C2H2-type domain-containing protein

Overview
NameC2H2-type domain-containing protein
Smed IDSMED30020086
Length (bp)3125
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of C2H2-type domain-containing protein (SMED30020086) t-SNE clustered cells

Violin plots show distribution of expression levels for C2H2-type domain-containing protein (SMED30020086) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of C2H2-type domain-containing protein (SMED30020086) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for C2H2-type domain-containing protein (SMED30020086) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020086

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30020086SMESG000042794.1 SmedASXL_012325SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30020086SMESG000042794.1 dd_Smed_v4_10757_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30020086SMESG000042794.1 dd_Smed_v6_10757_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30020086SMESG000042794.1 dd_Smed_v4_10757_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000018529.1 (coiled-coil domain containing 157 [Source:NCBI gene;Acc:100494973])

HSP 1 Score: 61.6178 bits (148), Expect = 6.273e-9
Identity = 58/246 (23.58%), Postives = 129/246 (52.44%), Query Frame = 2
Query: 2192 LAIIKRKISDLTDNI-SQLNSTIQNQKSINENLTLTENVIKNKEEKLVKRLQSLTEQKHKLEEKIDILQDQVESNQES-------IRALENERNSMSMKLSNQTILIETITKAKDEFRVRITELQSQLEGMQQTILEINQGKDLLVNYPDLNGPLDKFESGNIEQDLINQIKSNAARISLLSEQNRDLEQALEKLNQ-TYXXXXXXXXXXXVKATNNLSNTSGLPPNVASLELSRPHSKMSHVGQS 2902
            ++++ +K+SDL  ++ S LN    +++++++    +E+ ++N +E L  + +SL +Q  +L ++ + LQ  V   +E        I  +E ER  +  +L  Q  +++ + + K       + L  QL  ++Q++ E  + + LL  YP+L  P +   +G++ QD+  Q+++N  RI++L E+N  L   L KL + ++     ++  + + +  +++ ++GL P     + +RP   +    QS
Sbjct:  293 VSMLVQKMSDLKSDLKSTLNKLQDSEEAMSKERARSES-LQNHKESLHMKQRSLLQQLDRLAQENEDLQGTVGEAEEEKAKLVDQIADIERERKVLRSQLQEQQEIVKVLQQEKQILEESASSLDRQLVELKQSLQEQREREKLLALYPELQPPPEFEGTGDVTQDMEKQLQANNLRITILEEENSRLRATLCKLREKSHQEPLRLVPQTQLWSIPHVTESAGLEPRHEVSKKARPQLNLRDTSQS 537          
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000018525.1 (coiled-coil domain containing 157 [Source:NCBI gene;Acc:100494973])

HSP 1 Score: 51.9878 bits (123), Expect = 1.875e-6
Identity = 44/197 (22.34%), Postives = 99/197 (50.25%), Query Frame = 2
Query: 2315 KEEKLVKRLQSLTEQKHKLEEKIDILQDQVESNQESIRALENERNSMSMKLSNQTILIETITKAKDEFRVRITELQSQLEGMQQTILEINQGKDLLVNYPDLNGPLDKFESGNIEQDLINQIKSNAARISLLSEQNRDLEQALEKLNQ-TYXXXXXXXXXXXVKATNNLSNTSGLPPNVASLELSRPHSKMSHVGQS 2902
            K+  L+++L  L ++   L+  +   +++     + I  +E ER  +  +L  Q  +++ + + K       + L  QL  ++Q++ E  + + LL  YP+L  P +   +G++ QD+  Q+++N  RI++L E+N  L   L KL + ++     ++  + + +  +++ ++GL P     + +RP   +    QS
Sbjct:   12 KQRSLLQQLDRLAQENEDLQGTVGEAEEEKAKLVDQIADIERERKVLRSQLQEQQEIVKVLQQEKQILEESASSLDRQLVELKQSLQEQREREKLLALYPELQPPPEFEGTGDVTQDMEKQLQANNLRITILEEENSRLRATLCKLREKSHQEPLRLVPQTQLWSIPHVTESAGLEPRHEVSKKARPQLNLRDTSQS 208          
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Match: Ccdc157 (coiled-coil domain containing 157 [Source:MGI Symbol;Acc:MGI:3041210])

HSP 1 Score: 56.225 bits (134), Expect = 1.886e-7
Identity = 43/185 (23.24%), Postives = 103/185 (55.68%), Query Frame = 2
Query: 2210 KISDLTDNISQLNSTIQNQKSINENLTLTENVIKNKEEKLVKRLQSLTEQKHKLEEKIDILQDQVESNQESIRALENERNSMSMKLSNQTILIETITKAKDEFRVRITELQSQLEGMQQTILEINQGKDLLVNYPDLNGPLDK--FESGNIEQDLINQIKSNAARISLLSEQNRDLEQALEKLNQ 2758
            ++   +  I   ++ +  +K+  +++   +  ++ K+  L+++L  L +++ +L   +D  + Q    +E +++L+++R     +L  Q  L++++ + K +     T+LQ  +  ++Q + E+ + + LLV +PDL+ P +     S N+ QD+  Q+++NA RI +L E+N+ L+  L K+ +
Sbjct:  415 RLDGASQQIRWASTELDKEKARVDSMVRHQESLQAKQRTLLQQLDCLDQEREELRGSLDEAEAQRSELEEQLQSLQSDREQEQCQLQAQQELLQSLQQEKQDLEQVTTDLQLTISELRQQLEELKERERLLVAFPDLHQPEEAQIQSSSNVTQDMERQVQANAIRIQVLQEENKRLQSMLTKIRE 599          
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Match: Ccdc157 (coiled-coil domain containing 157 [Source:MGI Symbol;Acc:MGI:3041210])

HSP 1 Score: 55.4546 bits (132), Expect = 3.179e-7
Identity = 43/185 (23.24%), Postives = 103/185 (55.68%), Query Frame = 2
Query: 2210 KISDLTDNISQLNSTIQNQKSINENLTLTENVIKNKEEKLVKRLQSLTEQKHKLEEKIDILQDQVESNQESIRALENERNSMSMKLSNQTILIETITKAKDEFRVRITELQSQLEGMQQTILEINQGKDLLVNYPDLNGPLDK--FESGNIEQDLINQIKSNAARISLLSEQNRDLEQALEKLNQ 2758
            ++   +  I   ++ +  +K+  +++   +  ++ K+  L+++L  L +++ +L   +D  + Q    +E +++L+++R     +L  Q  L++++ + K +     T+LQ  +  ++Q + E+ + + LLV +PDL+ P +     S N+ QD+  Q+++NA RI +L E+N+ L+  L K+ +
Sbjct:  313 RLDGASQQIRWASTELDKEKARVDSMVRHQESLQAKQRTLLQQLDCLDQEREELRGSLDEAEAQRSELEEQLQSLQSDREQEQCQLQAQQELLQSLQQEKQDLEQVTTDLQLTISELRQQLEELKERERLLVAFPDLHQPEEAQIQSSSNVTQDMERQVQANAIRIQVLQEENKRLQSMLTKIRE 497          
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5SPX1|CC157_MOUSE (Coiled-coil domain-containing protein 157 OS=Mus musculus OX=10090 GN=Ccdc157 PE=1 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 1.319e-6
Identity = 43/185 (23.24%), Postives = 103/185 (55.68%), Query Frame = 2
Query: 2210 KISDLTDNISQLNSTIQNQKSINENLTLTENVIKNKEEKLVKRLQSLTEQKHKLEEKIDILQDQVESNQESIRALENERNSMSMKLSNQTILIETITKAKDEFRVRITELQSQLEGMQQTILEINQGKDLLVNYPDLNGPLDK--FESGNIEQDLINQIKSNAARISLLSEQNRDLEQALEKLNQ 2758
            ++   +  I   ++ +  +K+  +++   +  ++ K+  L+++L  L +++ +L   +D  + Q    +E +++L+++R     +L  Q  L++++ + K +     T+LQ  +  ++Q + E+ + + LLV +PDL+ P +     S N+ QD+  Q+++NA RI +L E+N+ L+  L K+ +
Sbjct:  415 RLDGASQQIRWASTELDKEKARVDSMVRHQESLQAKQRTLLQQLDCLDQEREELRGSLDEAEAQRSELEEQLQSLQSDREQEQCQLQAQQELLQSLQQEKQDLEQVTTDLQLTISELRQQLEELKERERLLVAFPDLHQPEEAQIQSSSNVTQDMERQVQANAIRIQVLQEENKRLQSMLTKIRE 599          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A1S3JCA9 (coiled-coil domain-containing protein 157 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106172015 PE=4 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 5.171e-16
Identity = 86/371 (23.18%), Postives = 163/371 (43.94%), Query Frame = 2
Query: 2123 EELDKLKVSI-SNFNVNATDPFE------ALAIIKRKISDLTDNISQLNSTIQNQKSINENLTLTENVIKNKEEKLVKRLQSLTEQKHKLEEKIDILQDQVESNQESIRALENERNSMSMKLSNQTILIETITKAKDEFRVRITELQSQLEGMQQTILEINQGKDLLVNYPDLNGPL--DKFESGNIEQDLINQIKSNAARISLLSEQNRDLEQALEKLNQTYXXXXXXXXXXXVKATNNLSNTSGLPPNVASLELSRPHS-KMSHVGQSMPKRQTHRQSTSSRPPSRDNIASQGSIIQWSVSNQK----------------PSHANVI-----------------FVCETCGRSYQQKSDLDVHKEYCAG 3106
            E+L+  KV +  +   NA++  E       ++ +K +++D+ +        +  Q+ +N+ L+  +  ++ K+E L++R+ +L +    L+++++ ++D+ +S QE++  +  E+  +  ++S Q I +  + K K      + +L+  +  + Q + E  + + LLV YPDLNGP+  D   SG+I  D+ NQ+K+N  RI +L EQN  L  ++ K+             +     N+ + +SG  P      L RP + +        P  +     T +   +R  I S G       +N                  PS    +                 F C  C + Y   +DLD+HK YC G
Sbjct:  385 EDLEATKVQLLKDLQENASNSSEIQTLEGVVSDLKSQLNDVKEKFDTTTKELAKQQVVNKTLSRNKEALQGKQESLLQRIDALDQDNESLKQRVEEIEDERDSLQENLDKVTEEKEKLVEEMSVQQIHLTELNKEKSSLEQAMQQLEQNIAALTQDLQEAQERERLLVEYPDLNGPVNPDLAGSGDIALDMENQVKANHTRIQILEEQNTALRNSITKV------------LAAQAKGNSAAGSSGPVP------LWRPDASRSQQKQSQQPHYEQRGGHTRNIQENRPRITSAGKASPLVAANSSSLAAYKQLKKAGLLPGPSSKGKVERPSSTGSGSGYSPQDVFTCGKCDKVYTTLADLDLHKSYCYG 737          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A267GZ09 (C2H2-type domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010910g1 PE=4 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 5.756e-16
Identity = 69/275 (25.09%), Postives = 141/275 (51.27%), Query Frame = 2
Query: 1940 ETKFSRQIHEFGVENEKLTNTISQLKLQTASLMEEIELKDKQINQDRAQLKQHILEKQNINEELDKLKVSISNFNVNATDPFEALAIIKRKISDLTDNISQLNSTIQNQKSINENLTLTENVIKNKEEKLVKRLQSLTEQKHKLEEKIDILQDQVESNQESIRALENERNSMSMKLSNQTILIETITKAKDEFRVRITELQSQLEGMQQTILEINQGKDLLVNYPDLNGPL--DKFESGNIEQDLINQIKSNAARISLLSEQNRDLEQALEKLNQ 2758
            E+K  + + ++    +++++    L+     LM++IE   K I Q    +K     K  + +   +  +S+ +  +       A+  +  +++DLTD + Q     Q   +  ENL      ++ K     +R+  L+ +  +L+E +D L++  ++++ S + LE E  +  M+     +LI+T+T+A+D   + +  L+SQ+  +Q ++ +    K LL+ YPDLNGP+  D   +G+   D+  Q+ +N  RI LL+EQ   + +ALE++ +
Sbjct:  316 ESKMDKLVKQYEATVDQVSSANKALEASKLQLMKDIEAAKKSIEQQEELIKLLDRVKNRVKQVSKRDDLSLEDLEL-------AVGSVGERLTDLTDQLCQAREETQAAATQCENLARQNESLQAKHRMTAERVAELSAENEQLKEALDELEEFKDNHRSSGKDLEKELVAAKMQNKESEMLIKTLTEAQDNLTLSVQRLKSQVSDLQTSLQKSEDEKRLLIEYPDLNGPVNQDVEGTGDPLADMRQQVFANETRIRLLTEQTSSMRRALERVGK 583          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A267GJS4 (C2H2-type domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010910g2 PE=4 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 6.436e-16
Identity = 69/275 (25.09%), Postives = 141/275 (51.27%), Query Frame = 2
Query: 1940 ETKFSRQIHEFGVENEKLTNTISQLKLQTASLMEEIELKDKQINQDRAQLKQHILEKQNINEELDKLKVSISNFNVNATDPFEALAIIKRKISDLTDNISQLNSTIQNQKSINENLTLTENVIKNKEEKLVKRLQSLTEQKHKLEEKIDILQDQVESNQESIRALENERNSMSMKLSNQTILIETITKAKDEFRVRITELQSQLEGMQQTILEINQGKDLLVNYPDLNGPL--DKFESGNIEQDLINQIKSNAARISLLSEQNRDLEQALEKLNQ 2758
            E+K  + + ++    +++++    L+     LM++IE   K I Q    +K     K  + +   +  +S+ +  +       A+  +  +++DLTD + Q     Q   +  ENL      ++ K     +R+  L+ +  +L+E +D L++  ++++ S + LE E  +  M+     +LI+T+T+A+D   + +  L+SQ+  +Q ++ +    K LL+ YPDLNGP+  D   +G+   D+  Q+ +N  RI LL+EQ   + +ALE++ +
Sbjct:  316 ESKMDKLVKQYEATVDQVSSANKALEASKLQLMKDIEAAKKSIEQQEELIKLLDRVKNRVKQVSKRDDLSLEDLEL-------AVGSVGERLTDLTDQLCQAREETQAAATQCENLARQNESLQAKHRMTAERVAELSAENEQLKEALDELEEFKDNHRSSGKDLEKELVAAKMQNKESEMLIKTLTEAQDNLTLSVQRLKSQVSDLQTSLQKSEDEKRLLIEYPDLNGPVNQDVEGTGDPLADMRQQVFANETRIRLLTEQTSSMRRALERVGK 583          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A1S3JDS8 (coiled-coil domain-containing protein 157 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106172015 PE=4 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 5.858e-14
Identity = 62/253 (24.51%), Postives = 138/253 (54.55%), Query Frame = 2
Query: 2042 EIELKDKQINQDRAQLKQHILEK-------QNINEELDKLKVSI-SNFNVNATDPFE------ALAIIKRKISDLTDNISQLNSTIQNQKSINENLTLTENVIKNKEEKLVKRLQSLTEQKHKLEEKIDILQDQVESNQESIRALENERNSMSMKLSNQTILIETITKAKDEFRVRITELQSQLEGMQQTILEINQGKDLLVNYPDLNGPL--DKFESGNIEQDLINQIKSNAARISLLSEQNRDLEQALEKL 2752
            E++ ++ ++  D+ +L+ ++++        Q   E+L+  KV +  +   NA++  E       ++ +K +++D+ +        +  Q+ +N+ L+  +  ++ K+E L++R+ +L +    L+++++ ++D+ +S QE++  +  E+  +  ++S Q I +  + K K      + +L+  +  + Q + E  + + LLV YPDLNGP+  D   SG+I  D+ NQ+K+N  RI +L EQN  L  ++ K+
Sbjct:  351 EVQRQNDKLRSDKKELETNVVKAREELASTQKRIEDLEATKVQLLKDLQENASNSSEIQTLEGVVSDLKSQLNDVKEKFDTTTKELAKQQVVNKTLSRNKEALQGKQESLLQRIDALDQDNESLKQRVEEIEDERDSLQENLDKVTEEKEKLVEEMSVQQIHLTELNKEKSSLEQAMQQLEQNIAALTQDLQEAQERERLLVEYPDLNGPVNPDLAGSGDIALDMENQVKANHTRIQILEEQNTALRNSITKV 603          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A026X2S7 (Uncharacterized protein (Fragment) OS=Ooceraea biroi OX=2015173 GN=X777_10511 PE=4 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 4.087e-12
Identity = 44/101 (43.56%), Postives = 54/101 (53.47%), Query Frame = 2
Query:  344 QEVLWLKLNEFDLDGMKFHQDAARCPAAYVTIYLLQMQFGESIISRNAAVKWPPRSCDL-------QTSNLGDFKLNIKR---SIRSDLFENVIENWVCQI 616
            Q   W +LN+ DL+ M F QD A C  A  TI LLQ +F E +ISR   V WP RSCDL           + D K NI R    IR  L E+VIEN+  ++
Sbjct:   23 QTFFWHQLNDLDLENMWFQQDEATCHTADETIALLQEKFSERVISRRGNVNWPQRSCDLTPLDFFKNPKTIDDLKSNITRVIADIRIHLCESVIENFAQRV 123          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000042794.1 (SMESG000042794.1)

HSP 1 Score: 779.245 bits (2011), Expect = 0.000e+0
Identity = 401/402 (99.75%), Postives = 402/402 (100.00%), Query Frame = 2
Query: 1919 QCEMLASETKFSRQIHEFGVENEKLTNTISQLKLQTASLMEEIELKDKQINQDRAQLKQHILEKQNINEELDKLKVSISNFNVNATDPFEALAIIKRKISDLTDNISQLNSTIQNQKSINENLTLTENVIKNKEEKLVKRLQSLTEQKHKLEEKIDILQDQVESNQESIRALENERNSMSMKLSNQTILIETITKAKDEFRVRITELQSQLEGMQQTILEINQGKDLLVNYPDLNGPLDKFESGNIEQDLINQIKSNAARISLLSEQNRDLEQALEKLNQTYXXXXXXXXXXXVKATNNLSNTSGLPPNVASLELSRPHSKMSHVGQSMPKRQTHRQSTSSRPPSRDNIASQGSIIQWSVSNQKPSHANVIFVCETCGRSYQQKSDLDVHKEYCAGRRRRSE 3124
            +CEMLASETKFSRQIHEFGVENEKLTNTISQLKLQTASLMEEIELKDKQINQDRAQLKQHILEKQNINEELDKLKVSISNFNVNATDPFEALAIIKRKISDLTDNISQLNSTIQNQKSINENLTLTENVIKNKEEKLVKRLQSLTEQKHKLEEKIDILQDQVESNQESIRALENERNSMSMKLSNQTILIETITKAKDEFRVRITELQSQLEGMQQTILEINQGKDLLVNYPDLNGPLDKFESGNIEQDLINQIKSNAARISLLSEQNRDLEQALEKLNQTYSSNKSIISNSNVKATNNLSNTSGLPPNVASLELSRPHSKMSHVGQSMPKRQTHRQSTSSRPPSRDNIASQGSIIQWSVSNQKPSHANVIFVCETCGRSYQQKSDLDVHKEYCAGRRRRSE
Sbjct:  329 KCEMLASETKFSRQIHEFGVENEKLTNTISQLKLQTASLMEEIELKDKQINQDRAQLKQHILEKQNINEELDKLKVSISNFNVNATDPFEALAIIKRKISDLTDNISQLNSTIQNQKSINENLTLTENVIKNKEEKLVKRLQSLTEQKHKLEEKIDILQDQVESNQESIRALENERNSMSMKLSNQTILIETITKAKDEFRVRITELQSQLEGMQQTILEINQGKDLLVNYPDLNGPLDKFESGNIEQDLINQIKSNAARISLLSEQNRDLEQALEKLNQTYSSNKSIISNSNVKATNNLSNTSGLPPNVASLELSRPHSKMSHVGQSMPKRQTHRQSTSSRPPSRDNIASQGSIIQWSVSNQKPSHANVIFVCETCGRSYQQKSDLDVHKEYCAGRRRRSE 730          
The following BLAST results are available for this feature:
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSXETT00000018529.16.273e-923.58coiled-coil domain containing 157 [Source:NCBI gen... [more]
ENSXETT00000018525.11.875e-622.34coiled-coil domain containing 157 [Source:NCBI gen... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ccdc1571.886e-723.24coiled-coil domain containing 157 [Source:MGI Symb... [more]
Ccdc1573.179e-723.24coiled-coil domain containing 157 [Source:MGI Symb... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q5SPX1|CC157_MOUSE1.319e-623.24Coiled-coil domain-containing protein 157 OS=Mus m... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JCA95.171e-1623.18coiled-coil domain-containing protein 157 isoform ... [more]
A0A267GZ095.756e-1625.09C2H2-type domain-containing protein (Fragment) OS=... [more]
A0A267GJS46.436e-1625.09C2H2-type domain-containing protein (Fragment) OS=... [more]
A0A1S3JDS85.858e-1424.51coiled-coil domain-containing protein 157 isoform ... [more]
A0A026X2S74.087e-1243.56Uncharacterized protein (Fragment) OS=Ooceraea bir... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000042794.10.000e+099.75SMESG000042794.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020086 ID=SMED30020086|Name=C2H2-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3125bp
GATTGGATAATTTGATTGGATATTAATAATTTCCTAAAAATATAATGAAA
TTGCAAAATTATATCTCTATTTAAAAAAAATGTCTAAATTATGATTATAA
AAATGGATTATTGGAATCCTTGTAGAAAAATGTACAACGGCATATTATTC
AATCAGCACTTTATCAAGATTACGGATCGACATATTTTGCTTGCTATTCG
TTGCAGTCTGCAACTTGCAGAATGTGAAAAGGATTTTGCTGTTCACCGTA
CTAAAATCCACCAATAAGATATCGAAATGCAAGAAGCAGGTGTAAGAGCA
AATGTAGCAGAAGATGCTAATTTTTCGGTTCCCTCGCCGTTCACAAGAAG
TATTGTGGCTAAAACTGAATGAATTCGACCTGGATGGCATGAAGTTTCAC
CAAGATGCTGCCAGGTGTCCTGCTGCATATGTCACAATATACTTATTGCA
AATGCAATTTGGTGAGTCGATAATTTCTAGAAATGCAGCTGTCAAATGGC
CTCCTAGAAGTTGTGATTTACAAACCTCAAATCTTGGTGATTTTAAATTG
AATATCAAACGCTCCATTAGGTCTGATTTATTTGAAAATGTCATAGAAAA
TTGGGTTTGTCAAATTCACCCAGGTAAGGAGAGTATGATGAGAAAATGGA
TAATTTTATTGAAGAAAAAATTTAAACAAAGAATTATAGAAATTGAAAAT
GACTTTAATTTGTTTTACTACACGTTTGAAATTTTTTATAAAATAAATTA
TTTTCATAATTATAGATTTCATGGAAACGGCATAAAATGACAAAATTAAA
TAATATTTCACATAAGTCGAGTACCCTTGATTCAATGGTACCATCGAATG
GTACCTTGCATCTATCTTACTAGCTTAATTATATCGAGTAACAGGCAAAC
AGACGAACTTAGTCAATTATATATAAAGATTCTTATTTCGTTATTAAGCT
ATTCTATTATTTATATATTTTTCTTGTGAATTTCATTAAATTTTTCCTAA
TTGTCATTTTATTTTTAATTAAACCTTATTAAAAATTATTCTTAAATTTT
TTTCCATAACAGCTCTCAATTCAAAAATATCCACCGAATATAAATTATAA
ATTCAAGTTTGTGCCCAGGGTCCCCATAGTAGTAGATTATCGATATTTTA
CTAATATATTGATGAAACGTATTAAAAATGACGGAAGAATATTTTATTGT
TTTCGAAAGCTTATTTTAAATCATTTCGAAGGTTCTTATAATGCCAATTT
TTGTGTTTTATAAATAAATTATAATCTTTCCTGATATAGAGTCACTACCT
AGAACATTAATTGCCTCTTTGAGTTCTAGCAGCGAGTTTAGAATCAAGTT
CACAATCTGACTTCTATACCAAAATACCTCCACCCCAGAAACGGTACCAA
TTACGGTTATGTCGAGTAATAAACTTCTAAAACTATTGAATAATATTGCA
TTATCAATTTCTACTACTTCTGTAATTATGCTTGGTTTAATTTCACCAGC
TACCTCAATTTATATCTGCCCATTTTTAATACCATATTCGATTCAAACAT
TTTCCTAACGTTCTGTACTAATTCATTTGAAACCGCACTCTGTTTCTGAA
GATAATATTATAATTCATTGTATTCTATCCATTTTGACTTGAATTCTTAT
CACTGTCACCAGTTGGAATTTCACTATGGACTTCTTATTGAGCTTTAAGT
GCAAATCCCTCAATATATTCCTCTTAACGTTCATCATCATATGTTGATTA
TCATCAGCTTCTAAATATATATATATATTTATTTTCATCATTGACCTGCG
TTTATTTTCAATTTCCTTTATCTTACAGTTTTTATTTGTTCAATGGCTTT
ATTTATTTAACACCAACTTTCGGCATAGATTTTTTTGCAGTGTTTGGAAT
CTTTTTAAACTTTCTATTCAGTGTGAAATGCTTGCTTCTGAAACCAAATT
TAGTCGACAAATACATGAATTCGGCGTTGAAAATGAAAAACTAACAAACA
CGATAAGCCAGTTGAAATTGCAAACTGCTTCATTGATGGAAGAAATTGAG
TTGAAGGATAAACAAATAAATCAAGACAGAGCGCAATTAAAACAACATAT
ATTAGAAAAACAAAATATCAACGAAGAATTAGACAAACTCAAAGTGTCAA
TTTCCAATTTCAATGTCAACGCAACCGATCCATTCGAAGCTCTTGCCATT
ATCAAAAGGAAAATCTCCGACCTAACCGACAACATTTCCCAATTGAATTC
TACCATCCAAAATCAAAAGTCCATCAACGAAAATTTGACATTGACAGAAA
ATGTAATCAAGAACAAGGAAGAAAAGTTAGTAAAGCGATTACAAAGTTTA
ACGGAACAGAAGCACAAGCTTGAAGAGAAAATAGACATTTTACAAGACCA
AGTAGAAAGTAATCAAGAAAGTATTCGTGCTCTAGAAAATGAAAGAAACT
CAATGTCTATGAAATTATCGAATCAAACTATTTTGATTGAGACAATTACT
AAAGCAAAAGATGAATTTAGGGTAAGAATTACTGAGCTTCAAAGTCAGTT
GGAAGGTATGCAACAGACGATTCTTGAAATAAATCAAGGAAAGGATTTAT
TAGTTAATTATCCAGACCTTAATGGGCCCTTAGATAAATTTGAATCAGGA
AATATTGAACAAGATCTCATAAATCAAATCAAATCAAACGCAGCTCGCAT
AAGTTTGCTGTCAGAGCAAAATCGGGATTTAGAACAAGCATTAGAAAAAC
TTAATCAAACTTATTCATCTAATAAAAGTATTATTTCAAATAGTAATGTA
AAAGCAACCAACAATTTGTCCAATACAAGTGGTTTACCCCCAAATGTTGC
TAGTTTAGAGTTATCGAGACCTCATTCCAAAATGTCCCATGTGGGTCAGT
CTATGCCCAAAAGACAAACTCATAGACAATCAACTTCCAGCAGACCTCCA
AGCAGAGACAATATCGCATCACAAGGTTCAATTATTCAATGGTCAGTTTC
TAACCAGAAACCATCTCATGCAAATGTAATATTTGTTTGTGAAACATGCG
GTCGTAGTTACCAACAAAAATCTGATTTGGATGTTCATAAAGAATATTGC
GCAGGTCGGCGACGAAGGAGTGAAC
back to top

protein sequence of SMED30020086-orf-1

>SMED30020086-orf-1 ID=SMED30020086-orf-1|Name=SMED30020086-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=159bp
MLIFRFPRRSQEVLWLKLNEFDLDGMKFHQDAARCPAAYVTIYLLQMQFG
ESIISRNAAVKWPPRSCDLQTSNLGDFKLNIKRSIRSDLFENVIENWVCQ
IHPGKESMMRKWIILLKKKFKQRIIEIENDFNLFYYTFEIFYKINYFHNY
RFHGNGIK*
back to top

protein sequence of SMED30020086-orf-2

>SMED30020086-orf-2 ID=SMED30020086-orf-2|Name=SMED30020086-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=399bp
MLASETKFSRQIHEFGVENEKLTNTISQLKLQTASLMEEIELKDKQINQD
RAQLKQHILEKQNINEELDKLKVSISNFNVNATDPFEALAIIKRKISDLT
DNISQLNSTIQNQKSINENLTLTENVIKNKEEKLVKRLQSLTEQKHKLEE
KIDILQDQVESNQESIRALENERNSMSMKLSNQTILIETITKAKDEFRVR
ITELQSQLEGMQQTILEINQGKDLLVNYPDLNGPLDKFESGNIEQDLINQ
IKSNAARISLLSEQNRDLEQALEKLNQTYSSNKSIISNSNVKATNNLSNT
SGLPPNVASLELSRPHSKMSHVGQSMPKRQTHRQSTSSRPPSRDNIASQG
SIIQWSVSNQKPSHANVIFVCETCGRSYQQKSDLDVHKEYCAGRRRRSE
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
GO:0003674molecular_function
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR029681CCDC157
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 258..278
NoneNo IPR availableCOILSCoilCoilcoord: 89..116
NoneNo IPR availableCOILSCoilCoilcoord: 131..179
NoneNo IPR availableCOILSCoilCoilcoord: 187..214
NoneNo IPR availableCOILSCoilCoilcoord: 19..81
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 318..345
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 313..345
IPR029681Coiled-coil domain-containing protein 157PANTHERPTHR43696FAMILY NOT NAMEDcoord: 5..368
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 369..396
score: 10.367