High mobility group protein B1

Overview
NameHigh mobility group protein B1
Smed IDSMED30020070
Length (bp)1454
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of High mobility group protein B1 (SMED30020070) t-SNE clustered cells

Violin plots show distribution of expression levels for High mobility group protein B1 (SMED30020070) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of High mobility group protein B1 (SMED30020070) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for High mobility group protein B1 (SMED30020070) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30020070

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30020070SMESG000034017.1 SmedASXL_005800SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30020070SMESG000034017.1 SmedASXL_005800SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30020070SMESG000034017.1 dd_Smed_v4_1095_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30020070SMESG000034017.1 dd_Smed_v4_1095_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30020070SMESG000034017.1 dd_Smed_v4_1095_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30020070SMESG000034017.1 dd_Smed_v4_1095_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30020070SMESG000034017.1 dd_Smed_v4_1095_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30020070SMESG000034017.1 dd_Smed_v4_1095_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30020070SMESG000034017.1 dd_Smed_v4_1095_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30020070SMESG000034017.1 dd_Smed_v4_1095_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30020070SMESG000034017.1 dd_Smed_v4_1095_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30020070SMESG000034017.1 dd_Smed_v4_1095_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30020070SMESG000034017.1 dd_Smed_v4_1095_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30020070SMESG000034017.1 dd_Smed_v4_1095_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020070SMESG000048483.1 SMESG000034017.1 Contig18201uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30020070SMESG000048483.1 SMESG000034017.1 Contig18201newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
X1 cellSMED30020070SMESG000034017.1 isotig06018be_Smed_v2PMID:22543868
Onal et al., 2012
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30020070SMESG000034017.1 dd_Smed_v6_1095_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30020070SMESG000034017.1 dd_Smed_v4_1095_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 1 cellSMED30020070SMESG000034017.1 H.50.4dsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
Category 1 cellSMED30020070SMESG000034017.1 H.50.4dsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of High mobility group protein B1 vs. Ensembl Human
Match: HMGB2 (high mobility group box 2 [Source:HGNC Symbol;Acc:HGNC:5000])

HSP 1 Score: 117.087 bits (292), Expect = 9.421e-30
Identity = 65/160 (40.62%), Postives = 101/160 (63.12%), Query Frame = 3
Query:   69 MTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEEN-----DXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLW--EACSDRDRYEKMATLDKERYEKEMEQFRA-GNFVAGE 524
            M++Y +FV+  R+EH+KKHP+   +F EFS KC+E+WK+M  +E+ +FE++A  +      + K     K  +K +KK P  PKR  SAFF FC E RPK++ EHP   + + A++LG +W  ++  D+  YE+ A   KE+YEK++  +RA G   AG+
Sbjct:   13 MSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGK 172          
BLAST of High mobility group protein B1 vs. Ensembl Human
Match: HMGB2 (high mobility group box 2 [Source:HGNC Symbol;Acc:HGNC:5000])

HSP 1 Score: 117.087 bits (292), Expect = 9.421e-30
Identity = 65/160 (40.62%), Postives = 101/160 (63.12%), Query Frame = 3
Query:   69 MTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEEN-----DXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLW--EACSDRDRYEKMATLDKERYEKEMEQFRA-GNFVAGE 524
            M++Y +FV+  R+EH+KKHP+   +F EFS KC+E+WK+M  +E+ +FE++A  +      + K     K  +K +KK P  PKR  SAFF FC E RPK++ EHP   + + A++LG +W  ++  D+  YE+ A   KE+YEK++  +RA G   AG+
Sbjct:   13 MSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGK 172          
BLAST of High mobility group protein B1 vs. Ensembl Human
Match: HMGB2 (high mobility group box 2 [Source:HGNC Symbol;Acc:HGNC:5000])

HSP 1 Score: 117.087 bits (292), Expect = 9.421e-30
Identity = 65/160 (40.62%), Postives = 101/160 (63.12%), Query Frame = 3
Query:   69 MTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEEN-----DXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLW--EACSDRDRYEKMATLDKERYEKEMEQFRA-GNFVAGE 524
            M++Y +FV+  R+EH+KKHP+   +F EFS KC+E+WK+M  +E+ +FE++A  +      + K     K  +K +KK P  PKR  SAFF FC E RPK++ EHP   + + A++LG +W  ++  D+  YE+ A   KE+YEK++  +RA G   AG+
Sbjct:   13 MSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGK 172          
BLAST of High mobility group protein B1 vs. Ensembl Human
Match: HMGB1 (high mobility group box 1 [Source:HGNC Symbol;Acc:HGNC:4983])

HSP 1 Score: 111.694 bits (278), Expect = 1.020e-27
Identity = 67/164 (40.85%), Postives = 100/164 (60.98%), Query Frame = 3
Query:   33 MDSSTGKSNKLAMTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASE-----ENDXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWE--ACSDRDRYEKMATLDKERYEKEMEQFRA 503
            M     K  +  M++Y +FV+  R+EH+KKHP+   +F+EFS KC+E+WK+M  +E+ +FE++A       E + K     K   K++ K P  PKR  SAFF FC E RPK++ EHP   + +VA++LG +W   A  D+  YEK A   KE+YEK++  +RA
Sbjct:    1 MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRA 164          
BLAST of High mobility group protein B1 vs. Ensembl Human
Match: HMGB1 (high mobility group box 1 [Source:HGNC Symbol;Acc:HGNC:4983])

HSP 1 Score: 111.694 bits (278), Expect = 1.020e-27
Identity = 67/164 (40.85%), Postives = 100/164 (60.98%), Query Frame = 3
Query:   33 MDSSTGKSNKLAMTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASE-----ENDXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWE--ACSDRDRYEKMATLDKERYEKEMEQFRA 503
            M     K  +  M++Y +FV+  R+EH+KKHP+   +F+EFS KC+E+WK+M  +E+ +FE++A       E + K     K   K++ K P  PKR  SAFF FC E RPK++ EHP   + +VA++LG +W   A  D+  YEK A   KE+YEK++  +RA
Sbjct:    1 MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRA 164          
BLAST of High mobility group protein B1 vs. Ensembl Celegans
Match: hmg-1.2 (High mobility group protein 1.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09390])

HSP 1 Score: 116.316 bits (290), Expect = 1.066e-29
Identity = 65/175 (37.14%), Postives = 103/175 (58.86%), Query Frame = 3
Query:   72 TAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEENDXXXXXXXXXXXXXXXXXXGQ-------PKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSD--RDRYEKMATLDKERYEKEMEQFRAGNFVAGETKRPKLDN-QDDSIH 566
            + Y +FVK+  +EH+KK+P E    TE S KC+EKWK+M  +E++RF ELA ++ ++          +   +   +       PKRA SAFF++  ++RP+++  HPDW+V +VA+ELG++W+      +D YE+ A  DK+RY  EM      N+ A   K   +D+  DD+IH
Sbjct:   50 SPYGFFVKMCYEEHKKKYPNENVQVTEISKKCSEKWKTMVDDEKRRFYELAQKDAERYQAEVAAYGGEDAMRKRKRAKKDPHAPKRALSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMR-----NYKAEMQKMSGMDHYDDDNIH 219          
BLAST of High mobility group protein B1 vs. Ensembl Celegans
Match: hmg-1.2 (High mobility group protein 1.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09390])

HSP 1 Score: 116.316 bits (290), Expect = 1.066e-29
Identity = 65/175 (37.14%), Postives = 103/175 (58.86%), Query Frame = 3
Query:   72 TAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEENDXXXXXXXXXXXXXXXXXXGQ-------PKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSD--RDRYEKMATLDKERYEKEMEQFRAGNFVAGETKRPKLDN-QDDSIH 566
            + Y +FVK+  +EH+KK+P E    TE S KC+EKWK+M  +E++RF ELA ++ ++          +   +   +       PKRA SAFF++  ++RP+++  HPDW+V +VA+ELG++W+      +D YE+ A  DK+RY  EM      N+ A   K   +D+  DD+IH
Sbjct:   50 SPYGFFVKMCYEEHKKKYPNENVQVTEISKKCSEKWKTMVDDEKRRFYELAQKDAERYQAEVAAYGGEDAMRKRKRAKKDPHAPKRALSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMR-----NYKAEMQKMSGMDHYDDDNIH 219          
BLAST of High mobility group protein B1 vs. Ensembl Celegans
Match: hmg-1.2 (High mobility group protein 1.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09390])

HSP 1 Score: 116.316 bits (290), Expect = 1.418e-29
Identity = 65/177 (36.72%), Postives = 102/177 (57.63%), Query Frame = 3
Query:   72 TAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEENDXXXXXXXXXXXXXXXXXXGQ---------PKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSD--RDRYEKMATLDKERYEKEMEQFRAGNFVAGETKRPKLDN-QDDSIH 566
            + Y +FVK+  +EH+KK+P E    TE S KC+EKWK+M  +E++RF ELA ++ ++            +     +         PKRA SAFF++  ++RP+++  HPDW+V +VA+ELG++W+      +D YE+ A  DK+RY  EM      N+ A   K   +D+  DD+IH
Sbjct:   49 SPYGFFVKMCYEEHKKKYPNENVQVTEISKKCSEKWKTMVDDEKRRFYELAQKDAERYQAEVSVAAYGGEDAMRKRKRAKKDPHAPKRALSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMR-----NYKAEMQKMSGMDHYDDDNIH 220          
BLAST of High mobility group protein B1 vs. Ensembl Celegans
Match: hmg-1.2 (High mobility group protein 1.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09390])

HSP 1 Score: 115.931 bits (289), Expect = 1.543e-29
Identity = 65/177 (36.72%), Postives = 102/177 (57.63%), Query Frame = 3
Query:   72 TAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEENDXXXXXXXXXXXXXXXXXXGQ---------PKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSD--RDRYEKMATLDKERYEKEMEQFRAGNFVAGETKRPKLDN-QDDSIH 566
            + Y +FVK+  +EH+KK+P E    TE S KC+EKWK+M  +E++RF ELA ++ ++            +     +         PKRA SAFF++  ++RP+++  HPDW+V +VA+ELG++W+      +D YE+ A  DK+RY  EM      N+ A   K   +D+  DD+IH
Sbjct:   50 SPYGFFVKMCYEEHKKKYPNENVQVTEISKKCSEKWKTMVDDEKRRFYELAQKDAERYQAEVSVAAYGGEDAMRKRKRAKKDPHAPKRALSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMR-----NYKAEMQKMSGMDHYDDDNIH 221          
BLAST of High mobility group protein B1 vs. Ensembl Celegans
Match: hmg-1.2 (High mobility group protein 1.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09390])

HSP 1 Score: 115.931 bits (289), Expect = 1.543e-29
Identity = 65/177 (36.72%), Postives = 102/177 (57.63%), Query Frame = 3
Query:   72 TAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEENDXXXXXXXXXXXXXXXXXXGQ---------PKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSD--RDRYEKMATLDKERYEKEMEQFRAGNFVAGETKRPKLDN-QDDSIH 566
            + Y +FVK+  +EH+KK+P E    TE S KC+EKWK+M  +E++RF ELA ++ ++            +     +         PKRA SAFF++  ++RP+++  HPDW+V +VA+ELG++W+      +D YE+ A  DK+RY  EM      N+ A   K   +D+  DD+IH
Sbjct:   50 SPYGFFVKMCYEEHKKKYPNENVQVTEISKKCSEKWKTMVDDEKRRFYELAQKDAERYQAEVSVAAYGGEDAMRKRKRAKKDPHAPKRALSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMR-----NYKAEMQKMSGMDHYDDDNIH 221          
BLAST of High mobility group protein B1 vs. Ensembl Fly
Match: Dsp1 (gene:FBgn0278608 transcript:FBtr0089259)

HSP 1 Score: 120.553 bits (301), Expect = 9.450e-30
Identity = 69/167 (41.32%), Postives = 102/167 (61.08%), Query Frame = 3
Query:   69 MTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEENDXXXXXXXXXXXXXXXXXXGQ------------PKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRD-----RYEKMATLDKERYEKEMEQFRAGNFVA 518
            MTAY YFV+  R+EH+KKHP+E   F EFS KCAE+WK+M  +E+KRF E+A E++ ++     +     +    G+            PKR+ SAFF+FC++ R KV+  +P++ V ++A+ELGR W   SD D     +YE MA  DK RYE+EM +++    +A
Sbjct:  175 MTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMA-EKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKW---SDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIA 337          
BLAST of High mobility group protein B1 vs. Ensembl Fly
Match: Dsp1 (gene:FBgn0278608 transcript:FBtr0089260)

HSP 1 Score: 120.553 bits (301), Expect = 9.450e-30
Identity = 69/167 (41.32%), Postives = 102/167 (61.08%), Query Frame = 3
Query:   69 MTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEENDXXXXXXXXXXXXXXXXXXGQ------------PKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRD-----RYEKMATLDKERYEKEMEQFRAGNFVA 518
            MTAY YFV+  R+EH+KKHP+E   F EFS KCAE+WK+M  +E+KRF E+A E++ ++     +     +    G+            PKR+ SAFF+FC++ R KV+  +P++ V ++A+ELGR W   SD D     +YE MA  DK RYE+EM +++    +A
Sbjct:  175 MTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMA-EKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKW---SDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIA 337          
BLAST of High mobility group protein B1 vs. Ensembl Fly
Match: Dsp1 (gene:FBgn0278608 transcript:FBtr0089261)

HSP 1 Score: 120.553 bits (301), Expect = 9.450e-30
Identity = 69/167 (41.32%), Postives = 102/167 (61.08%), Query Frame = 3
Query:   69 MTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEENDXXXXXXXXXXXXXXXXXXGQ------------PKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRD-----RYEKMATLDKERYEKEMEQFRAGNFVA 518
            MTAY YFV+  R+EH+KKHP+E   F EFS KCAE+WK+M  +E+KRF E+A E++ ++     +     +    G+            PKR+ SAFF+FC++ R KV+  +P++ V ++A+ELGR W   SD D     +YE MA  DK RYE+EM +++    +A
Sbjct:  175 MTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMA-EKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKW---SDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIA 337          
BLAST of High mobility group protein B1 vs. Ensembl Fly
Match: Dsp1 (gene:FBgn0278608 transcript:FBtr0089262)

HSP 1 Score: 120.553 bits (301), Expect = 9.599e-30
Identity = 69/167 (41.32%), Postives = 102/167 (61.08%), Query Frame = 3
Query:   69 MTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEENDXXXXXXXXXXXXXXXXXXGQ------------PKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRD-----RYEKMATLDKERYEKEMEQFRAGNFVA 518
            MTAY YFV+  R+EH+KKHP+E   F EFS KCAE+WK+M  +E+KRF E+A E++ ++     +     +    G+            PKR+ SAFF+FC++ R KV+  +P++ V ++A+ELGR W   SD D     +YE MA  DK RYE+EM +++    +A
Sbjct:  176 MTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMA-EKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKW---SDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIA 338          
BLAST of High mobility group protein B1 vs. Ensembl Fly
Match: Dsp1 (gene:FBgn0278608 transcript:FBtr0339766)

HSP 1 Score: 120.553 bits (301), Expect = 9.599e-30
Identity = 69/167 (41.32%), Postives = 102/167 (61.08%), Query Frame = 3
Query:   69 MTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEENDXXXXXXXXXXXXXXXXXXGQ------------PKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRD-----RYEKMATLDKERYEKEMEQFRAGNFVA 518
            MTAY YFV+  R+EH+KKHP+E   F EFS KCAE+WK+M  +E+KRF E+A E++ ++     +     +    G+            PKR+ SAFF+FC++ R KV+  +P++ V ++A+ELGR W   SD D     +YE MA  DK RYE+EM +++    +A
Sbjct:  176 MTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMA-EKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKW---SDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIA 338          
BLAST of High mobility group protein B1 vs. Ensembl Zebrafish
Match: hmgb2b (high mobility group box 2b [Source:ZFIN;Acc:ZDB-GENE-040912-122])

HSP 1 Score: 117.472 bits (293), Expect = 5.192e-30
Identity = 66/181 (36.46%), Postives = 104/181 (57.46%), Query Frame = 3
Query:   18 MKQSQMDSSTGKSNKLAMTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEENDXXXXXXXXXXXXXXXXXXGQ-------PKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDR--YEKMATLDKERYEKEMEQFRAGNFVAGETKR 533
            M +  ++   GK+     +AY +FV+  RDEH++K P+   +F+EFS KC+E+WKS+   ++ +FE++A  +  +     K     +     G+       PKR  SAFF FC E RP V+ EHP+  + E+A++LG LW   S +DR  +E+ A   +E+YEKE+  +RAG    G +KR
Sbjct:    1 MVKGDVNKPKGKT-----SAYAFFVQTCRDEHKRKSPDVPVNFSEFSKKCSERWKSLNASDKVKFEDMAKADKVRYDREMKTYVPPKGVGKTGRKKKDPNAPKRPPSAFFVFCSEYRPTVKSEHPNLTIGEIAKKLGELWSKQSSKDRAPFEQKAGKLREKYEKEVAAYRAG---GGASKR 173          
BLAST of High mobility group protein B1 vs. Ensembl Zebrafish
Match: hmgb2b (high mobility group box 2b [Source:ZFIN;Acc:ZDB-GENE-040912-122])

HSP 1 Score: 117.472 bits (293), Expect = 5.192e-30
Identity = 66/181 (36.46%), Postives = 104/181 (57.46%), Query Frame = 3
Query:   18 MKQSQMDSSTGKSNKLAMTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEENDXXXXXXXXXXXXXXXXXXGQ-------PKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDR--YEKMATLDKERYEKEMEQFRAGNFVAGETKR 533
            M +  ++   GK+     +AY +FV+  RDEH++K P+   +F+EFS KC+E+WKS+   ++ +FE++A  +  +     K     +     G+       PKR  SAFF FC E RP V+ EHP+  + E+A++LG LW   S +DR  +E+ A   +E+YEKE+  +RAG    G +KR
Sbjct:    1 MVKGDVNKPKGKT-----SAYAFFVQTCRDEHKRKSPDVPVNFSEFSKKCSERWKSLNASDKVKFEDMAKADKVRYDREMKTYVPPKGVGKTGRKKKDPNAPKRPPSAFFVFCSEYRPTVKSEHPNLTIGEIAKKLGELWSKQSSKDRAPFEQKAGKLREKYEKEVAAYRAG---GGASKR 173          
BLAST of High mobility group protein B1 vs. Ensembl Zebrafish
Match: hmgb3b (high mobility group box 3b [Source:ZFIN;Acc:ZDB-GENE-050417-290])

HSP 1 Score: 108.997 bits (271), Expect = 3.562e-27
Identity = 57/153 (37.25%), Postives = 97/153 (63.40%), Query Frame = 3
Query:   60 KLAMTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEE----NDXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDRYEKMATLD--KERYEKEMEQFR 500
            K  M+AY YFVK  R+EH KK+P    +F+EFS KC+E+WK+M P+E+ +FE+LA ++    + +       +  ++QKK P  P+R  S FF FC ++RP ++ ++P   + +VA++LG +W   SD ++   ++  D  K++Y+K+M  +R
Sbjct:   10 KGKMSAYAYFVKTCREEHNKKNPGVTVNFSEFSKKCSERWKTMSPKEKTKFEDLAKQDKARYDQEMMHYNPGKKGRKQKKDPNAPRRPPSGFFLFCAKQRPIIKAQNPSLGIGDVAKKLGGMWNNLSDSEKQPFLSNADKLKDKYQKDMAFYR 162          
BLAST of High mobility group protein B1 vs. Ensembl Zebrafish
Match: hmgb3b (high mobility group box 3b [Source:ZFIN;Acc:ZDB-GENE-050417-290])

HSP 1 Score: 108.997 bits (271), Expect = 3.562e-27
Identity = 57/153 (37.25%), Postives = 97/153 (63.40%), Query Frame = 3
Query:   60 KLAMTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEE----NDXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDRYEKMATLD--KERYEKEMEQFR 500
            K  M+AY YFVK  R+EH KK+P    +F+EFS KC+E+WK+M P+E+ +FE+LA ++    + +       +  ++QKK P  P+R  S FF FC ++RP ++ ++P   + +VA++LG +W   SD ++   ++  D  K++Y+K+M  +R
Sbjct:   10 KGKMSAYAYFVKTCREEHNKKNPGVTVNFSEFSKKCSERWKTMSPKEKTKFEDLAKQDKARYDQEMMHYNPGKKGRKQKKDPNAPRRPPSGFFLFCAKQRPIIKAQNPSLGIGDVAKKLGGMWNNLSDSEKQPFLSNADKLKDKYQKDMAFYR 162          
BLAST of High mobility group protein B1 vs. Ensembl Zebrafish
Match: hmgb1a (high mobility group box 1a [Source:ZFIN;Acc:ZDB-GENE-030131-341])

HSP 1 Score: 108.997 bits (271), Expect = 4.047e-27
Identity = 69/164 (42.07%), Postives = 101/164 (61.59%), Query Frame = 3
Query:   69 MTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELAS-----EENDXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDR--YEKMATLDKERYEKEMEQFRA-GNFVAGETKRP 536
            M++Y YFV+  R+EH+KKHPE   +F+EFS KC+E+WK+M  +E+ +FE++A       E + K     K  +K++ K P  PKR  SAFF FC E RPKV++E P   + +VA+ LG +W   S  ++  YEK A   KE+YEK++  +R+ G    G  K P
Sbjct:   12 MSSYAYFVQTCREEHKKKHPEATVNFSEFSKKCSERWKTMSAKEKGKFEDMAKLDKARYEREMKNYIPPKGEKKKRFKDPNAPKRPPSAFFIFCSEFRPKVKEETPGLSIGDVAKRLGEMWNKISSEEKQPYEKKAAKLKEKYEKDIAAYRSKGKVGGGAAKAP 175          
BLAST of High mobility group protein B1 vs. Ensembl Xenopus
Match: cep170b (centrosomal protein 170B [Source:Xenbase;Acc:XB-GENE-5943417])

HSP 1 Score: 116.701 bits (291), Expect = 1.057e-29
Identity = 66/164 (40.24%), Postives = 99/164 (60.37%), Query Frame = 3
Query:   33 MDSSTGKSNKLAMTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASE-----ENDXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWE--ACSDRDRYEKMATLDKERYEKEMEQFRA 503
            M     K  +  M++Y YFV+  R+EH+KKHP+   +F EFS KC+E+WK+M  +E+ +FE++A       E + K     K   K++ K P  PKR  SAFF FC E RPK++ EHP   + ++A++LG +W   A  D+  YE+ A   KE+YEK++  +RA
Sbjct:    1 MGKGDPKKPRGKMSSYAYFVQTCREEHKKKHPDASVNFAEFSKKCSERWKTMSAKEKSKFEDMAKADKVRYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEFRPKIKGEHPGSTIGDIAKKLGEMWNNTATDDKLPYERKAAKLKEKYEKDVAAYRA 164          
BLAST of High mobility group protein B1 vs. Ensembl Xenopus
Match: hmgb2 (high mobility group box 2 [Source:NCBI gene;Acc:394499])

HSP 1 Score: 111.309 bits (277), Expect = 1.070e-27
Identity = 62/155 (40.00%), Postives = 97/155 (62.58%), Query Frame = 3
Query:   69 MTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEEND--------XXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDR--YEKMATLDKERYEKEMEQFRA 503
            M++Y YFV+  R+EH+KKHP+   +F EFS KC+E+WK+M  +E+ +FEE+A  +ND        K     K   + ++KK P  PKR  SAFF FC E RP+++ E P   + + A++LG +W   + +D+  YE+ A   KE+YEK++  ++A
Sbjct:   13 MSSYAYFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEEMA--KNDKVRYEREMKTYIPPKGEKKGKKKKDPNAPKRPPSAFFLFCSEHRPQIKSESPGLSIGDTAKKLGEMWSEQTPKDKLPYEQKAAKLKEKYEKDVAAYKA 165          
BLAST of High mobility group protein B1 vs. Ensembl Xenopus
Match: hmgb3 (high mobility group box 3 [Source:NCBI gene;Acc:448228])

HSP 1 Score: 107.457 bits (267), Expect = 2.274e-26
Identity = 60/163 (36.81%), Postives = 97/163 (59.51%), Query Frame = 3
Query:   69 MTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEEN---DXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDR--YEKMATLDKERYEKEMEQFRAGNFVAGETKRPKL 542
            M+AY YFV+  R+EH+KK+PE   +F EFS KC+E+WK+M  +E+ +F++LA  +    D++        + ++KK P  PKR  S FF FC E RPK++  +P   + +VA++LG +W   +D ++  Y   A   KE+YEK++  +++          PKL
Sbjct:   13 MSAYAYFVQTCREEHKKKNPEIPVNFAEFSKKCSERWKTMSAKEKSKFDDLAKADKVRYDREMKDFGPVKKGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISIGDVAKKLGEMWNNLNDGEKQPYNNKAAKLKEKYEKDVADYKSKGKFDCAKGAPKL 175          
BLAST of High mobility group protein B1 vs. Ensembl Xenopus
Match: hmgb3 (high mobility group box 3 [Source:NCBI gene;Acc:448228])

HSP 1 Score: 104.375 bits (259), Expect = 1.623e-25
Identity = 57/143 (39.86%), Postives = 89/143 (62.24%), Query Frame = 3
Query:   69 MTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEEN---DXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDR--YEKMATLDKERYEK 482
            M+AY YFV+  R+EH+KK+PE   +F EFS KC+E+WK+M  +E+ +F++LA  +    D++        + ++KK P  PKR  S FF FC E RPK++  +P   + +VA++LG +W   +D ++  Y   A   KE+YEK
Sbjct:   13 MSAYAYFVQTCREEHKKKNPEIPVNFAEFSKKCSERWKTMSAKEKSKFDDLAKADKVRYDREMKDFGPVKKGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISIGDVAKKLGEMWNNLNDGEKQPYNNKAAKLKEKYEK 155          
BLAST of High mobility group protein B1 vs. Ensembl Mouse
Match: Hmgb2 (high mobility group box 2 [Source:MGI Symbol;Acc:MGI:96157])

HSP 1 Score: 117.472 bits (293), Expect = 5.106e-30
Identity = 66/160 (41.25%), Postives = 101/160 (63.12%), Query Frame = 3
Query:   69 MTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEEN-----DXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLW--EACSDRDRYEKMATLDKERYEKEMEQFRA-GNFVAGE 524
            M++Y +FV+  R+EH+KKHP+   +F EFS KC+E+WK+M  +E+ +FE+LA  +      + K     K  +K +KK P  PKR  SAFF FC E RPK++ EHP   + + A++LG +W  ++  D+  YE+ A   KE+YEK++  +RA G   AG+
Sbjct:   13 MSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDLAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSENRPKIKIEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGK 172          
BLAST of High mobility group protein B1 vs. Ensembl Mouse
Match: Hmgb1 (high mobility group box 1 [Source:MGI Symbol;Acc:MGI:96113])

HSP 1 Score: 113.62 bits (283), Expect = 1.063e-28
Identity = 68/167 (40.72%), Postives = 101/167 (60.48%), Query Frame = 3
Query:   24 QSQMDSSTGKSNKLAMTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASE-----ENDXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWE--ACSDRDRYEKMATLDKERYEKEMEQFRA 503
            Q  M     K  +  M++Y +FV+  R+EH+KKHP+   +F+EFS KC+E+WK+M  +E+ +FE++A       E + K     K   K++ K P  PKR  SAFF FC E RPK++ EHP   + +VA++LG +W   A  D+  YEK A   KE+YEK++  +RA
Sbjct:   12 QLNMGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRA 178          
BLAST of High mobility group protein B1 vs. Ensembl Mouse
Match: Hmgb1 (high mobility group box 1 [Source:MGI Symbol;Acc:MGI:96113])

HSP 1 Score: 111.694 bits (278), Expect = 7.006e-28
Identity = 67/164 (40.85%), Postives = 100/164 (60.98%), Query Frame = 3
Query:   33 MDSSTGKSNKLAMTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASE-----ENDXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWE--ACSDRDRYEKMATLDKERYEKEMEQFRA 503
            M     K  +  M++Y +FV+  R+EH+KKHP+   +F+EFS KC+E+WK+M  +E+ +FE++A       E + K     K   K++ K P  PKR  SAFF FC E RPK++ EHP   + +VA++LG +W   A  D+  YEK A   KE+YEK++  +RA
Sbjct:    1 MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRA 164          
BLAST of High mobility group protein B1 vs. Ensembl Mouse
Match: Hmgb1 (high mobility group box 1 [Source:MGI Symbol;Acc:MGI:96113])

HSP 1 Score: 111.694 bits (278), Expect = 7.006e-28
Identity = 67/164 (40.85%), Postives = 100/164 (60.98%), Query Frame = 3
Query:   33 MDSSTGKSNKLAMTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASE-----ENDXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWE--ACSDRDRYEKMATLDKERYEKEMEQFRA 503
            M     K  +  M++Y +FV+  R+EH+KKHP+   +F+EFS KC+E+WK+M  +E+ +FE++A       E + K     K   K++ K P  PKR  SAFF FC E RPK++ EHP   + +VA++LG +W   A  D+  YEK A   KE+YEK++  +RA
Sbjct:    1 MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRA 164          
BLAST of High mobility group protein B1 vs. Ensembl Mouse
Match: Hmgb1 (high mobility group box 1 [Source:MGI Symbol;Acc:MGI:96113])

HSP 1 Score: 111.694 bits (278), Expect = 7.006e-28
Identity = 67/164 (40.85%), Postives = 100/164 (60.98%), Query Frame = 3
Query:   33 MDSSTGKSNKLAMTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASE-----ENDXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWE--ACSDRDRYEKMATLDKERYEKEMEQFRA 503
            M     K  +  M++Y +FV+  R+EH+KKHP+   +F+EFS KC+E+WK+M  +E+ +FE++A       E + K     K   K++ K P  PKR  SAFF FC E RPK++ EHP   + +VA++LG +W   A  D+  YEK A   KE+YEK++  +RA
Sbjct:    1 MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRA 164          
BLAST of High mobility group protein B1 vs. UniProt/SwissProt
Match: sp|P52925|HMGB2_RAT (High mobility group protein B2 OS=Rattus norvegicus OX=10116 GN=Hmgb2 PE=2 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 2.692e-29
Identity = 63/152 (41.45%), Postives = 97/152 (63.82%), Query Frame = 3
Query:   69 MTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEEN-----DXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLW--EACSDRDRYEKMATLDKERYEKEMEQFRA 503
            M++Y +FV+  R+EH+KKHP+   +F EFS KC+E+WK+M  +E+ +FE+LA  +      + K     K  +K +KK P  PKR  SAFF FC E RPK++ EHP   + + A++LG +W  ++  D+  YE+ A   KE+YEK++  +RA
Sbjct:   13 MSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDLAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRA 164          
BLAST of High mobility group protein B1 vs. UniProt/SwissProt
Match: sp|P30681|HMGB2_MOUSE (High mobility group protein B2 OS=Mus musculus OX=10090 GN=Hmgb2 PE=1 SV=3)

HSP 1 Score: 117.472 bits (293), Expect = 3.572e-29
Identity = 66/160 (41.25%), Postives = 101/160 (63.12%), Query Frame = 3
Query:   69 MTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEEN-----DXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLW--EACSDRDRYEKMATLDKERYEKEMEQFRA-GNFVAGE 524
            M++Y +FV+  R+EH+KKHP+   +F EFS KC+E+WK+M  +E+ +FE+LA  +      + K     K  +K +KK P  PKR  SAFF FC E RPK++ EHP   + + A++LG +W  ++  D+  YE+ A   KE+YEK++  +RA G   AG+
Sbjct:   13 MSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDLAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSENRPKIKIEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGK 172          
BLAST of High mobility group protein B1 vs. UniProt/SwissProt
Match: sp|P26583|HMGB2_HUMAN (High mobility group protein B2 OS=Homo sapiens OX=9606 GN=HMGB2 PE=1 SV=2)

HSP 1 Score: 117.087 bits (292), Expect = 4.524e-29
Identity = 65/160 (40.62%), Postives = 101/160 (63.12%), Query Frame = 3
Query:   69 MTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEEN-----DXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLW--EACSDRDRYEKMATLDKERYEKEMEQFRA-GNFVAGE 524
            M++Y +FV+  R+EH+KKHP+   +F EFS KC+E+WK+M  +E+ +FE++A  +      + K     K  +K +KK P  PKR  SAFF FC E RPK++ EHP   + + A++LG +W  ++  D+  YE+ A   KE+YEK++  +RA G   AG+
Sbjct:   13 MSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGK 172          
BLAST of High mobility group protein B1 vs. UniProt/SwissProt
Match: sp|P40673|HMGB2_BOVIN (High mobility group protein B2 OS=Bos taurus OX=9913 GN=HMGB2 PE=1 SV=3)

HSP 1 Score: 117.087 bits (292), Expect = 4.524e-29
Identity = 65/160 (40.62%), Postives = 101/160 (63.12%), Query Frame = 3
Query:   69 MTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEEN-----DXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLW--EACSDRDRYEKMATLDKERYEKEMEQFRA-GNFVAGE 524
            M++Y +FV+  R+EH+KKHP+   +F EFS KC+E+WK+M  +E+ +FE++A  +      + K     K  +K +KK P  PKR  SAFF FC E RPK++ EHP   + + A++LG +W  ++  D+  YE+ A   KE+YEK++  +RA G   AG+
Sbjct:   13 MSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGK 172          
BLAST of High mobility group protein B1 vs. UniProt/SwissProt
Match: sp|P26584|HMGB2_CHICK (High mobility group protein B2 OS=Gallus gallus OX=9031 GN=HMGB2 PE=2 SV=2)

HSP 1 Score: 115.931 bits (289), Expect = 1.189e-28
Identity = 63/152 (41.45%), Postives = 96/152 (63.16%), Query Frame = 3
Query:   69 MTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEEN-----DXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLW--EACSDRDRYEKMATLDKERYEKEMEQFRA 503
            M++Y YFV+  R+EH+KKHP+   +F EFS KC+E+WK+M  +E+ +FEE+A  +      + K     K  +K +KK P  PKR  SAFF FC E RPK++ +HP   + + A++LG +W  +   D+  YE+ A   KE+YEK++  +RA
Sbjct:   13 MSSYAYFVQTCREEHKKKHPDSSVNFAEFSRKCSERWKTMSSKEKGKFEEMAKGDKARYDREMKNYVPPKGEKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKNDHPGLSIGDTAKKLGEMWSEQLAKDKQPYEQKAAKLKEKYEKDIAAYRA 164          
BLAST of High mobility group protein B1 vs. TrEMBL
Match: A0A267H111 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018661g1 PE=4 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 8.060e-49
Identity = 96/175 (54.86%), Postives = 125/175 (71.43%), Query Frame = 3
Query:   60 KLAMTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELAS--------EENDXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDRYEKMATLDKERYEKEMEQFRAGNFVAGETKRPKLDNQDDS 560
            K AMTAY  FV++IR+EHRKKHP+E   F+EFS KCAEKWK+M P+E+KRFE++A+        E  D  P    K  ++++ K P  PKR  SAFF+FC+E RPKVR  +PDWRV+EVA+ELGR WEAC +R RYE+ A  DK RYE++M+Q++AG FVA  +KR K D   D+
Sbjct:    9 KGAMTAYACFVQVIREEHRKKHPDETVVFSEFSKKCAEKWKTMNPKEKKRFEDMAARDKERHNREMEDYVPADGSKGRKRKRVKDPNMPKRPLSAFFFFCEEERPKVRASNPDWRVSEVAKELGRRWEACKNRPRYEQQAARDKLRYEEDMKQYKAGTFVA--SKRAKADATGDN 181          
BLAST of High mobility group protein B1 vs. TrEMBL
Match: A0A267H2Y9 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015935g1 PE=4 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 9.003e-49
Identity = 96/175 (54.86%), Postives = 125/175 (71.43%), Query Frame = 3
Query:   60 KLAMTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELAS--------EENDXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDRYEKMATLDKERYEKEMEQFRAGNFVAGETKRPKLDNQDDS 560
            K AMTAY  FV++IR+EHRKKHP+E   F+EFS KCAEKWK+M P+E+KRFE++A+        E  D  P    K  ++++ K P  PKR  SAFF+FC+E RPKVR  +PDWRV+EVA+ELGR WEAC +R RYE+ A  DK RYE++M+Q++AG FVA  +KR K D   D+
Sbjct:   15 KGAMTAYACFVQVIREEHRKKHPDETVVFSEFSKKCAEKWKTMNPKEKKRFEDMAARDKERHNREMEDYVPADGSKGRKRKRVKDPNMPKRPLSAFFFFCEEERPKVRASNPDWRVSEVAKELGRRWEACKNRPRYEQQAARDKLRYEEDMKQYKAGTFVA--SKRAKADATGDN 187          
BLAST of High mobility group protein B1 vs. TrEMBL
Match: A0A267EBY1 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025073g1 PE=4 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.147e-48
Identity = 96/175 (54.86%), Postives = 125/175 (71.43%), Query Frame = 3
Query:   60 KLAMTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELAS--------EENDXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDRYEKMATLDKERYEKEMEQFRAGNFVAGETKRPKLDNQDDS 560
            K AMTAY  FV++IR+EHRKKHP+E   F+EFS KCAEKWK+M P+E+KRFE++A+        E  D  P    K  ++++ K P  PKR  SAFF+FC+E RPKVR  +PDWRV+EVA+ELGR WEAC +R RYE+ A  DK RYE++M+Q++AG FVA  +KR K D   D+
Sbjct:   16 KGAMTAYACFVQVIREEHRKKHPDETVVFSEFSKKCAEKWKTMNPKEKKRFEDMAARDKERHNREMEDYVPADGSKGRKRKRVKDPNMPKRPLSAFFFFCEEERPKVRASNPDWRVSEVAKELGRRWEACKNRPRYEQQAARDKLRYEEDMKQYKAGTFVA--SKRAKADATGDN 188          
BLAST of High mobility group protein B1 vs. TrEMBL
Match: A0A1I8IAE5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 1.180e-48
Identity = 96/175 (54.86%), Postives = 125/175 (71.43%), Query Frame = 3
Query:   60 KLAMTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELAS--------EENDXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDRYEKMATLDKERYEKEMEQFRAGNFVAGETKRPKLDNQDDS 560
            K AMTAY  FV++IR+EHRKKHP+E   F+EFS KCAEKWK+M P+E+KRFE++A+        E  D  P    K  ++++ K P  PKR  SAFF+FC+E RPKVR  +PDWRV+EVA+ELGR WEAC +R RYE+ A  DK RYE++M+Q++AG FVA  +KR K D   D+
Sbjct:  892 KGAMTAYACFVQVIREEHRKKHPDETVVFSEFSKKCAEKWKTMNPKEKKRFEDMAARDKERHNREMEDYVPADGSKGRKRKRVKDPNMPKRPLSAFFFFCEEERPKVRASNPDWRVSEVAKELGRRWEACKNRPRYEQQAARDKLRYEEDMKQYKAGTFVA--SKRAKADATGDN 1064          
BLAST of High mobility group protein B1 vs. TrEMBL
Match: A0A1I8IJA4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030660g2 PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.388e-47
Identity = 94/168 (55.95%), Postives = 119/168 (70.83%), Query Frame = 3
Query:   60 KLAMTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELAS--------EENDXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDRYEKMATLDKERYEKEMEQFRAGNFVAGETKRPK 539
            K  M+AY  FV++IR+EH+KKHPEE   F EFS KCAEKWK+M P+E+KRFE++AS        E +D  P    K  ++++ K P  PKRA +AFF F DE R K+R EHPDWRV+EVA+ELGR+WEAC+DR +YE  A  DK+RYE EM Q+R G FV   TKRP+
Sbjct:    9 KGPMSAYACFVQVIREEHKKKHPEESVVFAEFSKKCAEKWKTMNPKEKKRFEDMASRDKERYNREMDDYVPADGSKGKKRKKPKDPNMPKRALTAFFLFSDEHRQKIRDEHPDWRVSEVAKELGRMWEACTDRPKYEAAAVRDKQRYEDEMNQYRQGTFVP--TKRPR 174          
BLAST of High mobility group protein B1 vs. Ensembl Cavefish
Match: ENSAMXT00000044228.1 (high mobility group protein B2-like [Source:NCBI gene;Acc:103034313])

HSP 1 Score: 117.857 bits (294), Expect = 2.512e-30
Identity = 67/158 (42.41%), Postives = 95/158 (60.13%), Query Frame = 3
Query:   72 TAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELAS-------EENDXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDR--YEKMATLDKERYEKEMEQFRAGNFVA 518
            +AY +FV   RDE +KK P    +F +FS KC+E WK++ P E+K+FE+LA        EE     P +      R+KK P  PKR  SAFF FC E RP V+ EHP+  + E+A++LG  W   S +DR  +++ A L +E+YEKE+  +R+G  VA
Sbjct:   13 SAYAFFVLSSRDELKKKSPGTSVNFGKFSKKCSEDWKALTPSEKKKFEDLAKADKARYDEEMKSYVPPKGMGKMGRKKKDPNAPKRPPSAFFIFCSEHRPAVKSEHPNLTIGEIAKKLGEKWSKLSTKDRSPFDQKAVLLREKYEKEVAAYRSGGSVA 170          
BLAST of High mobility group protein B1 vs. Ensembl Cavefish
Match: hmgb2a (high mobility group box 2 [Source:NCBI gene;Acc:111195933])

HSP 1 Score: 117.087 bits (292), Expect = 4.989e-30
Identity = 66/155 (42.58%), Postives = 98/155 (63.23%), Query Frame = 3
Query:   69 MTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEEND--------XXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDR--YEKMATLDKERYEKEMEQFRA 503
             ++Y +FV+  R+EH+KKHP    +F EFS KCAE+WK+M P+E+ +FE+LA  +ND        K     K   + ++KK P  PKR  SAFF FC + RPKV+ EHP   + ++A++LG +W   S +D+  YE+ A   KE+YEK++  +RA
Sbjct:   12 TSSYAFFVQTCREEHKKKHPGTSVNFAEFSKKCAERWKTMSPKEKTKFEDLA--KNDKVRYDREMKTYIPPKGAKKGKKKKDPNAPKRPPSAFFVFCSDHRPKVKSEHPGISIGDIAKKLGEMWSKQSPKDKAPYEQKAMKLKEKYEKDVAAYRA 164          
BLAST of High mobility group protein B1 vs. Ensembl Cavefish
Match: hmgb1a (high mobility group-T protein-like [Source:NCBI gene;Acc:103039534])

HSP 1 Score: 114.775 bits (286), Expect = 2.657e-29
Identity = 69/163 (42.33%), Postives = 102/163 (62.58%), Query Frame = 3
Query:   69 MTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEEL-----ASEENDXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACS--DRDRYEKMATLDKERYEKEMEQFRAGNFVAGETKRP 536
            M++Y YFV+  R+EH+KKHP+   +F+EFS KC+E+WK+M  +E+ +FEE+     A  E + K     +  +K++ K P  PKR  SAFF FC E RPKV++E P   + +VA++LG +W   S  ++  YEK A   KE+YEK++  +R G  V G  K P
Sbjct:   12 MSSYAYFVQTCREEHKKKHPDTSVNFSEFSKKCSERWKTMSAKEKGKFEEMARLDKARYEREMKNYVPPRGEKKKRFKDPNAPKRPPSAFFIFCAEYRPKVKEETPGLSIGDVAKKLGEMWNKTSAEEKQPYEKKAAKLKEKYEKDIAAYRKGKVVGGAAKAP 174          
BLAST of High mobility group protein B1 vs. Ensembl Cavefish
Match: hmgb1b (high mobility group protein B1-like [Source:NCBI gene;Acc:103041093])

HSP 1 Score: 111.694 bits (278), Expect = 2.983e-28
Identity = 66/162 (40.74%), Postives = 105/162 (64.81%), Query Frame = 3
Query:   69 MTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASE-----ENDXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSD--RDRYEKMATLDKERYEKEMEQFRAGNFVAGETKR 533
            M++Y YFV+  R+EH+KKHPE   +F+EFS KC+E+WK+M P+E+ +FE++A +     E + K     K  +K++ K P  PKR  SAFF FC + RPK++ E+P   + ++A++LG +W + S   +  YEK A   KE+Y+K++  +R    VAG +K+
Sbjct:   12 MSSYAYFVQTCREEHKKKHPEASVNFSEFSKKCSERWKTMSPKEKSKFEDMAKQDKVRYEREMKNYIPPKGEKKKRFKDPNAPKRPPSAFFIFCGDYRPKIKGENPGLSIGDIAKKLGEMWNSSSPEVKQPYEKKAAKLKEKYDKDIAVYRTKG-VAGLSKK 172          
BLAST of High mobility group protein B1 vs. Ensembl Cavefish
Match: hmgb3a (high mobility group protein B3 [Source:NCBI gene;Acc:103036962])

HSP 1 Score: 99.3673 bits (246), Expect = 1.161e-23
Identity = 53/165 (32.12%), Postives = 96/165 (58.18%), Query Frame = 3
Query:   69 MTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEENDXX-XXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSD--RDRYEKMATLDKERYEKEMEQFRA----GNFVAGETKRPKL 542
            M+AY YFV+  R+EH+ K PE   +F EFS KC+ +WK+M  +E+ RFE++A ++  +          ++ +KK P  PKR  S FF FC + RPK++ ++P   + EVA++LG +W   +D  +  Y   +   K++Y++++  +++     + + G   +P +
Sbjct:   13 MSAYAYFVQTCREEHKLKSPEIPVNFAEFSKKCSVRWKAMSGKEKTRFEDMAKQDKVRYDQEMMHYTGKRGKKKDPNAPKRPPSGFFIFCSDHRPKIKAQYPHMGIGEVAKKLGEMWNNLTDAHKQPYVMKSNKLKDKYQQDIADYKSKGKVSSIMMGMAPKPMM 177          
BLAST of High mobility group protein B1 vs. Ensembl Sea Lamprey
Match: hmgb2a (high mobility group box 2a [Source:ZFIN;Acc:ZDB-GENE-051120-126])

HSP 1 Score: 115.546 bits (288), Expect = 2.310e-30
Identity = 66/150 (44.00%), Postives = 94/150 (62.67%), Query Frame = 3
Query:   69 MTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEEN---DXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACS--DRDRYEKMATLDKERYEKEMEQFRA 503
            M++Y YFV+  R+EH+KKHPE   +F EFS KC+E+WK+M P+E+ RFEE+A  +    D++         KR+ K P  PKR  SAFF FC E RPKV+ +HP   + E+A+ LG +W   +   +  YEK A   KE+YEK++  +R 
Sbjct:   13 MSSYAYFVQTCREEHKKKHPEASVNFAEFSKKCSERWKTMSPKEKARFEEMAKADKARFDREMKNYVPPKGKRKTKDPNAPKRPPSAFFVFCSEHRPKVKADHPGLGIGEIAKRLGEMWGLLTPETKSPYEKKAAKLKEKYEKDVAAYRG 162          
BLAST of High mobility group protein B1 vs. Ensembl Sea Lamprey
Match: hmgb2b (high mobility group box 2b [Source:ZFIN;Acc:ZDB-GENE-040912-122])

HSP 1 Score: 103.605 bits (257), Expect = 7.005e-26
Identity = 61/159 (38.36%), Postives = 93/159 (58.49%), Query Frame = 3
Query:   69 MTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEENDXXXXXXXXXXXXXXXXXXGQ--------PKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWE--ACSDRDRYEKMATLDKERYEKEMEQFRAGNFV 515
            M++Y YFV+  R+EH+KK+PE   +F EFS KC+E+WK+M  +E+ RFE++A  + DK    R+ +T    K   G         PKR  SAFF +C E R KVR E+P   +  +A++LG +W      ++  YE+     KE+Y+K+M  +R+   V
Sbjct:   13 MSSYAYFVQTCREEHKKKNPEASVNFAEFSKKCSERWKTMSEKEKTRFEDMA--KVDKVRYDREMKTYVPPKGERGSRKKKDPNAPKRPPSAFFIYCAEYRSKVRAENPGLTIGSIAKKLGEMWNNAPADEKSIYERKTAKLKEKYDKDMASYRSKGKV 169          
BLAST of High mobility group protein B1 vs. Ensembl Yeast
Match: NHP6A (High-mobility group (HMG) protein; binds to and remodels nucleosomes; involved in recruiting FACT and other chromatin remodelling complexes to chromosomes; functionally redundant with Nhp6Bp; required for transcriptional initiation fidelity of some tRNA genes; homologous to mammalian HMGB1 and HMGB2; NHP6A has a paralog, NHP6B, that arose from the whole genome duplication; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000006256])

HSP 1 Score: 58.5362 bits (140), Expect = 1.713e-11
Identity = 30/70 (42.86%), Postives = 43/70 (61.43%), Query Frame = 3
Query:  300 PKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDR--YEKMATLDKERYEKEMEQFRA 503
            PKRA SA+ +F +E R  VR E+PD    +V ++LG  W+A +  ++  YE  A  DK+RYE E E + A
Sbjct:   21 PKRALSAYMFFANENRDIVRSENPDITFGQVGKKLGEKWKALTPEEKQPYEAKAQADKKRYESEKELYNA 90          
BLAST of High mobility group protein B1 vs. Ensembl Yeast
Match: NHP6B (High-mobility group (HMG) protein; binds to and remodels nucleosomes; involved in recruiting FACT and other chromatin remodelling complexes to the chromosomes; functionally redundant with Nhp6Ap; required for transcriptional initiation fidelity of some tRNA genes; homologous to mammalian HMGB1 and HMGB2; NHP6B has a paralog, NHP6A, that arose from the whole genome duplication [Source:SGD;Acc:S000002157])

HSP 1 Score: 57.3806 bits (137), Expect = 6.488e-11
Identity = 30/70 (42.86%), Postives = 41/70 (58.57%), Query Frame = 3
Query:  300 PKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACS--DRDRYEKMATLDKERYEKEMEQFRA 503
            PKR  SA+ +F +E R  VR E+PD    +V R LG  W+A +  ++  YE  A  DK+RYE E E + A
Sbjct:   27 PKRGLSAYMFFANENRDIVRSENPDVTFGQVGRILGERWKALTAEEKQPYESKAQADKKRYESEKELYNA 96          
BLAST of High mobility group protein B1 vs. Ensembl Nematostella
Match: EDO36028 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJW6])

HSP 1 Score: 76.2554 bits (186), Expect = 2.736e-16
Identity = 51/170 (30.00%), Postives = 93/170 (54.71%), Query Frame = 3
Query:   60 KLAMTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEENDXXXXXXXXXXXXXXXXXX-----------GQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDR--YEKMATLDKERYEKEMEQFRAGNFVAGETK 530
            K A +AY +F++  R++ +++  E +F   +FS   AEKWK+M  EE++ F + A ++ ++     +  T    +++             +PKR  SA+F+F + +R  V+K++P+     +++ LG +W   +D D+  Y+ MA  DK RYE EM+ F+ G   A + K
Sbjct:    4 KGAKSAYNFFLQDQREKLQRE--EGKFSLADFSKVSAEKWKNMSEEEKETFVQKAGKDKERFKEEMQSYTPPPSEESGKKKRKKQTKDPNKPKRCLSAYFHFINLKRDDVKKDNPNASGGALSKVLGEMWSKMTDDDKTQYQDMAKKDKVRYESEMKAFKDGKLPAKQNK 171          
BLAST of High mobility group protein B1 vs. Ensembl Nematostella
Match: EDO39305 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAG5])

HSP 1 Score: 51.2174 bits (121), Expect = 1.148e-8
Identity = 19/66 (28.79%), Postives = 45/66 (68.18%), Query Frame = 3
Query:  300 PKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDRYEKMATLDKERYEKEMEQF 497
            PKRA SA+  + ++ R +++ ++P   V EV++  G +W+  +D+ ++E+ A ++K++Y + M+++
Sbjct:    1 PKRAMSAYMLWLNDTRQEIKDKNPGISVTEVSKVAGEMWKNLTDKSKWEEKAAIEKQKYVQRMKEY 66          
BLAST of High mobility group protein B1 vs. Ensembl Nematostella
Match: EDO47230 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMY4])

HSP 1 Score: 50.8322 bits (120), Expect = 3.771e-7
Identity = 28/69 (40.58%), Postives = 38/69 (55.07%), Query Frame = 3
Query:  300 PKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACS--DRDRYEKMATLDKERYEKEMEQFR 500
            PK   + +  F +E+R KVR EHP+    EV + LG  W   S  D+ RY   A  DKERY  E+E ++
Sbjct:   21 PKAPLTGYVQFLNEQREKVRSEHPELPFPEVTKILGAEWSKMSQDDKQRYLDDAERDKERYIIELENYQ 89          
BLAST of High mobility group protein B1 vs. Ensembl Nematostella
Match: EDO41032 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5L8])

HSP 1 Score: 49.2914 bits (116), Expect = 1.329e-6
Identity = 26/69 (37.68%), Postives = 38/69 (55.07%), Query Frame = 3
Query:  300 PKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWE--ACSDRDRYEKMATLDKERYEKEMEQFR 500
            PK   + +  F +E R KVR E+PD    EV R LG +W       +  + + A  DKERY KE+E+++
Sbjct:   15 PKAPLTGYVRFLNEHREKVRSENPDLPFHEVTRILGNMWSQLPTPQKQLFLEEAEKDKERYMKELEEYQ 83          
BLAST of High mobility group protein B1 vs. Ensembl Medaka
Match: hmgb2a (high mobility group protein B2 [Source:NCBI gene;Acc:101157589])

HSP 1 Score: 110.923 bits (276), Expect = 1.002e-27
Identity = 66/168 (39.29%), Postives = 99/168 (58.93%), Query Frame = 3
Query:   69 MTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEEND------XXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDR--YEKMATLDKERYEKEMEQFRA----GNFVAGETKRP 536
             +AY YFV   R+EH+KKHP    +F EFS KC+E+WK+M  +E+ +F+ELA  +        K     K   + ++KK P  PKR  SAFF FC + RPK+++++P   + ++A++LG LW   S +D+  YE  A   KE+YEK++  +RA    G   AG+   P
Sbjct:   12 TSAYAYFVATCREEHKKKHPGTSVNFAEFSKKCSERWKTMSSKEKVKFDELAKTDKARYDREMKTYVPPKGAKKVKKKKDPNAPKRPPSAFFVFCSDHRPKIKEDNPGISIGDIAKKLGELWATQSAKDKAPYEAKAAKLKEKYEKDVAAYRAKGGSGKSDAGKKSGP 179          
BLAST of High mobility group protein B1 vs. Ensembl Medaka
Match: hmgb1a (high mobility group-T protein [Source:NCBI gene;Acc:101165167])

HSP 1 Score: 108.612 bits (270), Expect = 4.764e-27
Identity = 63/158 (39.87%), Postives = 95/158 (60.13%), Query Frame = 3
Query:   69 MTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEEN-----DXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACS--DRDRYEKMATLDKERYEKEMEQFRAGNFVAG 521
            M++Y YFV+  R+EH+KKHP+   +F EFS KC+E+WK+M  +E+ +FE++A ++      +       K  + ++ K P  PKR  SAFF FC E RPKV+ E P   + +VA+ LG +W + S  D+  YEK A   KE+Y K++  +RA     G
Sbjct:   12 MSSYAYFVQTCREEHKKKHPDASVNFAEFSKKCSERWKTMSAKEKGKFEDMARQDKVRYDREMMSYVPAKGAKTKKFKDPNAPKRPPSAFFIFCSEFRPKVKGESPGLTIGDVAKRLGEMWNSTSAEDKQPYEKKAAKLKEKYGKDIAAYRAKGKTGG 169          
BLAST of High mobility group protein B1 vs. Ensembl Medaka
Match: hmgb1b (high mobility group protein B1 [Source:NCBI gene;Acc:101156596])

HSP 1 Score: 105.531 bits (262), Expect = 5.630e-26
Identity = 62/156 (39.74%), Postives = 99/156 (63.46%), Query Frame = 3
Query:   69 MTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASE-----ENDXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACS--DRDRYEKMATLDKERYEKEMEQFRAGNFV 515
            M++Y YFV+  R+EH+KKHP+   +F+EFS KC+E+WK+M P+E+ +FE++A +     E + K     K  +K++ K P  PKR  SAFF FC + RPK++ E P   + + A++LG +W + S  ++  YEK A   KE+Y+K++  +R    V
Sbjct:   12 MSSYAYFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSPKEKGKFEDMAKQDKVRYEREMKNYVPPKGQKKKRFKDPNAPKRPPSAFFLFCADFRPKIKSESPGLSIGDTAKKLGEMWNSSSAEEKQPYEKKAAKLKEKYDKDIVAYRTKGKV 167          
BLAST of High mobility group protein B1 vs. Planmine SMEST
Match: SMESG000034017.1 (SMESG000034017.1)

HSP 1 Score: 349.362 bits (895), Expect = 1.922e-119
Identity = 216/216 (100.00%), Postives = 216/216 (100.00%), Query Frame = 3
Query:   33 MDSSTGKSNKLAMTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEENDXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDRYEKMATLDKERYEKEMEQFRAGNFVAGETKRPKLDNQDDSIHXXXXXXXXXXXXXXXXXITEKTGESSTVNANKSEHCVS 680
            MDSSTGKSNKLAMTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEENDKKPPGRKKRTRKRQKKAPGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDRYEKMATLDKERYEKEMEQFRAGNFVAGETKRPKLDNQDDSIHDDEDEEEEEVDNEVPNEITEKTGESSTVNANKSEHCVS
Sbjct:    1 MDSSTGKSNKLAMTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEENDKKPPGRKKRTRKRQKKAPGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDRYEKMATLDKERYEKEMEQFRAGNFVAGETKRPKLDNQDDSIHDDEDEEEEEVDNEVPNEITEKTGESSTVNANKSEHCVS 216          
BLAST of High mobility group protein B1 vs. Planmine SMEST
Match: SMESG000052032.1 (SMESG000052032.1)

HSP 1 Score: 196.438 bits (498), Expect = 7.464e-59
Identity = 98/178 (55.06%), Postives = 133/178 (74.72%), Query Frame = 3
Query:   60 KLAMTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEEND----------XXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDRYEKMATLDKERYEKEMEQFRAGNFVAGETKRPKLDNQDDSI 563
            K AM+AY YFV++IR+EH++KHP EQ  F+EFS KCAEKWK M P+E+KRFEE+A+ + D              G ++R ++R+ K PGQPKRAWSAFF+FCDE RPKVR+ HPDWRV  +A+ELGRLWE+C+D+++YEK +  DK+RYE++M QFRAG +V    KRP+ D+   ++
Sbjct:   12 KGAMSAYAYFVQVIREEHKRKHPGEQVVFSEFSKKCAEKWKLMTPKEKKRFEEMAASDKDRFNREMNNYQPTGEGGRRRRKRRRIKEPGQPKRAWSAFFFFCDEYRPKVREAHPDWRVGNIAKELGRLWESCTDKEKYEKKSEADKQRYEEQMSQFRAGQYVP-PVKRPRADSNGSAL 188          
BLAST of High mobility group protein B1 vs. Planmine SMEST
Match: SMESG000068286.1 (SMESG000068286.1)

HSP 1 Score: 148.673 bits (374), Expect = 5.136e-42
Identity = 74/166 (44.58%), Postives = 118/166 (71.08%), Query Frame = 3
Query:   51 KSNKLAMTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELASEENDX------XXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDRYEKMATLDKERYEKEMEQFRAGNFVAGETK 530
            K  K A T Y  FV+++R+EH+KKHP+EQ  F+EFS +C+EKWK M P+E++RF ++A+++ ++                KR+ K P +PK AW+AFF+F DE R K+++E+P+++V +VA+ LG++WEAC D+ +YE+ A  DKERY KE+E++++G  V+ +TK
Sbjct:    4 KKPKGAKTPYACFVQVVREEHKKKHPDEQIVFSEFSKRCSEKWKEMSPKEKQRFMDIAAKDKERYLKEMDNYQPPAGTKNKRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEACKDKSKYEEQAKRDKERYNKELEEYKSGTPVSKKTK 169          
BLAST of High mobility group protein B1 vs. Planmine SMEST
Match: SMESG000023365.1 (SMESG000023365.1)

HSP 1 Score: 134.42 bits (337), Expect = 9.134e-37
Identity = 74/160 (46.25%), Postives = 117/160 (73.12%), Query Frame = 3
Query:   60 KLAMTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKCAEKWKSMKPEERKRFEELAS--------EENDXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDRYEKMATLDKERYEKEMEQFRAGNFV 515
            K AM+AY  FV++IR++++ KHP+E   F+EFS KCAEKW+ + P+E+K+FE++A+        E N+  PPG  K  +++Q + P QPKR  SAFF +  E R +++ EHPDWRV ++A+ELG+ WE C+D+ +YE++A  +KER+E+EM+++++G FV
Sbjct:   11 KGAMSAYACFVQVIREKYKNKHPDEAVVFSEFSKKCAEKWRQLGPKEKKQFEDMAAVDKARYIKEMNEYVPPGGVKPNKRKQPRDPAQPKRGLSAFFLYSQEFRGQIKDEHPDWRVGDIAKELGKRWETCADKGKYEELARREKERFEREMDEYKSGTFV 170          
BLAST of High mobility group protein B1 vs. Planmine SMEST
Match: SMESG000043905.1 (SMESG000043905.1)

HSP 1 Score: 97.0561 bits (240), Expect = 4.048e-24
Identity = 49/107 (45.79%), Postives = 74/107 (69.16%), Query Frame = 3
Query:  186 MKPEERKRFEELA--------SEENDXXXXXXXXXXXXXXXXXXGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDRYEKMATLDKERYEK 482
            M  EE++RF+E+A         E N+       K+ ++++ K P +PKRAWSAFF++C+E RP ++  HPDWR+ +VA+ELG+ WE C ++D+YEKM+ +DKERY K
Sbjct:    1 MTLEEKRRFDEMAELDKSRHVKEINELLTVESNKKVKRKRIKNPNEPKRAWSAFFFYCNEFRPVIKDAHPDWRIGDVAKELGKRWEICLEKDKYEKMSKIDKERYVK 107          
The following BLAST results are available for this feature:
BLAST of High mobility group protein B1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HMGB29.421e-3040.63high mobility group box 2 [Source:HGNC Symbol;Acc:... [more]
HMGB29.421e-3040.63high mobility group box 2 [Source:HGNC Symbol;Acc:... [more]
HMGB29.421e-3040.63high mobility group box 2 [Source:HGNC Symbol;Acc:... [more]
HMGB11.020e-2740.85high mobility group box 1 [Source:HGNC Symbol;Acc:... [more]
HMGB11.020e-2740.85high mobility group box 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of High mobility group protein B1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmg-1.21.066e-2937.14High mobility group protein 1.2 [Source:UniProtKB... [more]
hmg-1.21.066e-2937.14High mobility group protein 1.2 [Source:UniProtKB... [more]
hmg-1.21.418e-2936.72High mobility group protein 1.2 [Source:UniProtKB... [more]
hmg-1.21.543e-2936.72High mobility group protein 1.2 [Source:UniProtKB... [more]
hmg-1.21.543e-2936.72High mobility group protein 1.2 [Source:UniProtKB... [more]
back to top
BLAST of High mobility group protein B1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dsp19.450e-3041.32gene:FBgn0278608 transcript:FBtr0089259[more]
Dsp19.450e-3041.32gene:FBgn0278608 transcript:FBtr0089260[more]
Dsp19.450e-3041.32gene:FBgn0278608 transcript:FBtr0089261[more]
Dsp19.599e-3041.32gene:FBgn0278608 transcript:FBtr0089262[more]
Dsp19.599e-3041.32gene:FBgn0278608 transcript:FBtr0339766[more]
back to top
BLAST of High mobility group protein B1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmgb2b5.192e-3036.46high mobility group box 2b [Source:ZFIN;Acc:ZDB-GE... [more]
hmgb2b5.192e-3036.46high mobility group box 2b [Source:ZFIN;Acc:ZDB-GE... [more]
hmgb3b3.562e-2737.25high mobility group box 3b [Source:ZFIN;Acc:ZDB-GE... [more]
hmgb3b3.562e-2737.25high mobility group box 3b [Source:ZFIN;Acc:ZDB-GE... [more]
hmgb1a4.047e-2742.07high mobility group box 1a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of High mobility group protein B1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cep170b1.057e-2940.24centrosomal protein 170B [Source:Xenbase;Acc:XB-GE... [more]
hmgb21.070e-2740.00high mobility group box 2 [Source:NCBI gene;Acc:39... [more]
hmgb32.274e-2636.81high mobility group box 3 [Source:NCBI gene;Acc:44... [more]
hmgb31.623e-2539.86high mobility group box 3 [Source:NCBI gene;Acc:44... [more]
back to top
BLAST of High mobility group protein B1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hmgb25.106e-3041.25high mobility group box 2 [Source:MGI Symbol;Acc:M... [more]
Hmgb11.063e-2840.72high mobility group box 1 [Source:MGI Symbol;Acc:M... [more]
Hmgb17.006e-2840.85high mobility group box 1 [Source:MGI Symbol;Acc:M... [more]
Hmgb17.006e-2840.85high mobility group box 1 [Source:MGI Symbol;Acc:M... [more]
Hmgb17.006e-2840.85high mobility group box 1 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of High mobility group protein B1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P52925|HMGB2_RAT2.692e-2941.45High mobility group protein B2 OS=Rattus norvegicu... [more]
sp|P30681|HMGB2_MOUSE3.572e-2941.25High mobility group protein B2 OS=Mus musculus OX=... [more]
sp|P26583|HMGB2_HUMAN4.524e-2940.63High mobility group protein B2 OS=Homo sapiens OX=... [more]
sp|P40673|HMGB2_BOVIN4.524e-2940.63High mobility group protein B2 OS=Bos taurus OX=99... [more]
sp|P26584|HMGB2_CHICK1.189e-2841.45High mobility group protein B2 OS=Gallus gallus OX... [more]
back to top
BLAST of High mobility group protein B1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H1118.060e-4954.86Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H2Y99.003e-4954.86Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267EBY11.147e-4854.86Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8IAE51.180e-4854.86Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IJA41.388e-4755.95Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of High mobility group protein B1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000044228.12.512e-3042.41high mobility group protein B2-like [Source:NCBI g... [more]
hmgb2a4.989e-3042.58high mobility group box 2 [Source:NCBI gene;Acc:11... [more]
hmgb1a2.657e-2942.33high mobility group-T protein-like [Source:NCBI ge... [more]
hmgb1b2.983e-2840.74high mobility group protein B1-like [Source:NCBI g... [more]
hmgb3a1.161e-2332.12high mobility group protein B3 [Source:NCBI gene;A... [more]
back to top
BLAST of High mobility group protein B1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hmgb2a2.310e-3044.00high mobility group box 2a [Source:ZFIN;Acc:ZDB-GE... [more]
hmgb2b7.005e-2638.36high mobility group box 2b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of High mobility group protein B1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
NHP6A1.713e-1142.86High-mobility group (HMG) protein; binds to and re... [more]
NHP6B6.488e-1142.86High-mobility group (HMG) protein; binds to and re... [more]
back to top
BLAST of High mobility group protein B1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO360282.736e-1630.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393051.148e-828.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO472303.771e-740.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410321.329e-637.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of High mobility group protein B1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hmgb2a1.002e-2739.29high mobility group protein B2 [Source:NCBI gene;A... [more]
hmgb1a4.764e-2739.87high mobility group-T protein [Source:NCBI gene;Ac... [more]
hmgb1b5.630e-2639.74high mobility group protein B1 [Source:NCBI gene;A... [more]
back to top
BLAST of High mobility group protein B1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000034017.11.922e-119100.00SMESG000034017.1[more]
SMESG000052032.17.464e-5955.06SMESG000052032.1[more]
SMESG000068286.15.136e-4244.58SMESG000068286.1[more]
SMESG000023365.19.134e-3746.25SMESG000023365.1[more]
SMESG000043905.14.048e-2445.79SMESG000043905.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30020070 ID=SMED30020070|Name=High mobility group protein B1|organism=Schmidtea mediterranea sexual|type=transcript|length=1454bp
GTTTTATATAAAATTGAATGAAACAATCACAAATGGATTCTTCAACAGGC
AAATCAAATAAACTTGCAATGACCGCTTATACATACTTTGTTAAGTTAAT
TAGAGATGAGCATAGAAAAAAGCACCCTGAAGAGCAATTTGATTTTACCG
AATTTTCTGCAAAATGTGCTGAAAAATGGAAATCAATGAAACCAGAAGAA
AGAAAACGTTTTGAAGAGTTAGCATCAGAAGAAAATGATAAAAAACCCCC
TGGCAGAAAGAAGCGAACTAGGAAACGCCAGAAAAAAGCTCCAGGCCAAC
CCAAACGTGCTTGGTCGGCATTTTTTTATTTTTGCGATGAACGACGACCT
AAAGTTCGTAAAGAACATCCTGATTGGCGAGTGGCAGAAGTAGCCAGAGA
GTTGGGAAGATTATGGGAAGCATGCTCAGACAGAGATCGCTATGAAAAAA
TGGCAACGTTAGATAAAGAAAGATATGAAAAAGAAATGGAGCAATTTCGT
GCCGGTAACTTTGTAGCAGGAGAAACTAAACGTCCAAAGCTTGATAATCA
AGATGATTCGATTCACGATGATGAAGACGAAGAGGAAGAAGAAGTGGACA
ATGAAGTACCAAATGAAATCACCGAAAAAACTGGTGAATCTTCGACTGTC
AATGCGAATAAATCGGAGCATTGCGTATCTTGATTTTTTCTCTGTACAAA
TAATCACTGTTTTTGAATATTAAGTATTTTAGAAATTAGTAGATATCGTT
GTATCGTTGTTGTGTTGAAGCATGATAAATGTGTATTATAAATATTAATT
GTTTTTTTTGTGATTGAATAATAAATATTTAGTTTTAATGTCATTGGATG
ATGGGCTTTCGATTGATTGGTTAATTGCTTGTGTGTGCGTGTGTGTGCTT
CATGGGTTGTGTGAGTTTGTGTAATTTAATATACAACATTTGGAATCGGA
AGTCAGGTAAAAATTTGCCATTGTTTTATTGGCTGACGAAGTTTTACAAA
GTTTTGTGGAAAAAATTTATTTTTTGCATGTAGATTATTTTGATGTACAA
AATTCTGAAAAATTTTCAATGTATATATTTGGTGCTTGAAGGTTTCATCG
GCGTTGAATTTGTTATCAATAACCATATTTAGTATTTAATGTTGTTTTTC
GGACGGTGGCTAATTATATGGAATTTGTGTTTTGCATTCTGTTCTTATAA
TTTAGCTGTTTATTTTATTGTTAAGAATATAAAGTCGAGTATAGTTAGAA
TCGTGAAATTCACAGATTTTATCATTAAAAAAAGCATTGTTAAATTATAG
ACAATTTGATTGTATTTGTATTATAGTTAAAGTTCTAGTATTTTCATGCA
GAAGCTATAGCTGGAAATACACAGTTAAATATAAAACAGTCATTTAATTG
TTATTAATAATTTCAACCTTTTATTTATAAATGCACTAGTTCAGCGATTT
TCAA
back to top

protein sequence of SMED30020070-orf-1

>SMED30020070-orf-1 ID=SMED30020070-orf-1|Name=SMED30020070-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=222bp
MKQSQMDSSTGKSNKLAMTAYTYFVKLIRDEHRKKHPEEQFDFTEFSAKC
AEKWKSMKPEERKRFEELASEENDKKPPGRKKRTRKRQKKAPGQPKRAWS
AFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDRYEKMATLDK
ERYEKEMEQFRAGNFVAGETKRPKLDNQDDSIHDDEDEEEEEVDNEVPNE
ITEKTGESSTVNANKSEHCVS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002013Category 1 cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036910HMG_box_dom_sf
IPR009071HMG_box_dom
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00886HIGHMOBLTY12coord: 44..66
score: 52.66
coord: 109..127
score: 35.28
coord: 127..146
score: 22.04
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 55..77
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 78..92
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 163..220
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 55..95
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 180..196
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 201..220
NoneNo IPR availablePANTHERPTHR13711SWI/SNF-RELATED CHROMATIN BINDING PROTEINcoord: 10..204
NoneNo IPR availableCDDcd01390HMGB-UBF_HMG-boxcoord: 94..157
e-value: 1.99068E-17
score: 71.5049
NoneNo IPR availableCDDcd01390HMGB-UBF_HMG-boxcoord: 14..71
e-value: 8.25373E-9
score: 48.393
IPR009071High mobility group box domainSMARTSM00398hmgende2coord: 93..161
e-value: 6.6E-19
score: 78.8
coord: 12..92
e-value: 7.2E-8
score: 42.1
IPR009071High mobility group box domainPFAMPF09011HMG_box_2coord: 14..71
e-value: 1.5E-11
score: 44.7
IPR009071High mobility group box domainPFAMPF00505HMG_boxcoord: 94..160
e-value: 1.5E-17
score: 63.8
IPR009071High mobility group box domainPROSITEPS50118HMG_BOX_2coord: 94..160
score: 17.588
IPR009071High mobility group box domainPROSITEPS50118HMG_BOX_2coord: 13..74
score: 11.125
IPR036910High mobility group box domain superfamilyGENE3DG3DSA:1.10.30.10coord: 92..162
e-value: 4.0E-22
score: 80.4
IPR036910High mobility group box domain superfamilyGENE3DG3DSA:1.10.30.10coord: 8..76
e-value: 9.7E-18
score: 66.3
IPR036910High mobility group box domain superfamilySUPERFAMILYSSF47095HMG-boxcoord: 85..162
IPR036910High mobility group box domain superfamilySUPERFAMILYSSF47095HMG-boxcoord: 14..71