68Peptidase inhibitor R3HDML OS=Homo sapiens OX=9606... [more]
sp|Q3KPV7|PI15_XENLA4.470e-3132.64Peptidase inhibitor 15 OS=Xenopus laevis OX=8355 G... [more]
back to top
BLAST of R3H domain containing-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564YKT88.835e-3938.86SCP domain-containing protein (Fragment) OS=Hymeno... [more]
A0A3Q3WXU05.923e-3739.06R3H domain containing-like OS=Mola mola OX=94237 P... [more]
A0A3B1JQ091.247e-3640.11R3H domain containing-like OS=Astyanax mexicanus O... [more]
A0A1S3MHR21.423e-3537.19peptidase inhibitor R3HDML-like isoform X1 OS=Salm... [more]
A0A1S3LKG21.729e-3539.66peptidase inhibitor R3HDML-like OS=Salmo salar OX=... [more]
back to top
BLAST of R3H domain containing-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
r3hdml4.722e-4040.11R3H domain containing like [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000031557.11.321e-3536.71peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000036030.19.463e-3537.25peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000029824.11.745e-3436.89peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
pi15a2.801e-3231.61peptidase inhibitor 15-A-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of R3H domain containing-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000374.12.022e-3437.57pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 ... [more]
ENSPMAT00000002250.14.459e-2128.72pep scaffold:Pmarinus_7.0:GL477299:1626:22672:-1 g... [more]
CRISP32.113e-1731.25cysteine rich secretory protein 3 [Source:HGNC Sym... [more]
CLEC18A2.243e-925.57C-type lectin domain family 18 member A [Source:HG... [more]
CRISP21.825e-837.38cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
back to top
BLAST of R3H domain containing-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PRY36.589e-933.61Cell wall-associated protein involved in export of... [more]
PRY11.503e-829.29Sterol binding protein involved in the export of a... [more]
PRY22.019e-829.45Sterol binding protein involved in the export of a... [more]
back to top
BLAST of R3H domain containing-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO488802.234e-1133.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419191.053e-1032.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO307701.388e-1028.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493102.531e-1028.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488815.032e-1026.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of R3H domain containing-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pi15a3.162e-3132.12peptidase inhibitor 15 [Source:NCBI gene;Acc:10117... [more]
crispld1b1.785e-2832.42cysteine-rich secretory protein LCCL domain-contai... [more]
crispld1b2.174e-2832.42cysteine-rich secretory protein LCCL domain-contai... [more]
crispld1a2.470e-2831.73cysteine rich secretory protein LCCL domain contai... [more]
crispld1a2.670e-2831.88cysteine rich secretory protein LCCL domain contai... [more]
back to top
BLAST of R3H domain containing-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044056.18.497e-15787.87SMESG000044056.1[more]
SMESG000044056.11.497e-14887.34SMESG000044056.1[more]
SMESG000044056.12.008e-14487.05SMESG000044056.1[more]
SMESG000044051.16.946e-4642.60SMESG000044051.1[more]
SMESG000044054.12.722e-4334.71SMESG000044054.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020109 ID=SMED30020109|Name=R3H domain containing-like|organism=Schmidtea mediterranea sexual|type=transcript|length=976bp
GTAAAATTAACATTGACAAACAAAATTTTATTATTATTTGAATTAAAATC
AATAGTAAAAAATTTATATATAAATTTATAGAAACTATCTGTGGATTTTG
AATTTGAATATGAAACTTTACAATTTATGTGTATTTTTTATGATTCAATT
CCAGATGAGAAAATCGCAATTATCAGACGATGAAATTACGAAGATGATCC
AATACCACAATGACAATAGAAGCACGGTTAAGCCTCCAGCAACCAACATG
CGCGAATTTAAATGGAGTAATAAATTAGCAAGACTTGCTGATAAATGGAG
CAAACAATGCATTTGGGAACATCCAAAAGAGGATAATAAAGAATATGCTC
CATATGGACAAAACCTTTATTATTATGAGACATCACCTAACGCTCTTGGC
ACAGCCGAAAAAGCAGTAATTTCATGGAGTGATGAAATCCAATTTTTTAC
ATATCCGATAACTTGCAGCGGCGGGATATGTGGACATTATACACAAAATA
TATGGGCAGATACATATGAAGTTGGTTGCGGTAAGGCAATATGCAAAGGT
CAATCTGCGTCAACTTCTAAGTTATTTGTCACTTGCCAATATTATCCTAG
AGGTAACTATATAAATACAGCGCCTTATGAAACAGGAACTCCATGCTCGA
AGTGTCCAGAAACTCATAAATTTTGCAATAAAAACTTATGCTCAGTTACG
GGTTTACCATCATCAAGCAATCATAACCCACCTAATGATGGTGAACTTAC
AAAGGGCAATATAATTAACAACTTTACATTAATAACAGCTATATTTATTG
TTTTTGATATGATATTTAAGCAAATTATTTAATTTTCCCATAACAAATTA
ACTTATATTTTGTCTAACAAGAAAATTTTTCAATTTAATTTAAAAAATCT
TTTAAAATATAATACAATTTGGAAAATTTATTTTTATGATTCAATACAAA
TTAAAAATAAATATAGTTATTATGCG
back to top

protein sequence of SMED30020109-orf-1

>SMED30020109-orf-1 ID=SMED30020109-orf-1|Name=SMED30020109-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=241bp
MKLYNLCVFFMIQFQMRKSQLSDDEITKMIQYHNDNRSTVKPPATNMREF
KWSNKLARLADKWSKQCIWEHPKEDNKEYAPYGQNLYYYETSPNALGTAE
KAVISWSDEIQFFTYPITCSGGICGHYTQNIWADTYEVGCGKAICKGQSA
STSKLFVTCQYYPRGNYINTAPYETGTPCSKCPETHKFCNKNLCSVTGLP
SSSNHNPPNDGELTKGNIINNFTLITAIFIVFDMIFKQII*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005576extracellular region
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR035940CAP_sf
IPR001283CRISP-related
IPR014044CAP_domain
IPR018244Allrgn_V5/Tpx1_CS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001283Cysteine-rich secretory protein-relatedPRINTSPR00837V5TPXLIKEcoord: 156..169
score: 45.04
coord: 124..140
score: 55.73
coord: 50..68
score: 29.03
coord: 102..115
score: 32.78
IPR001283Cysteine-rich secretory protein-relatedPANTHERPTHR10334CYSTEINE-RICH SECRETORY PROTEIN-RELATEDcoord: 16..200
IPR014044CAP domainSMARTSM00198SCP_3coord: 24..169
e-value: 5.3E-42
score: 155.5
IPR014044CAP domainPFAMPF00188CAPcoord: 31..161
e-value: 3.0E-22
score: 79.8
IPR035940CAP superfamilyGENE3DG3DSA:3.40.33.10coord: 12..203
e-value: 4.1E-55
score: 188.4
IPR035940CAP superfamilySUPERFAMILYSSF55797PR-1-likecoord: 13..176
NoneNo IPR availablePANTHERPTHR10334:SF220GLIPR1-LIKE PROTEIN 1coord: 16..200
NoneNo IPR availableCDDcd05380CAP_eukcoord: 32..162
e-value: 5.56221E-34
score: 116.785
IPR018244Allergen V5/Tpx-1-related, conserved sitePROSITEPS01010CRISP_2coord: 156..167